F332063

General Info

Members Datasets Scaffolds Average Seq Length
220 163 440 246

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10015920|Ga0081538_100159203
Length 281
Sequence LKLREQLIILFIKDIYVDLKPAKFKDHFSTTSKEYASSRPKYPRPLFEFLVGLVQRRNLAWDCATGNGQAAVLLAEHFDQVVASDASKEQIENAQPRNNIRYEVFPAERANLADNSVDLITIAQALHWFDLDDFYKEAKRVLRKNGKDGSGGRSGGGVLAAWAYGLHSISREVDNITHSLYEDILGPYWPKERKIVENRYEGIPFPFEEIDTPVFRIELDWSLSELIAYLYTWSSVQGFIKKNKSDPVKQVYDELASAWGEKKNRQTRRVVWPIHMRVGRP

Samples

Sample ID Description Type Environment
1 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
4 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
5 3300003399 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
89 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
94 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
95 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
96 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
101 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
102 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
103 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
104 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
105 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
106 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
107 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
108 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
111 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
112 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
113 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
114 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
115 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
116 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
117 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
118 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
119 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
120 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
123 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
124 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
130 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
131 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
132 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
133 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
134 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
135 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
136 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
137 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
138 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
139 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
140 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
143 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
144 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
145 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
146 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
153 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
154 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
155 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
156 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
157 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
158 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
159 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
160 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
161 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
162 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
163 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.09
Metatranscriptomes 0
Isolates 0.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.82
Nodule 0
Rhizoplane 1.36
Rhizosphere 95.91
Stem 0
Stem Tuber 0
Unclassified 7.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081538_10015920 3300005981 Archaea 5795
