F331881

General Info

Members Datasets Scaffolds Average Seq Length
220 130 440 201

Family's Representative Sequence

Representative Sequence 3300005343|Ga0070687_100387155|Ga0070687_1003871551
Length 230
Sequence MFDFCCAAAPLREYFFQVMQNEETLRPSTIALWEIVSVIVSCLIAEWVVLAFIGPSKLALAIALMIASHYIYGETLHDLGFRTDNFIAAVRLLLLPTIIVIALIIASFGSMYGLHLADRPWRWRFSVVPLWALFQQYALQGYLNRRAQVVFGTGWRSVLLIAFLFAFVHLPNPLLFALTFAGGAIWAAIYQKQPNLYALALSHSVASVSLAISLPPQWTNALRVGFKYFG

Samples

Sample ID Description Type Environment
1 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
104 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
109 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
110 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
111 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
112 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
113 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
114 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
115 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
116 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
117 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
118 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
119 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
120 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
121 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
122 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
123 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
124 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
125 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
126 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
127 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
128 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
129 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
130 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.45
Rhizosphere 99.55
Stem 0
Stem Tuber 0
Unclassified 15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070687_100387155 3300005343 Unclassified 913
2 JGI24751J29686_10001553 3300002459 Unclassified 4748
3 JGI24751J29686_10002303 3300002459 Unclassified 3867
4 Ga0065714_10123970 3300005288 Unclassified 1316
5 Ga0065712_10092475 3300005290 Bacteria 2328
6 Ga0065712_10210900 3300005290 Bacteria 1073
7 Ga0065715_10038351 3300005293 Bacteria 1705
8 Ga0070690_100080104 3300005330 Bacteria 2136
9 Ga0070670_100000098 3300005331 Bacteria 80608
10 Ga0070670_100080212 3300005331 Bacteria 2805
11 Ga0070670_100544688 3300005331 Bacteria 1035
12 Ga0068869_100146178 3300005334 Bacteria 1830
13 Ga0068869_100291754 3300005334 Bacteria 1314
14 Ga0068869_100448101 3300005334 Bacteria 1069
15 Ga0070689_100154829 3300005340 Bacteria 1850
16 Ga0070689_100426748 3300005340 Bacteria 1124
17 Ga0070687_100176597 3300005343 Unclassified 1276
18 Ga0070687_100493585 3300005343 Unclassified 823
19 Ga0070673_100098439 3300005364 Bacteria 2404
20 Ga0070673_100200460 3300005364 Bacteria 1718
21 Ga0070701_10051235 3300005438 Bacteria 2141
22 Ga0070705_100073357 3300005440 Bacteria 2076
23 Ga0070700_100000227 3300005441 Bacteria 31044
24 Ga0070694_100527577 3300005444 Bacteria 943
25 Ga0070681_10020660 3300005458 Bacteria 6597
26 Ga0068867_100161239 3300005459 Bacteria 1768
27 Ga0070706_100000032 3300005467 Bacteria 152892
28 Ga0070698_100032286 3300005471 Bacteria 5424
29 Ga0070699_100008701 3300005518 Bacteria 8799
30 Ga0070699_101205536 3300005518 Unclassified 694
31 Ga0070679_100333229 3300005530 Bacteria 1466
32 Ga0070697_100047519 3300005536 Bacteria 3479
33 Ga0070686_100761204 3300005544 Unclassified 777
