F332296

General Info

Members Datasets Scaffolds Average Seq Length
220 159 440 248

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10000687|Ga0213876_1000068723
Length 274
Sequence MWLVACILLRTARNHLAHNKGELTNMPNYRFGKQPPKADYRTLRFKDYLEPGINAPPPSYNVLTRVYNEVQTNDPTQLFPMDGNDTLGDCTIAALAHSITTFRGLIDAKPVIMPKQAVVKLYYHLTGGIDSGLQELDVLNYWRKTSVNGDKILGYVKIDPKNHTHVQQAIEMFGGVYIGFQVQQNCVDEFNAHQPWTPGPLTNDGHAVFAVGYDENGVTVLTWGNTQQATWAWWDECVDEAYAILPPEAKSNPGAFAPGFNFAQLQTDLQAIAA

Samples

Sample ID Description Type Environment
1 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
33 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300019161 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
47 3300019182 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
48 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
49 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
50 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
51 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
52 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
53 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
80 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
81 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
82 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
86 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
91 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
93 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
94 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
95 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
96 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
97 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
99 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
100 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
110 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
111 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
112 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
113 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
114 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
115 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
116 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
117 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
118 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
124 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
127 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
128 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
133 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
134 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
135 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
136 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
137 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
138 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
139 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
144 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
145 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
155 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
156 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
157 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
158 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
159 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.55
Metatranscriptomes 5.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.55
Rhizosphere 92.27
Stem 0
Stem Tuber 0
