F331777

General Info

Members Datasets Scaffolds Average Seq Length
220 161 440 207

Family's Representative Sequence

Representative Sequence 3300005288|Ga0065714_10102307|Ga0065714_101023073
Length 239
Sequence MLEGQAAGEGVAEHEGIDIAASGQLTADSYVMRIALVDYGAGNLTSVKKAFTHLGADLVVPSSPRDLDGADAIVVPGVGHFQATRSLTAEWRAAIRASLDRGRPLLGICVGMQWLYEGSTEAPDSEGLGVIPGRCTRLTGGTANLKVPHVGWNTLAMPRPSSLLDGVPAEASVYFTHSYAGPVNAATAASTEYGERFAAAVEENLVMGLQFHPEKSGATGLRILDNFLRRVAALAAPAV

Samples

Sample ID Description Type Environment
1 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
73 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
115 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
116 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
117 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
118 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
119 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
120 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
121 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
125 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
126 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
127 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
130 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
131 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
132 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
133 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
134 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
135 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
136 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
137 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
138 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
139 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
140 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
141 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
159 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
160 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
161 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.18
Metatranscriptomes 1.82
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 7.73
Rhizosphere 91.36
Stem 0
Stem Tuber 0
Unclassified 10.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10102307 3300005288 Bacteria 1625
2 Ga0058863_11549327 3300004799 Bacteria 853
3 Ga0058862_10060428 3300004803 Unclassified 2657
4 Ga0065715_10002039 3300005293 Bacteria 6949
5 Ga0070658_10000121 3300005327 Bacteria 70439
6 Ga0070676_10102657 3300005328 Bacteria 1769
7 Ga0070676_10233563 3300005328 Bacteria 1220
8 Ga0070670_100206642 3300005331 Bacteria 1707
9 Ga0070680_100000986 3300005336 Bacteria 20202
10 Ga0070680_100745229 3300005336 Bacteria 843
11 Ga0070682_100209059 3300005337 Unclassified 1382
12 Ga0070669_100059858 3300005353 Bacteria 2797
13 Ga0070675_100099272 3300005354 Bacteria 2450
14 Ga0070671_100134688 3300005355 Bacteria 2082
15 Ga0070674_100196107 3300005356 Unclassified 1556
16 Ga0070673_100053466 3300005364 Bacteria 3172
17 Ga0070673_100285460 3300005364 Unclassified 1449
18 Ga0070688_100006203 3300005365 Bacteria 6366
19 Ga0070688_100127248 3300005365 Bacteria 1714
20 Ga0070688_100467303 3300005365 Bacteria 946
21 Ga0070667_100333081 3300005367 Bacteria 1372
22 Ga0070667_100552806 3300005367 Bacteria 1058
23 Ga0070709_10031530 3300005434 Bacteria 3189
24 Ga0070714_100218552 3300005435 Unclassified 1750
25 Ga0070713_100071046 3300005436 Bacteria 2940
26 Ga0070678_100056265 3300005456 Bacteria 2876
27 Ga0070681_10018679 3300005458 Bacteria 6934
