F331892

General Info

Members Datasets Scaffolds Average Seq Length
220 135 440 140

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100781158|Ga0070675_1007811581
Length 148
Sequence MRLFLDANILVSVINKEYPLFTFTSRIISLADNSRFTLFTSPVCLAIAFYFAEKKYKSTSAKKKIQILCDHINIAATDKKIVLQSLNNPAVNDFEDGLEYYSAIENKCDCIITEDIKDFYFSKIEVLSSENFFEKYLLNPPGKQRIPK

Samples

Sample ID Description Type Environment
1 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
92 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
99 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
100 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
101 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
102 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
103 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
104 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
105 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
106 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
107 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
108 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
109 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
110 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
111 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
112 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
113 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
114 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
115 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
116 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
117 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
118 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
119 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
120 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
121 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
122 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
123 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
124 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
125 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
126 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
127 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
128 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
129 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
130 2738541302 Pedobacter sp. CF074 Isolate Unclassified
131 2818991437 Pedobacter terrae 518 Isolate Unclassified
132 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
133 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
134 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
135 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.82
Metatranscriptomes 0
Isolates 3.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.73
Nodule 0
Rhizoplane 0
Rhizosphere 94.55
Stem 0
Stem Tuber 0
Unclassified 7.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070675_100781158 3300005354 Bacteria 872
2 rootH2_10052063 3300003320 Bacteria 6398
3 Ga0065714_10064476 3300005288 Bacteria 57050
4 Ga0065704_10135755 3300005289 Bacteria 1573
5 Ga0070683_100558156 3300005329 Bacteria 1095
6 Ga0070670_101907061 3300005331 Bacteria 547
7 Ga0068869_100042733 3300005334 Bacteria 3251
8 Ga0068869_100452333 3300005334 Bacteria 1064
9 Ga0070666_10000393 3300005335 Bacteria 27564
10 Ga0070666_10376039 3300005335 Bacteria 1019
11 Ga0070682_100172950 3300005337 Bacteria 1502
12 Ga0070660_100067821 3300005339 Bacteria 2780
13 Ga0070668_100068011 3300005347 Bacteria 2768
14 Ga0070668_100509836 3300005347 Bacteria 1042
15 Ga0070671_100241929 3300005355 Bacteria 1532
16 Ga0070671_101055079 3300005355 Bacteria 713
17 Ga0070667_100401783 3300005367 Bacteria 1247