Unclassified 18.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213876_10000687 3300021384 Bacteria 23935
2 rootH2_10348893 3300003320 Bacteria 1245
3 Ga0058861_10076632 3300004800 Bacteria 820
4 Ga0058862_12870232 3300004803 Bacteria 924
5 Ga0065715_10386624 3300005293 Bacteria 884
6 Ga0070690_100046140 3300005330 Bacteria 2770
7 Ga0068868_100031936 3300005338 Bacteria 4048
8 Ga0068868_100068457 3300005338 Bacteria 2827
9 Ga0070671_100283100 3300005355 Bacteria 1410
10 Ga0070667_100125955 3300005367 Bacteria 2232
11 Ga0070709_10048434 3300005434 Bacteria 2652
12 Ga0070709_10094493 3300005434 Unclassified 1978
13 Ga0070714_100010610 3300005435 Bacteria 7289
14 Ga0070714_100024610 3300005435 Bacteria 4961
15 Ga0070714_100042044 3300005435 Bacteria 3859
16 Ga0070714_100113521 3300005435 Bacteria 2402
17 Ga0070714_100125376 3300005435 Bacteria 2289
18 Ga0070713_100000539 3300005436 Bacteria 23992
19 Ga0070713_100108082 3300005436 Unclassified 2421
20 Ga0070713_100495331 3300005436 Bacteria 1152
21 Ga0070710_10027335 3300005437 Bacteria 3041
22 Ga0070710_10106119 3300005437 Bacteria 1680
23 Ga0070711_100001037 3300005439 Bacteria 14784
24 Ga0070711_100011676 3300005439 Bacteria 5460
25 Ga0070711_100083879 3300005439 Bacteria 2278
26 Ga0070705_100329220 3300005440 Bacteria 1106
27 Ga0070708_100049054 3300005445 Bacteria 3734
28 Ga0070706_100197097 3300005467 Bacteria 1881
29 Ga0070707_100040913 3300005468 Bacteria 4434
30 Ga0070707_100182664 3300005468 Bacteria 2045
31 Ga0070672_100347282 3300005543 Bacteria 1264
32 Ga0068857_100187790 3300005577 Unclassified 1882
33 Ga0068857_100691457 3300005577 Unclassified 969
34 Ga0068856_100150533 3300005614 Bacteria 2336
35 Ga0068856_100200937 3300005614 Unclassified 2008
36 Ga0068856_100223173 3300005614 Bacteria 1900
37 Ga0068866_10227749 3300005718 Bacteria 1129
38 Ga0068858_100039915 3300005842 Bacteria 4352
39 Ga0068858_100435569 3300005842 Unclassified 1262
40 Ga0068860_100047684 3300005843 Bacteria 4082
41 Ga0070717_10036267 3300006028 Bacteria 3998
42 Ga0070717_10214868 3300006028 Unclassified 1689
43 Ga0070715_10002892 3300006163 Bacteria 5358
44 Ga0070715_10152648 3300006163 Bacteria 1133
45 Ga0070716_100002416 3300006173 Bacteria 8595
46 Ga0070716_100068287 3300006173 Bacteria 2079
47 Ga0070716_100408561 3300006173 Unclassified 978
48 Ga0070712_100000231 3300006175 Bacteria 31391
49 Ga0070712_100015882 3300006175 Unclassified 4854
50 Ga0097621_100287997 3300006237 Bacteria 1447
51 Ga0075436_100121945 3300006914 Unclassified 1824
52 Ga0075436_100127024 3300006914 Bacteria 1787
53 Ga0075435_100064637 3300007076 Bacteria 2973
54 Ga0099794_10002374 3300007265 Bacteria 6931
55 Ga0099795_10000017 3300007788 Bacteria 63153
56 Ga0105245_10032717 3300009098 Bacteria 4604
57 Ga0105245_10195661 3300009098 Bacteria 1939
58 Ga0105247_10090124 3300009101 Bacteria 1945
59 Ga0105241_10030713 3300009174 Bacteria 4018
60 Ga0105241_10049552 3300009174 Bacteria 3199
61 Ga0105242_10047855 3300009176 Bacteria 3473
62 Ga0105248_10080665 3300009177 Bacteria 3657
63 Ga0105237_10548994 3300009545 Bacteria 1162
64 Ga0105238_10384640 3300009551 Bacteria 1395
65 Ga0099796_10000009 3300010159 Bacteria 63267
66 Ga0105239_10197543 3300010375 Bacteria 2253
67 Ga0157378_10085195 3300013297 Bacteria 2862
68 Ga0157378_10976496 3300013297 Bacteria 880
69 Ga0157379_10118578 3300014968 Bacteria 2380
70 Ga0157376_10044549 3300014969 Bacteria 3648