34 Ga0070695_100088676 3300005545 Bacteria 2060
35 Ga0070695_100225396 3300005545 Bacteria 1352
36 Ga0070696_100012849 3300005546 Bacteria 5620
37 Ga0070693_100040576 3300005547 Bacteria 2613
38 Ga0070693_100197163 3300005547 Bacteria 1305
39 Ga0070693_100458975 3300005547 Unclassified 896
40 Ga0070693_100558232 3300005547 Unclassified 821
41 Ga0070704_100279920 3300005549 Bacteria 1381
42 Ga0070704_100444839 3300005549 Bacteria 1115
43 Ga0068857_100090379 3300005577 Bacteria 2740
44 Ga0068857_100387042 3300005577 Unclassified 1299
45 Ga0068857_100628247 3300005577 Bacteria 1016
46 Ga0068857_100978739 3300005577 Unclassified 814
47 Ga0068857_101084837 3300005577 Bacteria 773
48 Ga0070702_100238291 3300005615 Bacteria 1226
49 Ga0070702_100309349 3300005615 Unclassified 1096
50 Ga0068859_100015044 3300005617 Bacteria 7769
51 Ga0068859_100080012 3300005617 Bacteria 3308
52 Ga0068859_100123147 3300005617 Bacteria 2660
53 Ga0068859_100134950 3300005617 Unclassified 2540
54 Ga0068859_100297058 3300005617 Bacteria 1708
55 Ga0068859_100371567 3300005617 Unclassified 1525
56 Ga0068859_100462426 3300005617 Bacteria 1365
57 Ga0068859_100530134 3300005617 Bacteria 1272
58 Ga0068864_100065192 3300005618 Bacteria 3160
59 Ga0068864_100541188 3300005618 Bacteria 1124
60 Ga0068864_100613419 3300005618 Bacteria 1057
61 Ga0068861_100070709 3300005719 Bacteria 2703
62 Ga0068861_100474645 3300005719 Unclassified 1125
63 Ga0068870_10642305 3300005840 Bacteria 726
64 Ga0068863_100247020 3300005841 Bacteria 1723
65 Ga0068858_100093123 3300005842 Bacteria 2805
66 Ga0068858_100146687 3300005842 Bacteria 2216
67 Ga0068860_100249719 3300005843 Bacteria 1727
68 Ga0068860_100253755 3300005843 Bacteria 1713
69 Ga0068860_100481876 3300005843 Bacteria 1236
70 Ga0068862_101243714 3300005844 Unclassified 744
71 Ga0081539_10007215 3300005985 Bacteria 10224
72 Ga0070716_100328320 3300006173 Bacteria 1074
73 Ga0075428_100496760 3300006844 Bacteria 1305
74 Ga0075430_100271570 3300006846 Bacteria 1403
75 Ga0075431_100531846 3300006847 Unclassified 1164
76 Ga0075433_10146335 3300006852 Bacteria 2100
77 Ga0075433_10156361 3300006852 Bacteria 2028
78 Ga0075433_10207359 3300006852 Bacteria 1742
79 Ga0075433_10385818 3300006852 Bacteria 1236
80 Ga0075433_10418593 3300006852 Bacteria 1181
81 Ga0075434_100092654 3300006871 Bacteria 3024
82 Ga0075434_100187000 3300006871 Bacteria 2092
83 Ga0097620_100015044 3300006931 Bacteria 7769
84 Ga0097620_100080012 3300006931 Bacteria 3308
85 Ga0097620_100123142 3300006931 Bacteria 2660
86 Ga0097620_100134968 3300006931 Unclassified 2540
87 Ga0097620_100297059 3300006931 Bacteria 1708
88 Ga0097620_100371573 3300006931 Unclassified 1525
89 Ga0097620_100462470 3300006931 Bacteria 1365
90 Ga0097620_100506312 3300006931 Bacteria 1303
91 Ga0097620_100530117 3300006931 Bacteria 1272
92 Ga0105251_10272571 3300009011 Unclassified 764
93 Ga0105240_10164605 3300009093 Bacteria 2631
94 Ga0105240_10570881 3300009093 Bacteria 1249
95 Ga0111539_10702377 3300009094 Bacteria 1177
96 Ga0105245_10912796 3300009098 Unclassified 920
97 Ga0105247_10002624 3300009101 Bacteria 12136
98 Ga0105247_10194842 3300009101 Bacteria 1358
99 Ga0105247_10292297 3300009101 Unclassified 1127
100 Ga0105247_10713758 3300009101 Bacteria 756
101 Ga0105243_10020636 3300009148 Bacteria 4996
102 Ga0105243_10134489 3300009148 Bacteria 2102
103 Ga0105243_11224731 3300009148 Unclassified 765
104 Ga0105241_10019732 3300009174 Bacteria 4974
105 Ga0105241_10068179 3300009174 Bacteria 2756
106 Ga0105242_10036935 3300009176 Bacteria 3922