18 Ga0070711_101053911 3300005439 Bacteria 699
19 Ga0070663_100085529 3300005455 Unclassified 2327
20 Ga0070681_10025936 3300005458 Bacteria 5893
21 Ga0070681_10333802 3300005458 Bacteria 1425
22 Ga0068867_100285777 3300005459 Bacteria 1354
23 Ga0068867_100289552 3300005459 Bacteria 1346
24 Ga0070679_100093775 3300005530 Bacteria 2989
25 Ga0070672_100242393 3300005543 Bacteria 1517
26 Ga0070672_100544493 3300005543 Bacteria 1007
27 Ga0068855_100063208 3300005563 Bacteria 4320
28 Ga0068855_100264657 3300005563 Bacteria 1914
29 Ga0068855_100298588 3300005563 Bacteria 1784
30 Ga0068857_102051757 3300005577 Bacteria 561
31 Ga0068857_102264140 3300005577 Unclassified 533
32 Ga0068854_100109527 3300005578 Bacteria 2081
33 Ga0068852_100261813 3300005616 Bacteria 1661
34 Ga0068859_100000023 3300005617 Bacteria 221914
35 Ga0068864_100029982 3300005618 Bacteria 4610
36 Ga0068864_100545221 3300005618 Bacteria 1120
37 Ga0068861_100202276 3300005719 Bacteria 1668
38 Ga0068851_10155790 3300005834 Bacteria 1252
39 Ga0068863_100000424 3300005841 Bacteria 42794
40 Ga0068858_100002898 3300005842 Bacteria 17252
41 Ga0068860_100002282 3300005843 Bacteria 20152
42 Ga0068860_100004096 3300005843 Bacteria 14942
43 Ga0068860_100855295 3300005843 Bacteria 924
44 Ga0068862_100027632 3300005844 Bacteria 4776
45 Ga0068871_100365784 3300006358 Bacteria 1278
46 Ga0097620_100000023 3300006931 Bacteria 221914
47 Ga0105244_10040856 3300009036 Bacteria 2405
48 Ga0105240_10129264 3300009093 Bacteria 3031
49 Ga0105240_10243370 3300009093 Bacteria 2084
50 Ga0105247_10006045 3300009101 Bacteria 7531
51 Ga0105241_10000527 3300009174 Bacteria 28775
52 Ga0105241_10210052 3300009174 Bacteria 1630
53 Ga0105242_10034519 3300009176 Bacteria 4055
54 Ga0105237_10005965 3300009545 Bacteria 13649
55 Ga0105237_10040478 3300009545 Bacteria 4699
56 Ga0105237_10073557 3300009545 Bacteria 3410
57 Ga0105249_10003678 3300009553 Bacteria 13217
58 Ga0105249_10232123 3300009553 Bacteria 1820
59 Ga0105249_10551389 3300009553 Unclassified 1203
60 Ga0105249_11820355 3300009553 Unclassified 681
61 Ga0105249_12293923 3300009553 Bacteria 612
62 Ga0105239_10061958 3300010375 Bacteria 4106
63 Ga0105239_10095535 3300010375 Bacteria 3283
64 Ga0105246_10068757 3300011119 Bacteria 2485
65 Ga0157373_10204470 3300013100 Bacteria 1392
66 Ga0157373_10486724 3300013100 Bacteria 890
67 Ga0157371_10000688 3300013102 Bacteria 39888
68 Ga0157371_10003302 3300013102 Bacteria 14762
69 Ga0157371_10010034 3300013102 Bacteria 7406
70 Ga0157371_10015053 3300013102 Bacteria 5815
71 Ga0157371_10025619 3300013102 Bacteria 4296
72 Ga0157371_10053439 3300013102 Bacteria 2868
73 Ga0157371_10201298 3300013102 Bacteria 1427
74 Ga0157371_10499999 3300013102 Bacteria 898
75 Ga0157370_10000457 3300013104 Bacteria 51070
76 Ga0157370_10042807 3300013104 Bacteria 4361
77 Ga0157370_10061083 3300013104 Bacteria 3576
78 Ga0157370_10065759 3300013104 Bacteria 3430
79 Ga0157370_10220342 3300013104 Bacteria 1757
80 Ga0157370_10272415 3300013104 Bacteria 1564
81 Ga0157370_10292512 3300013104 Bacteria 1504
82 Ga0157370_10528628 3300013104 Bacteria 1082
83 Ga0157370_11318033 3300013104 Bacteria 650
84 Ga0157369_10015166 3300013105 Bacteria 8699
85 Ga0157369_10066395 3300013105 Bacteria 3881
86 Ga0157369_10121124 3300013105 Bacteria 2776
87 Ga0157369_10307313 3300013105 Unclassified 1649
88 Ga0157369_10336138 3300013105 Bacteria 1569
89 Ga0157374_10071630 3300013296 Bacteria 3269
90 Ga0157374_10508547 3300013296 Bacteria 1210
91 Ga0157374_10696812 3300013296 Unclassified 1029
92 Ga0157378_12379269 3300013297 Bacteria 581
93 Ga0163162_10000373 3300013306 Bacteria 40682
94 Ga0163162_10196976 3300013306 Bacteria 2143