2 MBSR1b_contig_2313008 2162886012 Bacteria 1184
3 CNXas_1000115 3300000545 Bacteria 14787
4 JGI26145J50221_1000864 3300003371 Archaea 2447
5 JGI26136J50244_100501 3300003399 Archaea 1340
6 Ga0065715_10160783 3300005293 Unclassified 1631
7 Ga0070658_10001451 3300005327 Bacteria 20221
8 Ga0070658_10064327 3300005327 Bacteria 2992
9 Ga0070676_10076734 3300005328 Bacteria 2018
10 Ga0070676_10270260 3300005328 Archaea 1141
11 Ga0070690_100043770 3300005330 Unclassified 2840
12 Ga0068869_100051617 3300005334 Bacteria 2984
13 Ga0070680_100005920 3300005336 Bacteria 9282
14 Ga0070680_100026421 3300005336 Archaea 4644
15 Ga0070692_10007012 3300005345 Archaea 4937
16 Ga0070675_100327885 3300005354 Archaea 1353
17 Ga0070671_100252245 3300005355 Bacteria 1499
18 Ga0070659_100210224 3300005366 Archaea 1603
19 Ga0070659_100311313 3300005366 Bacteria 1315
20 Ga0070709_10287300 3300005434 Unclassified 1197
21 Ga0070711_100390628 3300005439 Bacteria 1127
22 Ga0070705_100012025 3300005440 Archaea 4385
23 Ga0070700_100058893 3300005441 Bacteria 2415
24 Ga0070708_100396584 3300005445 Bacteria 1301
25 Ga0070678_100689439 3300005456 Unclassified 919
26 Ga0070662_100267383 3300005457 Archaea 1379
27 Ga0070681_10217408 3300005458 Bacteria 1827
28 Ga0070681_10284799 3300005458 Archaea 1563
29 Ga0068867_100035477 3300005459 Archaea 3617
30 Ga0070706_100022362 3300005467 Bacteria 5823
31 Ga0070698_100087167 3300005471 Bacteria 3108
32 Ga0070679_100108729 3300005530 Archaea 2759
33 Ga0070672_100113623 3300005543 Archaea 2210
34 Ga0070695_100268413 3300005545 Unclassified 1249
35 Ga0070696_100007353 3300005546 Archaea 7354
36 Ga0070693_100011662 3300005547 Archaea 4430
37 Ga0070704_100196297 3300005549 Bacteria 1626
38 Ga0070702_100003190 3300005615 Archaea 7278
39 Ga0068859_100205277 3300005617 Bacteria 2056
40 Ga0068864_100072294 3300005618 Archaea 3005
41 Ga0068870_10002048 3300005840 Archaea 8335
42 Ga0068870_10223284 3300005840 Archaea 1154
43 Ga0068860_100552077 3300005843 Archaea 1154
44 Ga0068862_100279929 3300005844 Archaea 1528
45 Ga0081455_10389443 3300005937 Bacteria 971
46 Ga0075366_10065919 3300006195 Bacteria 2154
47 Ga0097621_100537871 3300006237 Archaea 1062
48 Ga0075428_100041355 3300006844 Bacteria 5070
49 Ga0075428_100076747 3300006844 Bacteria 3648
50 Ga0075428_100114876 3300006844 Archaea 2932
51 Ga0075430_100363039 3300006846 Bacteria 1196
52 Ga0075431_100057089 3300006847 Bacteria 4026
53 Ga0075431_100280017 3300006847 Bacteria 1688
54 Ga0075431_100326211 3300006847 Bacteria 1547
55 Ga0075433_10011416 3300006852 Bacteria 7153
56 Ga0075433_10026663 3300006852 Bacteria 4896
57 Ga0075434_100000279 3300006871 Bacteria 36373
58 Ga0075429_100017450 3300006880 Bacteria 6207
59 Ga0075429_100043579 3300006880 Bacteria 3905
60 Ga0075429_100073298 3300006880 Archaea 2982
61 Ga0075429_100675231 3300006880 Archaea 905
62 Ga0068865_100036390 3300006881 Archaea 3319
63 Ga0068865_100243771 3300006881 Archaea 1415
64 Ga0097620_100205262 3300006931 Bacteria 2056
65 Ga0105240_10121646 3300009093 Bacteria 3142
66 Ga0114129_10015338 3300009147 Bacteria 10902
67 Ga0114129_10025966 3300009147 Bacteria 8296
68 Ga0114129_10107363 3300009147 Bacteria 3856
69 Ga0114129_10219917 3300009147 Archaea 2563
70 Ga0114129_10387113 3300009147 Bacteria 1845
71 Ga0105238_10195788 3300009551 Bacteria 1997
72 Ga0105246_10002580 3300011119 Archaea 10958
73 Ga0105246_10027330 3300011119 Archaea 3737
74 Ga0157369_10099591 3300013105 Unclassified 3098
75 Ga0157374_10201821 3300013296 Unclassified 1947
76 Ga0157378_10022196 3300013297 Archaea 5586
77 Ga0157378_10325729 3300013297 Bacteria 1494
78 Ga0163162_10733013 3300013306 Archaea 1108
79 Ga0157372_10025198 3300013307 Bacteria 6465
80 Ga0157372_10199834 3300013307 Bacteria 2315
81 Ga0163163_10228525 3300014325 Bacteria 1909
82 Ga0207647_10045967 3300025904 Archaea 2722
83 Ga0207699_10046723 3300025906 Bacteria 2534