28 Ga0070681_10039607 3300005458 Bacteria 4723
29 Ga0070681_10059995 3300005458 Unclassified 3782
30 Ga0070681_10072900 3300005458 Bacteria 3396
31 Ga0070685_10022366 3300005466 Bacteria 3446
32 Ga0070679_100000968 3300005530 Bacteria 24975
33 Ga0070679_100002610 3300005530 Bacteria 16386
34 Ga0070679_100048750 3300005530 Bacteria 4219
35 Ga0070679_100111123 3300005530 Bacteria 2727
36 Ga0070679_100124518 3300005530 Bacteria 2560
37 Ga0070684_100224565 3300005535 Bacteria 1714
38 Ga0070672_100061635 3300005543 Bacteria 2958
39 Ga0070672_100211211 3300005543 Bacteria 1625
40 Ga0070686_100289159 3300005544 Bacteria 1212
41 Ga0070695_100055096 3300005545 Bacteria 2562
42 Ga0070665_100084966 3300005548 Bacteria 3170
43 Ga0070665_100238628 3300005548 Bacteria 1819
44 Ga0070704_100391516 3300005549 Bacteria 1183
45 Ga0068855_100182459 3300005563 Bacteria 2372
46 Ga0070664_100936483 3300005564 Bacteria 813
47 Ga0068856_100211643 3300005614 Bacteria 1954
48 Ga0068852_101107670 3300005616 Bacteria 812
49 Ga0068859_100204999 3300005617 Bacteria 2057
50 Ga0068864_100117092 3300005618 Bacteria 2378
51 Ga0068864_100263221 3300005618 Bacteria 1605
52 Ga0068866_10021572 3300005718 Bacteria 2969
53 Ga0068870_10309944 3300005840 Bacteria 999
54 Ga0068863_100104043 3300005841 Bacteria 2701
55 Ga0068860_100479156 3300005843 Bacteria 1240
56 Ga0068862_100262545 3300005844 Bacteria 1577
57 Ga0081539_10032394 3300005985 Bacteria 3201
58 Ga0070712_100175981 3300006175 Bacteria 1664
59 Ga0097621_100025477 3300006237 Unclassified 4629
60 Ga0097621_100421432 3300006237 Bacteria 1198
61 Ga0097621_100887816 3300006237 Bacteria 830
62 Ga0068871_100309391 3300006358 Bacteria 1389
63 Ga0075431_100077735 3300006847 Bacteria 3425
64 Ga0068865_100640190 3300006881 Bacteria 902
65 Ga0097620_100205018 3300006931 Bacteria 2057
66 Ga0099795_10366015 3300007788 Bacteria 648
67 Ga0105240_10001618 3300009093 Bacteria 38196
68 Ga0105240_10001720 3300009093 Bacteria 36943
69 Ga0105245_10453677 3300009098 Bacteria 1291
70 Ga0105245_10964554 3300009098 Bacteria 896
71 Ga0114129_12004128 3300009147 Unclassified 700
72 Ga0105243_10347740 3300009148 Bacteria 1360
73 Ga0105248_10022452 3300009177 Bacteria 6999
74 Ga0105237_10473014 3300009545 Bacteria 1259
75 Ga0105239_10316032 3300010375 Bacteria 1761
76 Ga0105239_10479781 3300010375 Bacteria 1412
77 Ga0105246_10160678 3300011119 Bacteria 1711
78 Ga0157373_10223901 3300013100 Bacteria 1327
79 Ga0157370_10265742 3300013104 Unclassified 1585
80 Ga0157369_10056032 3300013105 Bacteria 4254
81 Ga0157369_10093019 3300013105 Bacteria 3218
82 Ga0157369_10374427 3300013105 Unclassified 1478
83 Ga0157374_10248028 3300013296 Bacteria 1752
84 Ga0157374_11386542 3300013296 Bacteria 725
85 Ga0157378_11267810 3300013297 Bacteria 778
86 Ga0163162_10075233 3300013306 Bacteria 3437
87 Ga0163162_10115900 3300013306 Bacteria 2780
88 Ga0157372_10099990 3300013307 Bacteria 3309
89 Ga0157372_10762360 3300013307 Bacteria 1125
90 Ga0157375_10203006 3300013308 Bacteria 2138
91 Ga0163163_10095685 3300014325 Bacteria 2989
92 Ga0157380_10583171 3300014326 Bacteria 1103
93 Ga0157377_10197565 3300014745 Bacteria 1275
94 Ga0157376_10023888 3300014969 Bacteria 4793
95 Ga0157376_10077255 3300014969 Bacteria 2847
96 Ga0163161_10187785 3300017792 Bacteria 1587
97 Ga0197907_10479971 3300020069 Bacteria 845
98 Ga0206356_11525490 3300020070 Bacteria 2921
99 Ga0213872_10049355 3300021361 Bacteria 1912
100 Ga0209233_1043045 3300025261 Bacteria 965
101 Ga0207697_10014606 3300025315 Bacteria 3255
102 Ga0207642_10028625 3300025899 Bacteria 2297