95 Ga0163162_10369127 3300013306 Bacteria 1568
96 Ga0157372_10000162 3300013307 Bacteria 73283
97 Ga0157372_10155470 3300013307 Bacteria 2641
98 Ga0157372_10170005 3300013307 Bacteria 2521
99 Ga0157372_10590822 3300013307 Bacteria 1294
100 Ga0157372_10745465 3300013307 Bacteria 1139
101 Ga0157372_10834512 3300013307 Bacteria 1070
102 Ga0157372_11221632 3300013307 Bacteria 868
103 Ga0157375_10050684 3300013308 Bacteria 4073
104 Ga0157375_11025276 3300013308 Bacteria 964
105 Ga0157375_12874663 3300013308 Bacteria 575
106 Ga0163163_10522807 3300014325 Bacteria 1249
107 Ga0157380_10609757 3300014326 Unclassified 1081
108 Ga0157380_11922069 3300014326 Unclassified 652
109 Ga0157380_12347012 3300014326 Unclassified 598
110 Ga0182008_10000432 3300014497 Bacteria 32241
111 Ga0157379_10100621 3300014968 Bacteria 2595
112 Ga0157376_10229270 3300014969 Bacteria 1725
113 Ga0157376_10461927 3300014969 Unclassified 1241
114 Ga0163161_10968720 3300017792 Bacteria 724
115 Ga0207656_10028731 3300025321 Bacteria 2285
116 Ga0207655_1091268 3300025728 Bacteria 1071
117 Ga0207710_10006584 3300025900 Bacteria 4954
118 Ga0207680_10002128 3300025903 Bacteria 9271
119 Ga0207680_10356390 3300025903 Bacteria 1028
120 Ga0207645_10217356 3300025907 Bacteria 1259
121 Ga0207654_10007557 3300025911 Bacteria 5482
122 Ga0207654_10153180 3300025911 Bacteria 1482
123 Ga0207707_10021819 3300025912 Bacteria 5597
124 Ga0207707_10268706 3300025912 Bacteria 1478
125 Ga0207695_10083356 3300025913 Bacteria 3230
126 Ga0207695_10552753 3300025913 Bacteria 1033
127 Ga0207671_10006732 3300025914 Bacteria 10176
128 Ga0207671_10024430 3300025914 Bacteria 4545
129 Ga0207671_10064772 3300025914 Bacteria 2717
130 Ga0207660_10057882 3300025917 Bacteria 2777
131 Ga0207660_10177279 3300025917 Bacteria 1653
132 Ga0207660_10485045 3300025917 Bacteria 1002
133 Ga0207657_10009227 3300025919 Bacteria 9945
134 Ga0207657_10042567 3300025919 Bacteria 4006
135 Ga0207652_10000074 3300025921 Bacteria 108397
136 Ga0207652_10032314 3300025921 Bacteria 4398
137 Ga0207650_11684067 3300025925 Bacteria 538
138 Ga0207659_11041580 3300025926 Unclassified 704
139 Ga0207644_10324121 3300025931 Bacteria 1246
140 Ga0207644_10911968 3300025931 Bacteria 737
141 Ga0207644_10969008 3300025931 Bacteria 713
142 Ga0207644_11188841 3300025931 Bacteria 641
143 Ga0207686_10055168 3300025934 Bacteria 2492
144 Ga0207689_10001785 3300025942 Bacteria 20329
145 Ga0207689_10001862 3300025942 Bacteria 19960
146 Ga0207689_11036034 3300025942 Bacteria 692
147 Ga0207667_10059567 3300025949 Bacteria 3998
148 Ga0207667_10140258 3300025949 Bacteria 2489
149 Ga0207667_10808415 3300025949 Bacteria 934
150 Ga0207712_10274271 3300025961 Unclassified 1373
151 Ga0207712_12061694 3300025961 Unclassified 510
152 Ga0207668_10192595 3300025972 Bacteria 1617
153 Ga0207668_10902849 3300025972 Bacteria 786
154 Ga0207658_10298488 3300025986 Unclassified 1387
155 Ga0207658_10411974 3300025986 Bacteria 1190
156 Ga0207677_10598730 3300026023 Bacteria 967
157 Ga0207703_10001211 3300026035 Bacteria 24154
158 Ga0207639_10115219 3300026041 Bacteria 2198
159 Ga0207678_10047418 3300026067 Bacteria 3716
160 Ga0207641_10000250 3300026088 Bacteria 68774
161 Ga0207648_10154759 3300026089 Bacteria 2023
162 Ga0207676_10142056 3300026095 Bacteria 2056
163 Ga0207676_10248425 3300026095 Bacteria 1600
164 Ga0207675_100708001 3300026118 Bacteria 1016
165 Ga0207675_101399571 3300026118 Bacteria 720
166 Ga0207683_10161341 3300026121 Bacteria 2027
167 Ga0207698_10001510 3300026142 Bacteria 13547
168 Ga0207698_10102966 3300026142 Bacteria 2371
169 Ga0268265_10103703 3300028380 Bacteria 2304
170 Ga0268264_10001954 3300028381 Bacteria 18515