107 Ga0105242_10079638 3300009176 Bacteria 2736
108 Ga0105248_10008264 3300009177 Bacteria 11435
109 Ga0105248_10296485 3300009177 Bacteria 1821
110 Ga0105248_10411122 3300009177 Bacteria 1523
111 Ga0105248_11376948 3300009177 Bacteria 798
112 Ga0105248_11894244 3300009177 Bacteria 677
113 Ga0105237_10699880 3300009545 Bacteria 1020
114 Ga0105238_10035475 3300009551 Bacteria 5070
115 Ga0105249_10017713 3300009553 Bacteria 6326
116 Ga0105249_10490564 3300009553 Bacteria 1272
117 Ga0105249_10620075 3300009553 Bacteria 1137
118 Ga0105239_10658851 3300010375 Bacteria 1196
119 Ga0105246_10436907 3300011119 Bacteria 1096
120 Ga0157373_10018787 3300013100 Bacteria 5030
121 Ga0157373_10113691 3300013100 Bacteria 1902
122 Ga0157373_10382719 3300013100 Bacteria 1007
123 Ga0157378_10508579 3300013297 Bacteria 1204
124 Ga0157378_10511548 3300013297 Bacteria 1201
125 Ga0157372_10624583 3300013307 Unclassified 1255
126 Ga0157372_11194551 3300013307 Bacteria 879
127 Ga0157375_10322932 3300013308 Bacteria 1708
128 Ga0163163_10000669 3300014325 Bacteria 29324
129 Ga0163163_10247308 3300014325 Bacteria 1833
130 Ga0163163_10275605 3300014325 Bacteria 1733
131 Ga0163163_10530988 3300014325 Bacteria 1239
132 Ga0157377_10324687 3300014745 Unclassified 1024
133 Ga0157379_10561579 3300014968 Unclassified 1063
134 Ga0157379_10731063 3300014968 Bacteria 931
135 Ga0163161_10244708 3300017792 Bacteria 1396
136 Ga0207642_10056146 3300025899 Bacteria 1805
137 Ga0207710_10015846 3300025900 Bacteria 3188
138 Ga0207643_10190121 3300025908 Bacteria 1246
139 Ga0207643_10197729 3300025908 Bacteria 1223
140 Ga0207684_10001147 3300025910 Bacteria 29558
141 Ga0207654_10295583 3300025911 Bacteria 1100
142 Ga0207707_10017679 3300025912 Bacteria 6219
143 Ga0207695_10144397 3300025913 Bacteria 2325
144 Ga0207671_10235914 3300025914 Bacteria 1436
145 Ga0207652_10292801 3300025921 Bacteria 1469
146 Ga0207646_10099538 3300025922 Bacteria 2605
147 Ga0207681_10036231 3300025923 Bacteria 3254
148 Ga0207694_10369625 3300025924 Bacteria 1189
149 Ga0207650_10000156 3300025925 Bacteria 81983
150 Ga0207659_10467244 3300025926 Bacteria 1064
151 Ga0207690_10037978 3300025932 Bacteria 3131
152 Ga0207686_10261820 3300025934 Bacteria 1268
153 Ga0207709_10035991 3300025935 Bacteria 2931
154 Ga0207665_10157979 3300025939 Bacteria 1629
155 Ga0207665_10237935 3300025939 Bacteria 1340
156 Ga0207711_10139162 3300025941 Bacteria 2183
157 Ga0207711_10387421 3300025941 Unclassified 1297
158 Ga0207689_10022305 3300025942 Bacteria 5324
159 Ga0207689_10155815 3300025942 Bacteria 1883
160 Ga0207689_10454785 3300025942 Bacteria 1070
161 Ga0207651_10402054 3300025960 Bacteria 1165
162 Ga0207712_10289933 3300025961 Bacteria 1339
163 Ga0207712_10303960 3300025961 Bacteria 1310
164 Ga0207640_10245495 3300025981 Bacteria 1386
165 Ga0207703_10528610 3300026035 Bacteria 1110
166 Ga0207703_10658927 3300026035 Bacteria 993
167 Ga0207708_10000031 3300026075 Bacteria 155478
168 Ga0207708_10054903 3300026075 Bacteria 3037
169 Ga0207708_10219122 3300026075 Bacteria 1524
170 Ga0207648_10032323 3300026089 Bacteria 4620
171 Ga0207676_10457103 3300026095 Bacteria 1205
172 Ga0207676_10870181 3300026095 Unclassified 882
173 Ga0207674_10051131 3300026116 Unclassified 4218
174 Ga0207675_100125359 3300026118 Bacteria 2433
175 Ga0207675_100138202 3300026118 Bacteria 2313
176 Ga0207675_100221650 3300026118 Bacteria 1822
177 Ga0268265_10638594 3300028380 Bacteria 1022
178 Ga0268264_10127845 3300028381 Bacteria 2248
179 Ga0268264_10346690 3300028381 Bacteria 1412
180 Ga0307408_100152514 3300031548 Unclassified 1826