71 Ga0157376_10294486 3300014969 Bacteria 1534
72 Ga0157376_10346898 3300014969 Bacteria 1419
73 Ga0184602_131512 3300019161 Bacteria 808
74 Ga0184598_107161 3300019182 Unclassified 791
75 Ga0184603_148035 3300019192 Unclassified 813
76 Ga0213876_10017320 3300021384 Bacteria 3804
77 Ga0213875_10064924 3300021388 Bacteria 1706
78 Ga0224570_100294 3300022730 Bacteria 3796
79 Ga0247553_102980 3300023672 Unclassified 807
80 Ga0228598_1002851 3300024227 Bacteria 3753
81 Ga0207692_10400712 3300025898 Bacteria 855
82 Ga0207685_10000685 3300025905 Bacteria 6080
83 Ga0207654_10217395 3300025911 Bacteria 1266
84 Ga0207693_10000623 3300025915 Bacteria 31692
85 Ga0207693_10007063 3300025915 Bacteria 9268
86 Ga0207693_10287560 3300025915 Bacteria 1288
87 Ga0207663_10001143 3300025916 Bacteria 12233
88 Ga0207663_10041088 3300025916 Bacteria 2816
89 Ga0207646_10009753 3300025922 Bacteria 9461
90 Ga0207646_10103071 3300025922 Bacteria 2559
91 Ga0207694_10509402 3300025924 Bacteria 1008
92 Ga0207700_10000482 3300025928 Bacteria 23403
93 Ga0207700_10086706 3300025928 Unclassified 2460
94 Ga0207700_10861945 3300025928 Unclassified 811
95 Ga0207664_10038264 3300025929 Bacteria 3718
96 Ga0207664_10058236 3300025929 Viruses 3073
97 Ga0207644_10150867 3300025931 Bacteria 1798
98 Ga0207704_10023118 3300025938 Bacteria 3344
99 Ga0207665_10006179 3300025939 Bacteria 7955
100 Ga0207665_10007061 3300025939 Bacteria 7436
101 Ga0207665_10451481 3300025939 Unclassified 987
102 Ga0207691_10739013 3300025940 Bacteria 829
103 Ga0207711_10063029 3300025941 Bacteria 3199
104 Ga0207651_10515787 3300025960 Bacteria 1035
105 Ga0207658_10072210 3300025986 Bacteria 2615
106 Ga0207677_10021342 3300026023 Bacteria 3955
107 Ga0207703_10410280 3300026035 Bacteria 1258
108 Ga0207708_10336398 3300026075 Unclassified 1235
109 Ga0207702_10067915 3300026078 Unclassified 3061
110 Ga0207702_10086163 3300026078 Bacteria 2739
111 Ga0207702_10204980 3300026078 Unclassified 1830
112 Ga0207674_10254563 3300026116 Bacteria 1703
113 Ga0207683_10016220 3300026121 Bacteria 6340
114 Ga0209179_1000001 3300027512 Bacteria 128813
115 Ga0209588_1003871 3300027671 Unclassified 4182
116 Ga0265356_1000031 3300028017 Bacteria 22210
117 Ga0268264_10070085 3300028381 Bacteria 2967
118 Ga0265337_1000856 3300028556 Bacteria 15971
119 Ga0265334_10001127 3300028573 Bacteria 13061
120 Ga0265322_10000957 3300028654 Bacteria 10036
121 Ga0265762_1001442 3300030760 Bacteria 4301
122 Ga0265762_1020794 3300030760 Bacteria 1208
123 Ga0265767_100631 3300030836 Bacteria 1531
124 Ga0265768_102327 3300030963 Unclassified 963
125 Ga0265768_102715 3300030963 Unclassified 920
126 Ga0265330_10002158 3300031235 Bacteria 10842
127 Ga0265339_10026940 3300031249 Bacteria 3288
128 Ga0265331_10158935 3300031250 Unclassified 1025
129 Ga0265316_10004107 3300031344 Bacteria 14579
130 Ga0265314_10138389 3300031711 Bacteria 1509
131 Ga0265342_10000260 3300031712 Bacteria 59291
132 Ga0316053_103321 3300032120 Unclassified 950
133 Ga0373934_0097385 3300035086 Bacteria 1188
134 Ga0373936_0008850 3300035113 Unclassified 3794
135 Ga0373946_0004611 3300035171 Bacteria 4941
136 Ga0373955_0011301 3300035172 Bacteria 4249
137 Ga0373924_0061568 3300035410 Bacteria 1571
138 Ga0373935_0078848 3300035692 Bacteria 2137
139 Ga0373935_0166920 3300035692 Unclassified 1503
140 Ga0373935_0376117 3300035692 Unclassified 1016
141 Ga0373935_0408145 3300035692 Unclassified 976
142 Ga0373927_0012784 3300035695 Bacteria 5584