103 Ga0207642_10240729 3300025899 Bacteria 1021
104 Ga0207699_10503146 3300025906 Unclassified 875
105 Ga0207645_10055301 3300025907 Bacteria 2534
106 Ga0207645_10094213 3300025907 Bacteria 1927
107 Ga0207707_10005331 3300025912 Bacteria 11237
108 Ga0207707_10085986 3300025912 Bacteria 2748
109 Ga0207707_10112109 3300025912 Bacteria 2384
110 Ga0207707_10187105 3300025912 Bacteria 1807
111 Ga0207707_10456364 3300025912 Bacteria 1093
112 Ga0207707_10486069 3300025912 Bacteria 1054
113 Ga0207695_10001806 3300025913 Bacteria 33744
114 Ga0207695_10014806 3300025913 Bacteria 9214
115 Ga0207695_10162138 3300025913 Bacteria 2167
116 Ga0207693_10176485 3300025915 Bacteria 1681
117 Ga0207660_10005756 3300025917 Bacteria 8041
118 Ga0207660_10154371 3300025917 Bacteria 1766
119 Ga0207657_10508530 3300025919 Bacteria 943
120 Ga0207652_10002459 3300025921 Bacteria 15619
121 Ga0207652_10005848 3300025921 Bacteria 9964
122 Ga0207652_10015711 3300025921 Bacteria 6166
123 Ga0207681_10005649 3300025923 Bacteria 7677
124 Ga0207650_10028107 3300025925 Bacteria 4030
125 Ga0207650_10193940 3300025925 Bacteria 1624
126 Ga0207650_10502711 3300025925 Bacteria 1013
127 Ga0207659_10059392 3300025926 Bacteria 2749
128 Ga0207659_10094644 3300025926 Bacteria 2239
129 Ga0207644_10146921 3300025931 Bacteria 1821
130 Ga0207706_10035600 3300025933 Bacteria 4425
131 Ga0207686_10187822 3300025934 Bacteria 1471
132 Ga0207686_10339853 3300025934 Bacteria 1127
133 Ga0207669_10286529 3300025937 Unclassified 1245
134 Ga0207704_10049046 3300025938 Bacteria 2537
135 Ga0207704_10078370 3300025938 Bacteria 2125
136 Ga0207665_10018717 3300025939 Bacteria 4551
137 Ga0207691_10043764 3300025940 Bacteria 4125
138 Ga0207711_10032702 3300025941 Bacteria 4398
139 Ga0207661_10595468 3300025944 Bacteria 1015
140 Ga0207679_10280108 3300025945 Bacteria 1430
141 Ga0207679_10841831 3300025945 Bacteria 837
142 Ga0207667_10155168 3300025949 Unclassified 2356
143 Ga0207658_10195885 3300025986 Bacteria 1683
144 Ga0207678_10609216 3300026067 Bacteria 958
145 Ga0207702_10237175 3300026078 Bacteria 1707
146 Ga0207641_10027030 3300026088 Bacteria 4738
147 Ga0207641_10481557 3300026088 Bacteria 1203
148 Ga0207641_10746362 3300026088 Bacteria 966
149 Ga0207648_10052969 3300026089 Bacteria 3548
150 Ga0207648_10376087 3300026089 Bacteria 1284
151 Ga0207676_10313312 3300026095 Bacteria 1437
152 Ga0207674_10222951 3300026116 Bacteria 1834
153 Ga0207683_10007694 3300026121 Bacteria 9228
154 Ga0207698_10547933 3300026142 Bacteria 1133
155 Ga0209974_10092959 3300027876 Bacteria 1048
156 Ga0268266_10206522 3300028379 Bacteria 1800
157 Ga0268266_10210884 3300028379 Bacteria 1781
158 Ga0268265_10295566 3300028380 Bacteria 1456
159 Ga0268264_10437094 3300028381 Bacteria 1265
160 Ga0307405_10684933 3300031731 Bacteria 847
161 Ga0395898_0077151 3300037466 Bacteria 3217
162 Ga0395898_0560462 3300037466 Bacteria 1085
163 Ga0395901_0455954 3300038443 Unclassified 1307
164 Ga0395901_1079431 3300038443 Unclassified 774
165 Ga0436360_0033319 3300039438 Bacteria 973
166 Ga0436361_0794472 3300039447 Bacteria 3093
167 Ga0436363_1154384 3300039450 Unclassified 958
168 Ga0450894_000961 3300042131 Bacteria 4533
169 Ga0450895_002768 3300042132 Bacteria 1324
170 Ga0450896_000445 3300042133 Bacteria 4232
171 Ga0439464_0093374 3300042439 Bacteria 909
172 Ga0466957_0106337 3300044842 Bacteria 1775
173 Ga0451576_1385739 3300045051 Bacteria 732
174 Ga0466967_0001893 3300045976 Bacteria 12641
175 Ga0466967_0075954 3300045976 Unclassified 3021
176 Ga0495580_0613403 3300046472 Unclassified 718