84 Ga0207645_10060052 3300025907 Bacteria 2428
85 Ga0207643_10000731 3300025908 Archaea 20164
86 Ga0207643_10010586 3300025908 Bacteria 4966
87 Ga0207643_10220452 3300025908 Archaea 1161
88 Ga0207705_10001559 3300025909 Bacteria 18205
89 Ga0207705_10080291 3300025909 Unclassified 2377
90 Ga0207684_10019054 3300025910 Bacteria 5870
91 Ga0207707_10157514 3300025912 Bacteria 1986
92 Ga0207707_10239126 3300025912 Archaea 1579
93 Ga0207652_10465855 3300025921 Archaea 1139
94 Ga0207659_10455791 3300025926 Archaea 1078
95 Ga0207706_10026402 3300025933 Archaea 5199
96 Ga0207669_10536505 3300025937 Archaea 942
97 Ga0207708_10046805 3300026075 Archaea 3294
98 Ga0207648_10003794 3300026089 Archaea 15793
99 Ga0207648_10007138 3300026089 Archaea 11017
100 Ga0209969_1001919 3300027360 Archaea 2856
101 Ga0209967_1000850 3300027364 Archaea 3927
102 Ga0209981_1000534 3300027378 Archaea 4838
103 Ga0209996_1000175 3300027395 Archaea 8197
104 Ga0209984_1000853 3300027424 Archaea 3265
105 Ga0209984_1001863 3300027424 Bacteria 2324
106 Ga0210000_1002480 3300027462 Archaea 2627
107 Ga0209999_1000452 3300027543 Bacteria 6333
108 Ga0209982_1000235 3300027552 Bacteria 6565
109 Ga0209982_1003006 3300027552 Bacteria 2381
110 Ga0209970_1014076 3300027614 Unclassified 1328
111 Ga0209971_1004186 3300027682 Archaea 3422
112 Ga0209971_1009290 3300027682 Bacteria 2330
113 Ga0209971_1014184 3300027682 Bacteria 1889
114 Ga0209966_1020178 3300027695 Archaea 1289
115 Ga0209998_10000645 3300027717 Archaea 9353
116 Ga0209998_10010155 3300027717 Archaea 1949
117 Ga0209974_10000052 3300027876 Archaea 29511
118 Ga0209974_10024480 3300027876 Archaea 1998
119 Ga0207428_10040379 3300027907 Archaea 3786
120 Ga0207428_10141347 3300027907 Bacteria 1837
121 Ga0307408_100549341 3300031548 Bacteria 1019
122 Ga0307508_10003214 3300031616 Bacteria 16703
123 Ga0316575_10037696 3300031665 Bacteria 1905
124 Ga0307413_10058473 3300031824 Archaea 2363
125 Ga0307409_100075034 3300031995 Bacteria 2706
126 Ga0307409_100099576 3300031995 Archaea 2407
127 Ga0307409_100434245 3300031995 Unclassified 1263
128 Ga0307416_100072676 3300032002 Bacteria 2864
129 Ga0307416_100637389 3300032002 Bacteria 1149
130 Ga0316583_10005640 3300032133 Bacteria 4500
131 Ga0373943_0169364 3300035170 Bacteria 1194
132 Ga0373935_0032959 3300035692 Bacteria 3222
133 Ga0373947_0152720 3300035725 Bacteria 1488
134 Ga0373937_0608114 3300036401 Bacteria 1038
135 Ga0395905_0097550 3300037471 Bacteria 2760
136 Ga0395901_0199437 3300038443 Bacteria 2098
137 Ga0400483_265803 3300039062 Bacteria 1667
138 Ga0439436_0019019 3300041404 Bacteria 2052
139 Ga0439452_050432 3300042010 Archaea 955
140 Ga0439457_001674 3300042014 Bacteria 6577
141 Ga0450923_040151 3300042125 Archaea 981
142 Ga0439464_0009450 3300042439 Archaea 2567
143 Ga0451577_0047792 3300042876 Bacteria 3825
144 Ga0466972_0000207 3300044658 Bacteria 42277
145 Ga0453683_0027494 3300044673 Bacteria 3608
146 Ga0453683_0030673 3300044673 Unclassified 3398
147 Ga0453683_0074454 3300044673 Bacteria 2126
148 Ga0451576_0015367 3300045051 Bacteria 8481
149 Ga0451576_0052821 3300045051 Bacteria 4258
150 Ga0451576_0063641 3300045051 Bacteria 3844
151 Ga0451576_0166518 3300045051 Bacteria 2300
152 Ga0451576_0526632 3300045051 Bacteria 1242
153 Ga0495580_0067899 3300046472 Bacteria 2494
154 Ga0495662_0020210 3300046476 Bacteria 3221
155 Ga0495666_0064706 3300046526 Bacteria 1745
156 Ga0495665_0047412 3300046531 Bacteria 2279
157 Ga0495586_0134232 3300046535 Bacteria 1387
158 Ga0495625_0086990 3300046660 Bacteria 2167
159 Ga0495659_0019326 3300046664 Archaea 2280
160 Ga0495647_0017518 3300046681 Unclassified 2536
161 Ga0495647_0019063 3300046681 Bacteria 2450
162 Ga0495672_0074108 3300047320 Bacteria 1918
163 Ga0495684_0016887 3300047471 Bacteria 5624
164 Ga0495686_0014474 3300047472 Bacteria 5426
165 Ga0496102_0104725 3300048905 Bacteria 2632