171 Ga0268264_10655369 3300028381 Bacteria 1039
172 Ga0268264_10984600 3300028381 Bacteria 849
173 Ga0307513_10515669 3300031456 Bacteria 911
174 Ga0307516_10232816 3300031730 Bacteria 1545
175 Ga0307413_10728161 3300031824 Bacteria 827
176 Ga0307414_10051278 3300032004 Bacteria 2863
177 Ga0395900_0383687 3300037418 Bacteria 1372
178 Ga0395905_0742714 3300037471 Bacteria 884
179 Ga0395901_0021240 3300038443 Bacteria 6649
180 Ga0395901_0139990 3300038443 Unclassified 2543
181 Ga0439439_0020671 3300041406 Unclassified 1638
182 Ga0439461_0025006 3300041410 Unclassified 1211
183 Ga0439431_0039977 3300041997 Bacteria 1191
184 Ga0439442_011319 3300042002 Bacteria 1815
185 Ga0439432_080233 3300042006 Bacteria 989
186 Ga0439449_0080588 3300042007 Bacteria 1200
187 Ga0450897_003883 3300042128 Bacteria 1223
188 Ga0450894_004452 3300042131 Bacteria 1819
189 Ga0450910_012745 3300042147 Bacteria 1218
190 Ga0439434_0013029 3300042435 Bacteria 2466
191 Ga0495603_0881440 3300046455 Bacteria 509
192 Ga0495580_0059008 3300046472 Bacteria 2697
193 Ga0495610_0003107 3300046512 Bacteria 13229
194 Ga0495637_0105069 3300046520 Bacteria 1100
195 Ga0495598_0092579 3300046537 Bacteria 988
196 Ga0495668_0002772 3300046616 Bacteria 13985
197 Ga0495672_0028244 3300047320 Bacteria 3552
198 Ga0495672_0283762 3300047320 Bacteria 790
199 Ga0495687_114475 3300047443 Bacteria 985
200 Ga0495686_0136518 3300047472 Bacteria 1450
201 Ga0501297_028818 3300049520 Bacteria 730
202 Ga0501198_024872 3300049649 Bacteria 971
203 Ga0501216_078620 3300049660 Bacteria 694
204 Ga0501223_082479 3300049663 Bacteria 645
205 Ga0501232_057787 3300049757 Bacteria 614
206 Ga0501268_008011 3300049765 Bacteria 1589
207 Ga0501035_0019325 3300049822 Bacteria 6269
208 nmdc:mga0k408_4026_c1 3300050493 Bacteria 7801
209 Ga0500594_0060576 3300053118 Bacteria 1090
210 Ga0500588_0011594 3300053146 Bacteria 2163
211 Ga0500588_0106572 3300053146 Bacteria 973
212 Ga0500604_0014703 3300053151 Bacteria 2134
213 Ga0500616_0005341 3300053153 Bacteria 8758
214 2586207408 2585427687 Bacteria 5544917
215 2738853752 2738541302 Bacteria 5944758
216 2819549817 2818991437 Bacteria 5805520
217 2857628936 2857627736 Bacteria 5625397
218 2902048817 2902048731 Bacteria 4976191
219 2904445880 2904445276 Bacteria 5310396
220 2946000414 2945997725 Bacteria 6404843
221 Ga0070675_100781158
222 rootH2_10052063
223 Ga0065714_10064476
224 Ga0065704_10135755
225 Ga0070683_100558156
226 Ga0070670_101907061
227 Ga0068869_100042733
228 Ga0068869_100452333
229 Ga0070666_10000393
230 Ga0070666_10376039
231 Ga0070682_100172950
232 Ga0070660_100067821
233 Ga0070668_100068011
234 Ga0070668_100509836
235 Ga0070671_100241929
236 Ga0070671_101055079
237 Ga0070667_100401783
238 Ga0070711_101053911
239 Ga0070663_100085529
240 Ga0070681_10025936
241 Ga0070681_10333802
242 Ga0068867_100285777
243 Ga0068867_100289552
244 Ga0070679_100093775
245 Ga0070672_100242393
246 Ga0070672_100544493
247 Ga0068855_100063208
248 Ga0068855_100264657
249 Ga0068855_100298588
250 Ga0068857_102051757
251 Ga0068857_102264140
252 Ga0068854_100109527
253 Ga0068852_100261813
254 Ga0068859_100000023
255 Ga0068864_100029982
256 Ga0068864_100545221
257 Ga0068861_100202276
258 Ga0068851_10155790
259 Ga0068863_100000424
260 Ga0068858_100002898
261 Ga0068860_100002282
262 Ga0068860_100004096
263 Ga0068860_100855295
264 Ga0068862_100027632
265 Ga0068871_100365784
266 Ga0097620_100000023
267 Ga0105244_10040856
268 Ga0105240_10129264
269 Ga0105240_10243370
270 Ga0105247_10006045
271 Ga0105241_10000527
272 Ga0105241_10210052
273 Ga0105242_10034519
274 Ga0105237_10005965
275 Ga0105237_10040478
276 Ga0105237_10073557