181 Ga0307406_10003376 3300031901 Bacteria 8701
182 Ga0307412_10328106 3300031911 Bacteria 1220
183 Ga0307412_10370538 3300031911 Bacteria 1156
184 Ga0307414_10005558 3300032004 Bacteria 6952
185 Ga0307415_100004732 3300032126 Bacteria 7124
186 Ga0373940_0092919 3300035088 Unclassified 906
187 Ga0373951_0006206 3300035091 Bacteria 2738
188 Ga0395900_0346690 3300037418 Bacteria 1459
189 Ga0395898_0103643 3300037466 Bacteria 2729
190 Ga0395901_0102672 3300038443 Bacteria 3001
191 Ga0395901_0310143 3300038443 Bacteria 1634
192 Ga0395901_0737288 3300038443 Unclassified 979
193 Ga0439448_0017611 3300042005 Bacteria 2183
194 Ga0439455_0010011 3300042012 Bacteria 2072
195 Ga0439458_0015525 3300042157 Bacteria 1726
196 Ga0496110_0148158 3300048913 Bacteria 2124
197 Ga0501202_051273 3300049652 Bacteria 915
198 Ga0501216_030080 3300049660 Bacteria 999
199 Ga0501217_000199 3300049661 Bacteria 8952
200 Ga0501223_003944 3300049663 Bacteria 3202
201 Ga0501227_009964 3300049665 Bacteria 2055
202 Ga0501230_050353 3300049667 Bacteria 826
203 Ga0501233_089089 3300049668 Bacteria 803
204 Ga0501257_052684 3300049686 Bacteria 1017
205 Ga0501225_0004742 3300049705 Bacteria 4033
206 Ga0501229_005868 3300049706 Bacteria 1514
207 Ga0501234_001253 3300049707 Bacteria 3987
208 Ga0501267_010014 3300049764 Bacteria 953
209 Ga0501273_004578 3300049770 Bacteria 1525
210 nmdc:mga09592_9090_c1 3300050508 Bacteria 8078
211 nmdc:mga0qj67_423021_c1 3300050509 Bacteria 1074
212 nmdc:mga0qj67_566298_c1 3300050509 Bacteria 911
213 nmdc:mga06r32_118306_c1 3300050510 Bacteria 2612
214 nmdc:mga0n895_182832_c1 3300050512 Bacteria 2128
215 nmdc:mga0n895_317394_c1 3300050512 Bacteria 1579
216 nmdc:mga0n895_44334_c1 3300050512 Bacteria 4337
217 nmdc:mga08x19_35320_c1 3300050514 Bacteria 3162
218 nmdc:mga0a205_339295_c1 3300050515 Bacteria 1371
219 nmdc:mga0a205_422660_c1 3300050515 Bacteria 1194
220 nmdc:mga0a205_48470_c1 3300050515 Bacteria 2808
221 Ga0070687_100387155
222 JGI24751J29686_10001553
223 JGI24751J29686_10002303
224 Ga0065714_10123970
225 Ga0065712_10092475
226 Ga0065712_10210900
227 Ga0065715_10038351
228 Ga0070690_100080104
229 Ga0070670_100000098
230 Ga0070670_100080212
231 Ga0070670_100544688
232 Ga0068869_100146178
233 Ga0068869_100291754
234 Ga0068869_100448101
235 Ga0070689_100154829
236 Ga0070689_100426748
237 Ga0070687_100176597
238 Ga0070687_100493585
239 Ga0070673_100098439
240 Ga0070673_100200460
241 Ga0070701_10051235
242 Ga0070705_100073357
243 Ga0070700_100000227
244 Ga0070694_100527577
245 Ga0070681_10020660
246 Ga0068867_100161239
247 Ga0070706_100000032
248 Ga0070698_100032286
249 Ga0070699_100008701
250 Ga0070699_101205536
251 Ga0070679_100333229
252 Ga0070697_100047519
253 Ga0070686_100761204
254 Ga0070695_100088676
255 Ga0070695_100225396
256 Ga0070696_100012849
257 Ga0070693_100040576
258 Ga0070693_100197163
259 Ga0070693_100458975
260 Ga0070693_100558232
261 Ga0070704_100279920
262 Ga0070704_100444839
263 Ga0068857_100090379
264 Ga0068857_100387042
265 Ga0068857_100628247
266 Ga0068857_100978739
267 Ga0068857_101084837
268 Ga0070702_100238291
269 Ga0070702_100309349
270 Ga0068859_100015044
271 Ga0068859_100080012
272 Ga0068859_100123147
273 Ga0068859_100134950
274 Ga0068859_100297058
275 Ga0068859_100371567
276 Ga0068859_100462426
277 Ga0068859_100530134
278 Ga0068864_100065192
279 Ga0068864_100541188
280 Ga0068864_100613419
281 Ga0068861_100070709
282 Ga0068861_100474645
283 Ga0068870_10642305
284 Ga0068863_100247020
285 Ga0068858_100093123
286 Ga0068858_100146687
287 Ga0068860_100249719
288 Ga0068860_100253755
289 Ga0068860_100481876