166 Ga0496114_0182940 3300048917 Bacteria 1831
167 Ga0496115_0592856 3300048918 Bacteria 882
168 Ga0501037_0049278 3300049573 Archaea 3085
169 Ga0501039_0041814 3300049575 Archaea 3541
170 Ga0501041_0026341 3300049577 Archaea 3497
171 Ga0501042_0138315 3300049578 Archaea 1755
172 Ga0501043_0085211 3300049579 Archaea 2483
173 Ga0501068_0354943 3300049584 Bacteria 943
174 Ga0501071_0616971 3300049587 Bacteria 834
175 Ga0501075_0347122 3300049591 Archaea 1131
176 Ga0501076_0014095 3300049592 Archaea 6011
177 Ga0501077_0214158 3300049593 Archaea 1224
178 Ga0501202_005236 3300049652 Bacteria 2296
179 Ga0501217_069273 3300049661 Unclassified 957
180 Ga0501256_009207 3300049685 Unclassified 930
181 Ga0501221_009890 3300049704 Archaea 1682
182 Ga0501234_004172 3300049707 Archaea 2264
183 Ga0501245_022026 3300049708 Archaea 1004
184 Ga0501079_0164558 3300049741 Archaea 1730
185 Ga0501083_0001682 3300049744 Bacteria 15104
186 Ga0501265_007327 3300049762 Archaea 1298
187 Ga0501275_011199 3300049772 Archaea 970
188 Ga0501282_010324 3300049778 Archaea 1002
189 Ga0501045_0022337 3300049824 Archaea 4529
190 nmdc:mga0k408_198993_c1 3300050493 Bacteria 1196
191 nmdc:mga0k408_388610_c1 3300050493 Unclassified 831
192 nmdc:mga05p37_116166_c1 3300050507 Archaea 3289
193 nmdc:mga05p37_148872_c1 3300050507 Bacteria 2865
194 nmdc:mga05p37_185949_c1 3300050507 Archaea 2526
195 nmdc:mga05p37_537210_c1 3300050507 Bacteria 1334
196 nmdc:mga05p37_542578_c1 3300050507 Bacteria 1326
197 nmdc:mga05p37_676912_c1 3300050507 Bacteria 1151
198 nmdc:mga09592_14587_c1 3300050508 Bacteria 6414
199 nmdc:mga09592_232829_c1 3300050508 Bacteria 1596
200 nmdc:mga0qj67_451576_c1 3300050509 Archaea 1035
201 nmdc:mga06r32_174718_c1 3300050510 Bacteria 2132
202 nmdc:mga06r32_412382_c1 3300050510 Bacteria 1332
203 nmdc:mga06r32_53739_c1 3300050510 Bacteria 3860
204 nmdc:mga08y16_129946_c1 3300050511 Archaea 2620
205 nmdc:mga08y16_255194_c1 3300050511 Archaea 1812
206 nmdc:mga08y16_44977_c1 3300050511 Archaea 4626
207 nmdc:mga0n895_2442_c1 3300050512 Bacteria 14515
208 nmdc:mga0n895_47653_c1 3300050512 Bacteria 4191
209 nmdc:mga08x19_77960_c1 3300050514 Bacteria 2170
210 nmdc:mga0a205_2936_c1 3300050515 Bacteria 15104
211 Ga0500568_0000231 3300053139 Bacteria 47879
212 Ga0501084_0109901 3300054114 Archaea 2316
213 Ga0590074_025428 3300059423 Archaea 1032
214 Ga0590075_066834 3300059424 Unclassified 928
215 Ga0590077_016774 3300059426 Archaea 1537
216 Ga0590077_023138 3300059426 Archaea 1328
217 Ga0501082_0358571 3300060353 Bacteria 1272
218 Ga0530510_0048625 3300061734 Archaea 3066
219 2889419226 2889415604 Bacteria 8048700
220 2920111769 2920107658 Bacteria 10042636
221 Ga0081538_10015920
222 MBSR1b_contig_2313008
223 CNXas_1000115
224 JGI26145J50221_1000864
225 JGI26136J50244_100501
226 Ga0065715_10160783
227 Ga0070658_10001451
228 Ga0070658_10064327
229 Ga0070676_10076734
230 Ga0070676_10270260
231 Ga0070690_100043770
232 Ga0068869_100051617
233 Ga0070680_100005920
234 Ga0070680_100026421
235 Ga0070692_10007012
236 Ga0070675_100327885
237 Ga0070671_100252245
238 Ga0070659_100210224
239 Ga0070659_100311313
240 Ga0070709_10287300
241 Ga0070711_100390628
242 Ga0070705_100012025
243 Ga0070700_100058893
244 Ga0070708_100396584
245 Ga0070678_100689439
246 Ga0070662_100267383
247 Ga0070681_10217408
248 Ga0070681_10284799
249 Ga0068867_100035477
250 Ga0070706_100022362
251 Ga0070698_100087167
252 Ga0070679_100108729
253 Ga0070672_100113623
254 Ga0070695_100268413
255 Ga0070696_100007353
256 Ga0070693_100011662
257 Ga0070704_100196297
258 Ga0070702_100003190
259 Ga0068859_100205277
260 Ga0068864_100072294
261 Ga0068870_10002048
262 Ga0068870_10223284
263 Ga0068860_100552077
264 Ga0068862_100279929
265 Ga0081455_10389443
266 Ga0075366_10065919
267 Ga0097621_100537871
268 Ga0075428_100041355
269 Ga0075428_100076747
270 Ga0075428_100114876
271 Ga0075430_100363039