177 Ga0495664_0020615 3300046477 Bacteria 3803
178 Ga0495594_0021547 3300046499 Bacteria 3439
179 Ga0495618_0287571 3300046514 Bacteria 1024
180 Ga0495630_0541003 3300046517 Unclassified 893
181 Ga0495640_0434240 3300046533 Unclassified 803
182 Ga0495586_0027078 3300046535 Bacteria 3068
183 Ga0495587_0262950 3300046536 Bacteria 969
184 Ga0495645_0215696 3300046543 Bacteria 1294
185 Ga0495645_0339548 3300046543 Unclassified 970
186 Ga0495634_0122722 3300046642 Bacteria 1663
187 Ga0495588_0122243 3300046674 Bacteria 1372
188 Ga0495646_0156557 3300046680 Bacteria 1264
189 Ga0495669_0052539 3300046684 Bacteria 1831
190 Ga0495669_0054341 3300046684 Unclassified 1803
191 Ga0495613_0037800 3300046689 Bacteria 3579
192 Ga0495604_0138080 3300047317 Bacteria 1745
193 Ga0495675_0024443 3300047444 Unclassified 3851
194 Ga0495686_0008419 3300047472 Bacteria 7568
195 Ga0496100_0135748 3300048903 Bacteria 1738
196 Ga0496104_0039358 3300048907 Bacteria 4427
197 Ga0496105_0023414 3300048908 Bacteria 5008
198 Ga0496105_0181631 3300048908 Bacteria 1722
199 Ga0496106_0250268 3300048909 Bacteria 1417
200 Ga0496107_0212022 3300048910 Bacteria 1440
201 Ga0496108_0001370 3300048911 Bacteria 19169
202 Ga0496109_0013530 3300048912 Bacteria 7082
203 Ga0496109_0201114 3300048912 Bacteria 1873
204 Ga0496110_0049924 3300048913 Bacteria 3672
205 Ga0496111_0030400 3300048914 Bacteria 3840
206 Ga0496112_0024490 3300048915 Bacteria 5780
207 Ga0496112_0103201 3300048915 Bacteria 2821
208 Ga0496113_0012517 3300048916 Bacteria 5705
209 Ga0496113_0294248 3300048916 Bacteria 1299
210 Ga0496115_0020384 3300048918 Bacteria 5115
211 Ga0496115_0103638 3300048918 Bacteria 2334
212 Ga0501034_0352348 3300049571 Bacteria 1400
213 Ga0501036_0626011 3300049572 Bacteria 892
214 Ga0501038_0273276 3300049574 Bacteria 1332
215 Ga0501072_0540332 3300049588 Unclassified 921
216 nmdc:mga06r32_77979_c1 3300050510 Bacteria 3219
217 Ga0495601_0057797 3300053077 Bacteria 2457
218 Ga0495595_0033869 3300053084 Bacteria 2307
219 Ga0495619_0063481 3300053085 Bacteria 2460
220 Ga0501082_1133177 3300060353 Bacteria 684
221 Ga0065714_10102307
222 Ga0058863_11549327
223 Ga0058862_10060428
224 Ga0065715_10002039
225 Ga0070658_10000121
226 Ga0070676_10102657
227 Ga0070676_10233563
228 Ga0070670_100206642
229 Ga0070680_100000986
230 Ga0070680_100745229
231 Ga0070682_100209059
232 Ga0070669_100059858
233 Ga0070675_100099272
234 Ga0070671_100134688
235 Ga0070674_100196107
236 Ga0070673_100053466
237 Ga0070673_100285460
238 Ga0070688_100006203
239 Ga0070688_100127248
240 Ga0070688_100467303
241 Ga0070667_100333081
242 Ga0070667_100552806
243 Ga0070709_10031530
244 Ga0070714_100218552
245 Ga0070713_100071046
246 Ga0070678_100056265
247 Ga0070681_10018679
248 Ga0070681_10039607
249 Ga0070681_10059995
250 Ga0070681_10072900
251 Ga0070685_10022366
252 Ga0070679_100000968
253 Ga0070679_100002610
254 Ga0070679_100048750
255 Ga0070679_100111123
256 Ga0070679_100124518
257 Ga0070684_100224565
258 Ga0070672_100061635
259 Ga0070672_100211211
260 Ga0070686_100289159
261 Ga0070695_100055096
262 Ga0070665_100084966
263 Ga0070665_100238628
264 Ga0070704_100391516
265 Ga0068855_100182459
266 Ga0070664_100936483
267 Ga0068856_100211643
268 Ga0068852_101107670
269 Ga0068859_100204999
270 Ga0068864_100117092
271 Ga0068864_100263221
272 Ga0068866_10021572
273 Ga0068870_10309944
274 Ga0068863_100104043
275 Ga0068860_100479156
276 Ga0068862_100262545
277 Ga0081539_10032394
278 Ga0070712_100175981
279 Ga0097621_100025477
280 Ga0097621_100421432
281 Ga0097621_100887816
282 Ga0068871_100309391
283 Ga0075431_100077735