290 Ga0068862_101243714
291 Ga0081539_10007215
292 Ga0070716_100328320
293 Ga0075428_100496760
294 Ga0075430_100271570
295 Ga0075431_100531846
296 Ga0075433_10146335
297 Ga0075433_10156361
298 Ga0075433_10207359
299 Ga0075433_10385818
300 Ga0075433_10418593
301 Ga0075434_100092654
302 Ga0075434_100187000
303 Ga0097620_100015044
304 Ga0097620_100080012
305 Ga0097620_100123142
306 Ga0097620_100134968
307 Ga0097620_100297059
308 Ga0097620_100371573
309 Ga0097620_100462470
310 Ga0097620_100506312
311 Ga0097620_100530117
312 Ga0105251_10272571
313 Ga0105240_10164605
314 Ga0105240_10570881
315 Ga0111539_10702377
316 Ga0105245_10912796
317 Ga0105247_10002624
318 Ga0105247_10194842
319 Ga0105247_10292297
320 Ga0105247_10713758
321 Ga0105243_10020636
322 Ga0105243_10134489
323 Ga0105243_11224731
324 Ga0105241_10019732
325 Ga0105241_10068179
326 Ga0105242_10036935
327 Ga0105242_10079638
328 Ga0105248_10008264
329 Ga0105248_10296485
330 Ga0105248_10411122
331 Ga0105248_11376948
332 Ga0105248_11894244
333 Ga0105237_10699880
334 Ga0105238_10035475
335 Ga0105249_10017713
336 Ga0105249_10490564
337 Ga0105249_10620075
338 Ga0105239_10658851
339 Ga0105246_10436907
340 Ga0157373_10018787
341 Ga0157373_10113691
342 Ga0157373_10382719
343 Ga0157378_10508579
344 Ga0157378_10511548
345 Ga0157372_10624583
346 Ga0157372_11194551
347 Ga0157375_10322932
348 Ga0163163_10000669
349 Ga0163163_10247308
350 Ga0163163_10275605
351 Ga0163163_10530988
352 Ga0157377_10324687
353 Ga0157379_10561579
354 Ga0157379_10731063
355 Ga0163161_10244708
356 Ga0207642_10056146
357 Ga0207710_10015846
358 Ga0207643_10190121
359 Ga0207643_10197729
360 Ga0207684_10001147
361 Ga0207654_10295583
362 Ga0207707_10017679
363 Ga0207695_10144397
364 Ga0207671_10235914
365 Ga0207652_10292801
366 Ga0207646_10099538
367 Ga0207681_10036231
368 Ga0207694_10369625
369 Ga0207650_10000156
370 Ga0207659_10467244
371 Ga0207690_10037978
372 Ga0207686_10261820
373 Ga0207709_10035991
374 Ga0207665_10157979
375 Ga0207665_10237935
376 Ga0207711_10139162
377 Ga0207711_10387421
378 Ga0207689_10022305
379 Ga0207689_10155815
380 Ga0207689_10454785
381 Ga0207651_10402054
382 Ga0207712_10289933
383 Ga0207712_10303960
384 Ga0207640_10245495
385 Ga0207703_10528610
386 Ga0207703_10658927
387 Ga0207708_10000031
388 Ga0207708_10054903
389 Ga0207708_10219122
390 Ga0207648_10032323
391 Ga0207676_10457103
392 Ga0207676_10870181
393 Ga0207674_10051131
394 Ga0207675_100125359
395 Ga0207675_100138202
396 Ga0207675_100221650
397 Ga0268265_10638594
398 Ga0268264_10127845
399 Ga0268264_10346690
400 Ga0307408_100152514
401 Ga0307406_10003376
402 Ga0307412_10328106
403 Ga0307412_10370538
404 Ga0307414_10005558
405 Ga0307415_100004732
406 Ga0373940_0092919
407 Ga0373951_0006206
408 Ga0395900_0346690
409 Ga0395898_0103643
410 Ga0395901_0102672
411 Ga0395901_0310143
412 Ga0395901_0737288
413 Ga0439448_0017611
414 Ga0439455_0010011
415 Ga0439458_0015525
416 Ga0496110_0148158
417 Ga0501202_051273
418 Ga0501216_030080
419 Ga0501217_000199
420 Ga0501223_003944
421 Ga0501227_009964
422 Ga0501230_050353
423 Ga0501233_089089
424 Ga0501257_052684
425 Ga0501225_0004742
426 Ga0501229_005868
427 Ga0501234_001253
428 Ga0501267_010014
429 Ga0501273_004578
430 nmdc:mga09592_9090_c1
431 nmdc:mga0qj67_423021_c1
432 nmdc:mga0qj67_566298_c1
433 nmdc:mga06r32_118306_c1
434 nmdc:mga0n895_182832_c1
435 nmdc:mga0n895_317394_c1
436 nmdc:mga0n895_44334_c1
437 nmdc:mga08x19_35320_c1
438 nmdc:mga0a205_339295_c1
439 nmdc:mga0a205_422660_c1
440 nmdc:mga0a205_48470_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02517