143 Ga0373927_0123636 3300035695 Bacteria 1689
144 Ga0373933_0006590 3300035724 Bacteria 6328
145 Ga0373947_0004699 3300035725 Bacteria 8005
146 Ga0373937_0021824 3300036401 Bacteria 5748
147 Ga0373937_0044441 3300036401 Bacteria 4057
148 Ga0373925_0000260 3300037068 Bacteria 55009
149 Ga0373925_0004850 3300037068 Bacteria 10125
150 Ga0373925_0028832 3300037068 Bacteria 4070
151 Ga0395899_0074047 3300037312 Bacteria 2489
152 Ga0395900_0076417 3300037418 Bacteria 3442
153 Ga0395905_0091730 3300037471 Unclassified 2848
154 Ga0436364_0048250 3300037853 Bacteria 26887
155 Ga0395901_0528138 3300038443 Unclassified 1198
156 Ga0436365_0037699 3300039437 Bacteria 3800
157 Ga0436365_1757655 3300039437 Bacteria 40290
158 Ga0436360_0112851 3300039438 Unclassified 945
159 Ga0436361_0188010 3300039447 Bacteria 4094
160 Ga0436361_0612166 3300039447 Bacteria 1333
161 Ga0436362_0386755 3300039453 Bacteria 1232
162 Ga0436362_1084891 3300039453 Bacteria 2105
163 Ga0466969_0034088 3300044656 Bacteria 2580
164 Ga0466972_0029001 3300044658 Bacteria 2726
165 Ga0466965_0093455 3300044683 Bacteria 1532
166 Ga0466966_0079067 3300044684 Bacteria 2050
167 Ga0466966_0116123 3300044684 Bacteria 1647
168 Ga0466961_0003524 3300044693 Bacteria 9760
169 Ga0466961_0024316 3300044693 Bacteria 3897
170 Ga0466964_0021038 3300044706 Bacteria 2519
171 Ga0466971_0033154 3300044719 Bacteria 2314
172 Ga0466957_0094999 3300044842 Bacteria 1872
173 Ga0466959_0082392 3300045049 Bacteria 2317
174 Ga0466958_0302893 3300045836 Bacteria 1026
175 Ga0466967_1505682 3300045976 Unclassified 670
176 Ga0495592_0160470 3300046454 Bacteria 1547
177 Ga0495651_0000647 3300046462 Bacteria 26880
178 Ga0495651_0002733 3300046462 Bacteria 13676
179 Ga0495580_0000964 3300046472 Bacteria 25235
180 Ga0495580_0322471 3300046472 Unclassified 1050
181 Ga0495664_0074285 3300046477 Bacteria 2034
182 Ga0495608_0230569 3300046511 Bacteria 1159
183 Ga0495628_0000052 3300046516 Bacteria 91554
184 Ga0495630_0004220 3300046517 Bacteria 10068
185 Ga0495652_0343539 3300046529 Bacteria 1071
186 Ga0495640_0040554 3300046533 Bacteria 3260
187 Ga0495586_0128957 3300046535 Bacteria 1416
188 Ga0495587_0156177 3300046536 Bacteria 1299
189 Ga0495645_0027859 3300046543 Unclassified 4105
190 Ga0495645_0163229 3300046543 Bacteria 1539
191 Ga0495667_0026306 3300046559 Bacteria 3921
192 Ga0495635_0158767 3300046663 Bacteria 1539
193 Ga0495599_0024976 3300046678 Bacteria 3738
194 Ga0495658_0067516 3300046683 Unclassified 2068
195 Ga0495658_0147127 3300046683 Bacteria 1445
196 Ga0495624_0009340 3300046690 Bacteria 6795
197 Ga0495600_0104297 3300046809 Unclassified 1847
198 Ga0495604_0185021 3300047317 Bacteria 1455
199 Ga0495674_0210788 3300047319 Bacteria 1609
200 Ga0495680_0010996 3300047322 Bacteria 8040
201 Ga0495680_0084861 3300047322 Bacteria 2386
202 Ga0495675_0126256 3300047444 Bacteria 1592
203 Ga0495684_0031393 3300047471 Unclassified 4078
204 Ga0496100_0262443 3300048903 Bacteria 1281
205 Ga0496102_0285407 3300048905 Bacteria 1556
206 Ga0496102_0651692 3300048905 Unclassified 976
207 Ga0496104_0062293 3300048907 Bacteria 3537
208 Ga0496105_0019693 3300048908 Bacteria 5444
209 Ga0496105_0081718 3300048908 Bacteria 2669
210 Ga0496110_0121008 3300048913 Bacteria 2358
211 Ga0496111_0088088 3300048914 Bacteria 2273
212 Ga0496112_0386059 3300048915 Bacteria 1341
213 Ga0496114_0292840 3300048917 Bacteria 1436
214 nmdc:mga0rr50_30260_c2 3300050513 Bacteria 3433