277 Ga0105249_10003678
278 Ga0105249_10232123
279 Ga0105249_10551389
280 Ga0105249_11820355
281 Ga0105249_12293923
282 Ga0105239_10061958
283 Ga0105239_10095535
284 Ga0105246_10068757
285 Ga0157373_10204470
286 Ga0157373_10486724
287 Ga0157371_10000688
288 Ga0157371_10003302
289 Ga0157371_10010034
290 Ga0157371_10015053
291 Ga0157371_10025619
292 Ga0157371_10053439
293 Ga0157371_10201298
294 Ga0157371_10499999
295 Ga0157370_10000457
296 Ga0157370_10042807
297 Ga0157370_10061083
298 Ga0157370_10065759
299 Ga0157370_10220342
300 Ga0157370_10272415
301 Ga0157370_10292512
302 Ga0157370_10528628
303 Ga0157370_11318033
304 Ga0157369_10015166
305 Ga0157369_10066395
306 Ga0157369_10121124
307 Ga0157369_10307313
308 Ga0157369_10336138
309 Ga0157374_10071630
310 Ga0157374_10508547
311 Ga0157374_10696812
312 Ga0157378_12379269
313 Ga0163162_10000373
314 Ga0163162_10196976
315 Ga0163162_10369127
316 Ga0157372_10000162
317 Ga0157372_10155470
318 Ga0157372_10170005
319 Ga0157372_10590822
320 Ga0157372_10745465
321 Ga0157372_10834512
322 Ga0157372_11221632
323 Ga0157375_10050684
324 Ga0157375_11025276
325 Ga0157375_12874663
326 Ga0163163_10522807
327 Ga0157380_10609757
328 Ga0157380_11922069
329 Ga0157380_12347012
330 Ga0182008_10000432
331 Ga0157379_10100621
332 Ga0157376_10229270
333 Ga0157376_10461927
334 Ga0163161_10968720
335 Ga0207656_10028731
336 Ga0207655_1091268
337 Ga0207710_10006584
338 Ga0207680_10002128
339 Ga0207680_10356390
340 Ga0207645_10217356
341 Ga0207654_10007557
342 Ga0207654_10153180
343 Ga0207707_10021819
344 Ga0207707_10268706
345 Ga0207695_10083356
346 Ga0207695_10552753
347 Ga0207671_10006732
348 Ga0207671_10024430
349 Ga0207671_10064772
350 Ga0207660_10057882
351 Ga0207660_10177279
352 Ga0207660_10485045
353 Ga0207657_10009227
354 Ga0207657_10042567
355 Ga0207652_10000074
356 Ga0207652_10032314
357 Ga0207650_11684067
358 Ga0207659_11041580
359 Ga0207644_10324121
360 Ga0207644_10911968
361 Ga0207644_10969008
362 Ga0207644_11188841
363 Ga0207686_10055168
364 Ga0207689_10001785
365 Ga0207689_10001862
366 Ga0207689_11036034
367 Ga0207667_10059567
368 Ga0207667_10140258
369 Ga0207667_10808415
370 Ga0207712_10274271
371 Ga0207712_12061694
372 Ga0207668_10192595
373 Ga0207668_10902849
374 Ga0207658_10298488
375 Ga0207658_10411974
376 Ga0207677_10598730
377 Ga0207703_10001211
378 Ga0207639_10115219
379 Ga0207678_10047418
380 Ga0207641_10000250
381 Ga0207648_10154759
382 Ga0207676_10142056
383 Ga0207676_10248425
384 Ga0207675_100708001
385 Ga0207675_101399571
386 Ga0207683_10161341
387 Ga0207698_10001510
388 Ga0207698_10102966
389 Ga0268265_10103703
390 Ga0268264_10001954
391 Ga0268264_10655369
392 Ga0268264_10984600
393 Ga0307513_10515669
394 Ga0307516_10232816
395 Ga0307413_10728161
396 Ga0307414_10051278
397 Ga0395900_0383687
398 Ga0395905_0742714
399 Ga0395901_0021240
400 Ga0395901_0139990
401 Ga0439439_0020671
402 Ga0439461_0025006
403 Ga0439431_0039977
404 Ga0439442_011319
405 Ga0439432_080233
406 Ga0439449_0080588
407 Ga0450897_003883
408 Ga0450894_004452
409 Ga0450910_012745
410 Ga0439434_0013029
411 Ga0495603_0881440
412 Ga0495580_0059008
413 Ga0495610_0003107
414 Ga0495637_0105069
415 Ga0495598_0092579
416 Ga0495668_0002772
417 Ga0495672_0028244
418 Ga0495672_0283762
419 Ga0495687_114475
420 Ga0495686_0136518
421 Ga0501297_028818
422 Ga0501198_024872
423 Ga0501216_078620
424 Ga0501223_082479
425 Ga0501232_057787
426 Ga0501268_008011
427 Ga0501035_0019325
428 nmdc:mga0k408_4026_c1
429 Ga0500594_0060576
430 Ga0500588_0011594
431 Ga0500588_0106572
432 Ga0500604_0014703
433 Ga0500616_0005341
434 2586207408
435 2738853752
436 2819549817
437 2857628936
438 2902048817
439 2904445880
440 2946000414