284 Ga0068865_100640190
285 Ga0097620_100205018
286 Ga0099795_10366015
287 Ga0105240_10001618
288 Ga0105240_10001720
289 Ga0105245_10453677
290 Ga0105245_10964554
291 Ga0114129_12004128
292 Ga0105243_10347740
293 Ga0105248_10022452
294 Ga0105237_10473014
295 Ga0105239_10316032
296 Ga0105239_10479781
297 Ga0105246_10160678
298 Ga0157373_10223901
299 Ga0157370_10265742
300 Ga0157369_10056032
301 Ga0157369_10093019
302 Ga0157369_10374427
303 Ga0157374_10248028
304 Ga0157374_11386542
305 Ga0157378_11267810
306 Ga0163162_10075233
307 Ga0163162_10115900
308 Ga0157372_10099990
309 Ga0157372_10762360
310 Ga0157375_10203006
311 Ga0163163_10095685
312 Ga0157380_10583171
313 Ga0157377_10197565
314 Ga0157376_10023888
315 Ga0157376_10077255
316 Ga0163161_10187785
317 Ga0197907_10479971
318 Ga0206356_11525490
319 Ga0213872_10049355
320 Ga0209233_1043045
321 Ga0207697_10014606
322 Ga0207642_10028625
323 Ga0207642_10240729
324 Ga0207699_10503146
325 Ga0207645_10055301
326 Ga0207645_10094213
327 Ga0207707_10005331
328 Ga0207707_10085986
329 Ga0207707_10112109
330 Ga0207707_10187105
331 Ga0207707_10456364
332 Ga0207707_10486069
333 Ga0207695_10001806
334 Ga0207695_10014806
335 Ga0207695_10162138
336 Ga0207693_10176485
337 Ga0207660_10005756
338 Ga0207660_10154371
339 Ga0207657_10508530
340 Ga0207652_10002459
341 Ga0207652_10005848
342 Ga0207652_10015711
343 Ga0207681_10005649
344 Ga0207650_10028107
345 Ga0207650_10193940
346 Ga0207650_10502711
347 Ga0207659_10059392
348 Ga0207659_10094644
349 Ga0207644_10146921
350 Ga0207706_10035600
351 Ga0207686_10187822
352 Ga0207686_10339853
353 Ga0207669_10286529
354 Ga0207704_10049046
355 Ga0207704_10078370
356 Ga0207665_10018717
357 Ga0207691_10043764
358 Ga0207711_10032702
359 Ga0207661_10595468
360 Ga0207679_10280108
361 Ga0207679_10841831
362 Ga0207667_10155168
363 Ga0207658_10195885
364 Ga0207678_10609216
365 Ga0207702_10237175
366 Ga0207641_10027030
367 Ga0207641_10481557
368 Ga0207641_10746362
369 Ga0207648_10052969
370 Ga0207648_10376087
371 Ga0207676_10313312
372 Ga0207674_10222951
373 Ga0207683_10007694
374 Ga0207698_10547933
375 Ga0209974_10092959
376 Ga0268266_10206522
377 Ga0268266_10210884
378 Ga0268265_10295566
379 Ga0268264_10437094
380 Ga0307405_10684933
381 Ga0395898_0077151
382 Ga0395898_0560462
383 Ga0395901_0455954
384 Ga0395901_1079431
385 Ga0436360_0033319
386 Ga0436361_0794472
387 Ga0436363_1154384
388 Ga0450894_000961
389 Ga0450895_002768
390 Ga0450896_000445
391 Ga0439464_0093374
392 Ga0466957_0106337
393 Ga0451576_1385739
394 Ga0466967_0001893
395 Ga0466967_0075954
396 Ga0495580_0613403
397 Ga0495664_0020615
398 Ga0495594_0021547
399 Ga0495618_0287571
400 Ga0495630_0541003
401 Ga0495640_0434240
402 Ga0495586_0027078
403 Ga0495587_0262950
404 Ga0495645_0215696
405 Ga0495645_0339548
406 Ga0495634_0122722
407 Ga0495588_0122243
408 Ga0495646_0156557
409 Ga0495669_0052539
410 Ga0495669_0054341
411 Ga0495613_0037800
412 Ga0495604_0138080
413 Ga0495675_0024443
414 Ga0495686_0008419
415 Ga0496100_0135748
416 Ga0496104_0039358
417 Ga0496105_0023414
418 Ga0496105_0181631
419 Ga0496106_0250268
420 Ga0496107_0212022
421 Ga0496108_0001370
422 Ga0496109_0013530
423 Ga0496109_0201114
424 Ga0496110_0049924
425 Ga0496111_0030400
426 Ga0496112_0024490
427 Ga0496112_0103201
428 Ga0496113_0012517
429 Ga0496113_0294248
430 Ga0496115_0020384
431 Ga0496115_0103638
432 Ga0501034_0352348
433 Ga0501036_0626011
434 Ga0501038_0273276
435 Ga0501072_0540332
436 nmdc:mga06r32_77979_c1
437 Ga0495601_0057797
438 Ga0495595_0033869
439 Ga0495619_0063481
440 Ga0501082_1133177