272 Ga0075431_100057089
273 Ga0075431_100280017
274 Ga0075431_100326211
275 Ga0075433_10011416
276 Ga0075433_10026663
277 Ga0075434_100000279
278 Ga0075429_100017450
279 Ga0075429_100043579
280 Ga0075429_100073298
281 Ga0075429_100675231
282 Ga0068865_100036390
283 Ga0068865_100243771
284 Ga0097620_100205262
285 Ga0105240_10121646
286 Ga0114129_10015338
287 Ga0114129_10025966
288 Ga0114129_10107363
289 Ga0114129_10219917
290 Ga0114129_10387113
291 Ga0105238_10195788
292 Ga0105246_10002580
293 Ga0105246_10027330
294 Ga0157369_10099591
295 Ga0157374_10201821
296 Ga0157378_10022196
297 Ga0157378_10325729
298 Ga0163162_10733013
299 Ga0157372_10025198
300 Ga0157372_10199834
301 Ga0163163_10228525
302 Ga0207647_10045967
303 Ga0207699_10046723
304 Ga0207645_10060052
305 Ga0207643_10000731
306 Ga0207643_10010586
307 Ga0207643_10220452
308 Ga0207705_10001559
309 Ga0207705_10080291
310 Ga0207684_10019054
311 Ga0207707_10157514
312 Ga0207707_10239126
313 Ga0207652_10465855
314 Ga0207659_10455791
315 Ga0207706_10026402
316 Ga0207669_10536505
317 Ga0207708_10046805
318 Ga0207648_10003794
319 Ga0207648_10007138
320 Ga0209969_1001919
321 Ga0209967_1000850
322 Ga0209981_1000534
323 Ga0209996_1000175
324 Ga0209984_1000853
325 Ga0209984_1001863
326 Ga0210000_1002480
327 Ga0209999_1000452
328 Ga0209982_1000235
329 Ga0209982_1003006
330 Ga0209970_1014076
331 Ga0209971_1004186
332 Ga0209971_1009290
333 Ga0209971_1014184
334 Ga0209966_1020178
335 Ga0209998_10000645
336 Ga0209998_10010155
337 Ga0209974_10000052
338 Ga0209974_10024480
339 Ga0207428_10040379
340 Ga0207428_10141347
341 Ga0307408_100549341
342 Ga0307508_10003214
343 Ga0316575_10037696
344 Ga0307413_10058473
345 Ga0307409_100075034
346 Ga0307409_100099576
347 Ga0307409_100434245
348 Ga0307416_100072676
349 Ga0307416_100637389
350 Ga0316583_10005640
351 Ga0373943_0169364
352 Ga0373935_0032959
353 Ga0373947_0152720
354 Ga0373937_0608114
355 Ga0395905_0097550
356 Ga0395901_0199437
357 Ga0400483_265803
358 Ga0439436_0019019
359 Ga0439452_050432
360 Ga0439457_001674
361 Ga0450923_040151
362 Ga0439464_0009450
363 Ga0451577_0047792
364 Ga0466972_0000207
365 Ga0453683_0027494
366 Ga0453683_0030673
367 Ga0453683_0074454
368 Ga0451576_0015367
369 Ga0451576_0052821
370 Ga0451576_0063641
371 Ga0451576_0166518
372 Ga0451576_0526632
373 Ga0495580_0067899
374 Ga0495662_0020210
375 Ga0495666_0064706
376 Ga0495665_0047412
377 Ga0495586_0134232
378 Ga0495625_0086990
379 Ga0495659_0019326
380 Ga0495647_0017518
381 Ga0495647_0019063
382 Ga0495672_0074108
383 Ga0495684_0016887
384 Ga0495686_0014474
385 Ga0496102_0104725
386 Ga0496114_0182940
387 Ga0496115_0592856
388 Ga0501037_0049278
389 Ga0501039_0041814
390 Ga0501041_0026341
391 Ga0501042_0138315
392 Ga0501043_0085211
393 Ga0501068_0354943
394 Ga0501071_0616971
395 Ga0501075_0347122
396 Ga0501076_0014095
397 Ga0501077_0214158
398 Ga0501202_005236
399 Ga0501217_069273
400 Ga0501256_009207
401 Ga0501221_009890
402 Ga0501234_004172
403 Ga0501245_022026
404 Ga0501079_0164558
405 Ga0501083_0001682
406 Ga0501265_007327
407 Ga0501275_011199
408 Ga0501282_010324
409 Ga0501045_0022337
410 nmdc:mga0k408_198993_c1
411 nmdc:mga0k408_388610_c1
412 nmdc:mga05p37_116166_c1
413 nmdc:mga05p37_148872_c1
414 nmdc:mga05p37_185949_c1
415 nmdc:mga05p37_537210_c1
416 nmdc:mga05p37_542578_c1
417 nmdc:mga05p37_676912_c1
418 nmdc:mga09592_14587_c1
419 nmdc:mga09592_232829_c1
420 nmdc:mga0qj67_451576_c1
421 nmdc:mga06r32_174718_c1
422 nmdc:mga06r32_412382_c1
423 nmdc:mga06r32_53739_c1
424 nmdc:mga08y16_129946_c1
425 nmdc:mga08y16_255194_c1
426 nmdc:mga08y16_44977_c1
427 nmdc:mga0n895_2442_c1
428 nmdc:mga0n895_47653_c1
429 nmdc:mga08x19_77960_c1
430 nmdc:mga0a205_2936_c1
431 Ga0500568_0000231
432 Ga0501084_0109901
433 Ga0590074_025428
434 Ga0590075_066834
435 Ga0590077_016774
436 Ga0590077_023138
437 Ga0501082_0358571
438 Ga0530510_0048625
439 2889419226
440 2920111769