Rce1-like

Type II CAAX prenyl endopeptidase Rce1-like

117

209

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zdu-assembly1.cif.gz_C occ(apo/return) conformation of cyddc mutant (e500q.c) in atp(cydc)/atp(cydd) bound state (dataset-19) 0.2925 4 179
7zdc-assembly1.cif.gz_C if(heme/confined) conformation of cyddc in adp(cydd) bound state (dataset-3) 0.2729 4 190
7zdu-assembly1.cif.gz_C occ(apo/return) conformation of cyddc mutant (e500q.c) in atp(cydc)/atp(cydd) bound state (dataset-19) 0.2693 4 179
7zdc-assembly1.cif.gz_C if(heme/confined) conformation of cyddc in adp(cydd) bound state (dataset-3) 0.2526 4 190
7o3v-assembly1.cif.gz_F stalk complex structure (trwj/virb5-trwi/virb6) from the fully-assembled r388 type iv secretion system determined by cryo-em. 0.252 3 173
ID Description Score Start End Superfamily
af_A0A1D6ED85_305_435_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3808 92 193 1.20.1250.20
af_O16271_13_246_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.2956 4 185 1.20.120.1770
af_P09348_118_240_1.20.58.220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.2855 70 180 1.20.58.220
af_O16271_13_246_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.2794 4 185 1.20.120.1770
af_P9WPG3_21_202_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.2749 3 175 1.20.120.1760
ID Description Score Start End GO Terms
AF-A0A1Q7YH94-F1-model_v4 CAAX protease family protein 0.7819 3 197 GO:0004222
GO:0016020
GO:0071586
AF-A0A2V8LVH6-F1-model_v4 CPBP family intramembrane metalloprotease 0.7773 7 197 GO:0004222
GO:0016020
GO:0071586
AF-A0A831T230-F1-model_v4 CPBP family intramembrane metalloprotease 0.7771 1 193 GO:0004222
GO:0016020
GO:0071586
AF-A0A7Y4UAJ8-F1-model_v4 CPBP family intramembrane metalloprotease 0.7743 8 194 GO:0004222
GO:0016020
GO:0071586
AF-A0A1Q7YH94-F1-model_v4 CAAX protease family protein 0.7711 3 197 GO:0004222
GO:0016020
GO:0071586

Map