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13470

PIN_3

PIN domain

2

117

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x3t-assembly1.cif.gz_H vapbc from mycobacterium tuberculosis 0.8198 1 115
7by2-assembly1.cif.gz_B-2 toxin-antitoxin complex from klebsiella pneumoniae 0.7848 3 129
5ecw-assembly1.cif.gz_A structure of the shigella flexneri vapc mutant d7a 0.7792 1 129
5wz4-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis vapc20 (rv2549c), sarcin-ricin loop cleaving toxin 0.7749 3 121
4xgr-assembly1.cif.gz_A crystal structure of addiction module from mycobacterial species 0.7743 3 126
ID Description Score Start End Superfamily
af_P9WFB3_1_135_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.855 3 129 3.40.50.1010
af_O50411_2_124_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8207 1 123 3.40.50.1010
af_P9WFB3_1_135_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8034 3 129 3.40.50.1010
af_O53779_1_126_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8025 4 123 3.40.50.1010
af_P9WF69_2_135_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8007 4 121 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A6M1EBW9-F1-model_v4 PIN domain-containing protein 0.9905 1 134
AF-A0A838TJT1-F1-model_v4 PIN domain-containing protein 0.9853 41 139
AF-A0A7Y7CGP6-F1-model_v4 PIN domain-containing protein 0.9834 1 137
AF-A0A1Q3X3R1-F1-model_v4 Twitching motility protein PilT 0.9818 1 137
AF-A0A3D1L334-F1-model_v4 Twitching motility protein PilT 0.976 1 113

Map