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

35

231

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ka9-assembly1.cif.gz_H imidazole glycerol phosphate synthase 0.9205 1 194
4gud-assembly2.cif.gz_B crystal structure of amidotransferase hish from vibrio cholerae 0.9103 2 193
4gud-assembly1.cif.gz_A crystal structure of amidotransferase hish from vibrio cholerae 0.9064 2 195
1ox4-assembly1.cif.gz_A towards understanding the mechanism of the complex cyclization reaction catalyzed by imidazole glycerophosphate synthase 0.9003 2 194
4gud-assembly1.cif.gz_A crystal structure of amidotransferase hish from vibrio cholerae 0.8976 2 195
ID Description Score Start End Superfamily
af_Q57929_1_195_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9537 1 195 3.40.50.880
af_A0A1D6L7F2_93_266_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9372 21 182 3.40.50.880
af_P9WMM1_1_205_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9364 2 195 3.40.50.880
af_Q9SZ30_59_284_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9326 2 192 3.40.50.880
af_A0A1D6H537_1_181_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9276 55 192 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A2V9WMZ7-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.9947 1 195 GO:0000105
GO:0000107
GO:0004359
GO:0005737
GO:0006541
GO:0016829
AF-A0A2V9WMZ7-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.9897 1 195 GO:0000105
GO:0000107
GO:0004359
GO:0005737
GO:0006541
GO:0016829
AF-A0A1G0QUI8-F1-model_v4 Imidazole glycerol phosphate synthase, glutamine amidotransferase subunit 0.9858 110 195 GO:0000105
GO:0000107
GO:0004359
GO:0016829
AF-A0A7C5Z272-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.9824 1 195 GO:0000105
GO:0000107
GO:0004359
GO:0005737
GO:0006541
GO:0016829
AF-A0A2V8HHB8-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.9811 1 194 GO:0000105
GO:0000107
GO:0004359
GO:0005737
GO:0006541
GO:0016829

Map