215 nmdc:mga08x19_3195_c1 3300050514 Bacteria 9828
216 nmdc:mga08x19_54506_c1 3300050514 Unclassified 2574
217 Ga0495601_0133427 3300053077 Unclassified 1618
218 Ga0495595_0080906 3300053084 Bacteria 1547
219 Ga0495619_0207894 3300053085 Bacteria 1355
220 Ga0466962_0036175 3300061719 Bacteria 2362
221 Ga0213876_10000687
222 rootH2_10348893
223 Ga0058861_10076632
224 Ga0058862_12870232
225 Ga0065715_10386624
226 Ga0070690_100046140
227 Ga0068868_100031936
228 Ga0068868_100068457
229 Ga0070671_100283100
230 Ga0070667_100125955
231 Ga0070709_10048434
232 Ga0070709_10094493
233 Ga0070714_100010610
234 Ga0070714_100024610
235 Ga0070714_100042044
236 Ga0070714_100113521
237 Ga0070714_100125376
238 Ga0070713_100000539
239 Ga0070713_100108082
240 Ga0070713_100495331
241 Ga0070710_10027335
242 Ga0070710_10106119
243 Ga0070711_100001037
244 Ga0070711_100011676
245 Ga0070711_100083879
246 Ga0070705_100329220
247 Ga0070708_100049054
248 Ga0070706_100197097
249 Ga0070707_100040913
250 Ga0070707_100182664
251 Ga0070672_100347282
252 Ga0068857_100187790
253 Ga0068857_100691457
254 Ga0068856_100150533
255 Ga0068856_100200937
256 Ga0068856_100223173
257 Ga0068866_10227749
258 Ga0068858_100039915
259 Ga0068858_100435569
260 Ga0068860_100047684
261 Ga0070717_10036267
262 Ga0070717_10214868
263 Ga0070715_10002892
264 Ga0070715_10152648
265 Ga0070716_100002416
266 Ga0070716_100068287
267 Ga0070716_100408561
268 Ga0070712_100000231
269 Ga0070712_100015882
270 Ga0097621_100287997
271 Ga0075436_100121945
272 Ga0075436_100127024
273 Ga0075435_100064637
274 Ga0099794_10002374
275 Ga0099795_10000017
276 Ga0105245_10032717
277 Ga0105245_10195661
278 Ga0105247_10090124
279 Ga0105241_10030713
280 Ga0105241_10049552
281 Ga0105242_10047855
282 Ga0105248_10080665
283 Ga0105237_10548994
284 Ga0105238_10384640
285 Ga0099796_10000009
286 Ga0105239_10197543
287 Ga0157378_10085195
288 Ga0157378_10976496
289 Ga0157379_10118578
290 Ga0157376_10044549
291 Ga0157376_10294486
292 Ga0157376_10346898
293 Ga0184602_131512
294 Ga0184598_107161
295 Ga0184603_148035
296 Ga0213876_10017320
297 Ga0213875_10064924
298 Ga0224570_100294
299 Ga0247553_102980
300 Ga0228598_1002851
301 Ga0207692_10400712
302 Ga0207685_10000685
303 Ga0207654_10217395
304 Ga0207693_10000623
305 Ga0207693_10007063
306 Ga0207693_10287560
307 Ga0207663_10001143
308 Ga0207663_10041088
309 Ga0207646_10009753
310 Ga0207646_10103071
311 Ga0207694_10509402
312 Ga0207700_10000482
313 Ga0207700_10086706
314 Ga0207700_10861945
315 Ga0207664_10038264
316 Ga0207664_10058236
317 Ga0207644_10150867
318 Ga0207704_10023118
319 Ga0207665_10006179
320 Ga0207665_10007061
321 Ga0207665_10451481
322 Ga0207691_10739013
323 Ga0207711_10063029
324 Ga0207651_10515787
325 Ga0207658_10072210
326 Ga0207677_10021342
327 Ga0207703_10410280
328 Ga0207708_10336398
329 Ga0207702_10067915
330 Ga0207702_10086163
331 Ga0207702_10204980
332 Ga0207674_10254563
333 Ga0207683_10016220
334 Ga0209179_1000001
335 Ga0209588_1003871
336 Ga0265356_1000031
337 Ga0268264_10070085
338 Ga0265337_1000856
339 Ga0265334_10001127
340 Ga0265322_10000957
341 Ga0265762_1001442
342 Ga0265762_1020794
343 Ga0265767_100631
344 Ga0265768_102327
345 Ga0265768_102715
346 Ga0265330_10002158
347 Ga0265339_10026940
348 Ga0265331_10158935
349 Ga0265316_10004107
350 Ga0265314_10138389
351 Ga0265342_10000260
352 Ga0316053_103321
353 Ga0373934_0097385
354 Ga0373936_0008850
355 Ga0373946_0004611