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13649

Methyltransf_25

Methyltransferase domain

60

146

0.96

PF08241

Methyltransf_11

Methyltransferase domain

61

147

0.94

PF13847

Methyltransf_31

Methyltransferase domain

58

147

0.93

PF08242

Methyltransf_12

Methyltransferase domain

61

147

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hg2-assembly1.cif.gz_A the structure of a putative type ii methyltransferase from anaeromyxobacter dehalogenans. 0.946 17 250
4hg2-assembly1.cif.gz_A the structure of a putative type ii methyltransferase from anaeromyxobacter dehalogenans. 0.9383 17 250
3g5t-assembly1.cif.gz_A crystal structure of trans-aconitate 3-methyltransferase from yeast 0.9025 10 248
3g5t-assembly1.cif.gz_A crystal structure of trans-aconitate 3-methyltransferase from yeast 0.8586 10 248
3dh0-assembly1.cif.gz_A crystal structure of a sam dependent methyltransferase from aquifex aeolicus 0.8081 4 133
ID Description Score Start End Superfamily
4hg2B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9774 134 231 1.10.10.2560
4hg2A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9488 17 250 3.40.50.150
af_Q54JJ5_11_259_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9482 5 247 3.40.50.150
af_Q9LEV6_5_258_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9473 7 245 3.40.50.150
4hg2A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9378 17 250 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A6H9L7V1-F1-model_v4 Class I SAM-dependent methyltransferase 0.9923 1 249 GO:0008757
GO:0032259
AF-A0A7C4J7R7-F1-model_v4 SAM-dependent methyltransferase 0.9914 87 248 GO:0008757
GO:0032259
AF-A0A7V7WI43-F1-model_v4 Class I SAM-dependent methyltransferase 0.9896 1 195 GO:0008757
GO:0032259
AF-A0A6H9L7V1-F1-model_v4 Class I SAM-dependent methyltransferase 0.9883 1 249 GO:0008757
GO:0032259
AF-A0A7Y5VZ50-F1-model_v4 SAM-dependent methyltransferase 0.9878 123 248

Map