356 Ga0373955_0011301
357 Ga0373924_0061568
358 Ga0373935_0078848
359 Ga0373935_0166920
360 Ga0373935_0376117
361 Ga0373935_0408145
362 Ga0373927_0012784
363 Ga0373927_0123636
364 Ga0373933_0006590
365 Ga0373947_0004699
366 Ga0373937_0021824
367 Ga0373937_0044441
368 Ga0373925_0000260
369 Ga0373925_0004850
370 Ga0373925_0028832
371 Ga0395899_0074047
372 Ga0395900_0076417
373 Ga0395905_0091730
374 Ga0436364_0048250
375 Ga0395901_0528138
376 Ga0436365_0037699
377 Ga0436365_1757655
378 Ga0436360_0112851
379 Ga0436361_0188010
380 Ga0436361_0612166
381 Ga0436362_0386755
382 Ga0436362_1084891
383 Ga0466969_0034088
384 Ga0466972_0029001
385 Ga0466965_0093455
386 Ga0466966_0079067
387 Ga0466966_0116123
388 Ga0466961_0003524
389 Ga0466961_0024316
390 Ga0466964_0021038
391 Ga0466971_0033154
392 Ga0466957_0094999
393 Ga0466959_0082392
394 Ga0466958_0302893
395 Ga0466967_1505682
396 Ga0495592_0160470
397 Ga0495651_0000647
398 Ga0495651_0002733
399 Ga0495580_0000964
400 Ga0495580_0322471
401 Ga0495664_0074285
402 Ga0495608_0230569
403 Ga0495628_0000052
404 Ga0495630_0004220
405 Ga0495652_0343539
406 Ga0495640_0040554
407 Ga0495586_0128957
408 Ga0495587_0156177
409 Ga0495645_0027859
410 Ga0495645_0163229
411 Ga0495667_0026306
412 Ga0495635_0158767
413 Ga0495599_0024976
414 Ga0495658_0067516
415 Ga0495658_0147127
416 Ga0495624_0009340
417 Ga0495600_0104297
418 Ga0495604_0185021
419 Ga0495674_0210788
420 Ga0495680_0010996
421 Ga0495680_0084861
422 Ga0495675_0126256
423 Ga0495684_0031393
424 Ga0496100_0262443
425 Ga0496102_0285407
426 Ga0496102_0651692
427 Ga0496104_0062293
428 Ga0496105_0019693
429 Ga0496105_0081718
430 Ga0496110_0121008
431 Ga0496111_0088088
432 Ga0496112_0386059
433 Ga0496114_0292840
434 nmdc:mga0rr50_30260_c2
435 nmdc:mga08x19_3195_c1
436 nmdc:mga08x19_54506_c1
437 Ga0495601_0133427
438 Ga0495595_0080906
439 Ga0495619_0207894
440 Ga0466962_0036175

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ois-assembly1.cif.gz_A crystal structure xylellain, a cysteine protease from xylella fastidiosa 0.7497 7 223
7s5j-assembly1.cif.gz_A solution nmr structure of substrate bound peptidase domain from pcat1 0.7263 68 225
7z3t-assembly3.cif.gz_C crystal structure of apo human cathepsin l 0.7235 36 223
2hxz-assembly2.cif.gz_B crystal structure of cathepsin s in complex with a nonpeptidic inhibitor (hexagonal spacegroup) 0.7222 35 223
6yi7-assembly1.cif.gz_A structure of cathepsin b1 from schistosoma mansoni (smcb1) in complex with an azanitrile inhibitor 0.7143 33 224
ID Description Score Start End Superfamily
3oisC00 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.7255 7 223 3.90.70.10
af_A0A0P0WQJ6_5_203_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.7235 67 210 3.90.70.10
af_Q7XUH7_10_233_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.7207 68 222 3.90.70.10
af_I1KLT2_20_339_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.7118 6 223 3.90.70.10
af_A3BJY0_5_184_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.7052 94 222 3.90.70.10
ID Description Score Start End GO Terms
AF-A0A2V9AH61-F1-model_v4 Peptidase C39-like domain-containing protein 0.9822 5 250
AF-A0A2V9AH61-F1-model_v4 Peptidase C39-like domain-containing protein 0.9783 5 250
AF-A0A6A8RIX5-F1-model_v4 deleted 0.9291 58 223
AF-A0A6A8RIX5-F1-model_v4 deleted 0.9015 58 223
AF-A0A2V9AFU2-F1-model_v4 Peptidase C1A papain C-terminal domain-containing protein 0.9014 9 132

Map