F331775

General Info

Members Datasets Scaffolds Average Seq Length
220 169 440 143

Family's Representative Sequence

Representative Sequence 3300005288|Ga0065714_10022348|Ga0065714_100223482
Length 160
Sequence MVSRRAAYVILFPMTTPGVKATVRFVSDDLFLGITPSGHALPLDTDSQRSSAPSPVELLLVALGACAATDVAGILVKKRQHVTSYVVEVTGTRRDEYPRSYTXMNVRHILTGKSISPXAVAHAIELSETKXCSVAATLRPTVEIQSSFEIIEEPTTETRE

Samples

Sample ID Description Type Environment
1 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
83 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
93 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
94 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
95 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
96 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
97 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
98 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
99 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
100 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
101 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
102 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
103 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
104 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
105 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
106 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
107 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
108 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
109 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
110 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
111 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
112 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
113 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
114 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
115 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
116 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
117 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
118 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
119 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
120 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
121 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
122 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
127 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
128 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
129 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
130 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
131 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
132 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
133 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
135 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
136 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
137 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
138 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
139 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
140 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
141 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
142 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
143 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
144 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
145 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
146 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
147 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
148 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
149 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
150 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
151 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
152 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
153 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
154 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
155 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
156 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
157 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
158 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
159 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
160 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
161 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
162 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
163 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
164 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
168 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.82
Rhizosphere 98.18
Stem 0
Stem Tuber 0
Unclassified 42.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10022348 3300005288 Bacteria 1046
2 Ga0065704_10008803 3300005289 Bacteria 2811
3 Ga0065704_10138292 3300005289 Bacteria 1546
4 Ga0065712_10023479 3300005290 Bacteria 2177
5 Ga0065715_10028555 3300005293 Bacteria 1416
6 Ga0065715_10205547 3300005293 Bacteria 1339
7 Ga0065715_10574138 3300005293 Unclassified 725
8 Ga0070690_100002209 3300005330 Bacteria 10415
9 Ga0070670_100109704 3300005331 Unclassified 2378
10 Ga0068869_100002890 3300005334 Bacteria 10436
11 Ga0070682_100000059 3300005337 Bacteria 106643
12 Ga0068868_100147575 3300005338 Bacteria 1935
13 Ga0070689_100070972 3300005340 Bacteria 2720
14 Ga0070669_100127057 3300005353 Bacteria 1952
15 Ga0070674_100569288 3300005356 Bacteria 953
16 Ga0070701_10404378 3300005438 Unclassified 866
17 Ga0070705_100083509 3300005440 Unclassified 1968
18 Ga0070700_100364072 3300005441 Unclassified 1076
19 Ga0070700_100386236 3300005441 Bacteria 1049
20 Ga0070700_100642247 3300005441 Unclassified 837
21 Ga0070694_100088668 3300005444 Bacteria 2166
22 Ga0070694_100181323 3300005444 Bacteria 1558
23 Ga0070694_100263446 3300005444 Bacteria 1308
24 Ga0070694_100496878 3300005444 Unclassified 970
25 Ga0070694_100572835 3300005444 Bacteria 906
26 Ga0070694_100773298 3300005444 Unclassified 786
27 Ga0070708_100022688 3300005445 Bacteria 5327
28 Ga0070662_100749046 3300005457 Unclassified 828
29 Ga0068867_101495017 3300005459 Bacteria 629
30 Ga0070685_10315724 3300005466 Unclassified 1057
31 Ga0070706_100088878 3300005467 Bacteria 2864
32 Ga0070706_100248153 3300005467 Bacteria 1662
33 Ga0070706_101185280 3300005467 Unclassified 702
34 Ga0070706_101547384 3300005467 Bacteria 605
35 Ga0070707_100000205 3300005468 Bacteria 59421
36 Ga0070707_100007438 3300005468 Bacteria 10170
37 Ga0070698_100001851 3300005471 Bacteria 23556
38 Ga0070698_100024094 3300005471 Bacteria 6352
39 Ga0070698_100083789 3300005471 Bacteria 3177
40 Ga0070698_100656429 3300005471 Unclassified 990
41 Ga0070699_100085046 3300005518 Bacteria 2760
42 Ga0070699_100542692 3300005518 Bacteria 1058
43 Ga0070699_100941493 3300005518 Unclassified 791
44 Ga0070697_100027536 3300005536 Bacteria 4548
45 Ga0070697_100106827 3300005536 Bacteria 2329
46 Ga0070697_100156170 3300005536 Bacteria 1926
47 Ga0070697_100272117 3300005536 Bacteria 1452
48 Ga0070697_100326547 3300005536 Unclassified 1322
49 Ga0070697_100416840 3300005536 Bacteria 1167
50 Ga0070686_100027979 3300005544 Bacteria 3415
51 Ga0070695_100150686 3300005545 Bacteria 1623
52 Ga0070695_100214736 3300005545 Bacteria 1383
53 Ga0070696_100147619 3300005546 Bacteria 1723
54 Ga0070696_100527493 3300005546 Bacteria 943
55 Ga0070696_100591645 3300005546 Bacteria 893
56 Ga0070693_100080095 3300005547 Bacteria 1945
57 Ga0070704_100486426 3300005549 Bacteria 1069
58 Ga0070704_102225755 3300005549 Unclassified 510
59 Ga0068857_100855799 3300005577 Unclassified 870
60 Ga0068854_100157057 3300005578 Bacteria 1758
61 Ga0070702_100392418 3300005615 Bacteria 990
62 Ga0068859_100563410 3300005617 Bacteria 1233
63 Ga0068861_100001639 3300005719 Bacteria 14276
64 Ga0068861_100050010 3300005719 Bacteria 3168
65 Ga0068861_102038313 3300005719 Unclassified 573
66 Ga0068870_10024146 3300005840 Bacteria 3006
67 Ga0068858_100015296 3300005842 Bacteria 7219
68 Ga0068862_100688312 3300005844 Unclassified 989
69 Ga0081539_10002203 3300005985 Bacteria 28490
70 Ga0081539_10022842 3300005985 Unclassified 4121
71 Ga0081539_10206085 3300005985 Bacteria 904
72 Ga0068871_100163338 3300006358 Unclassified 1905
73 Ga0075431_100252939 3300006847 Bacteria 1790
74 Ga0075433_10034733 3300006852 Bacteria 4332
75 Ga0075434_102353628 3300006871 Unclassified 535
76 Ga0068865_100253622 3300006881 Bacteria 1390
77 Ga0097620_100563410 3300006931 Bacteria 1233
78 Ga0114129_10056616 3300009147 Bacteria 5491
79 Ga0105243_10286693 3300009148 Bacteria 1486
80 Ga0105243_10412247 3300009148 Bacteria 1258
81 Ga0105243_10416015 3300009148 Bacteria 1252
82 Ga0105243_10597839 3300009148 Unclassified 1062
83 Ga0105241_10388688 3300009174 Bacteria 1221
84 Ga0105242_11006052 3300009176 Bacteria 842
85 Ga0105248_10548469 3300009177 Unclassified 1304
86 Ga0105249_10084212 3300009553 Unclassified 2961
87 Ga0105249_11688296 3300009553 Unclassified 706
88 Ga0099796_10092279 3300010159 Bacteria 1127
89 Ga0105239_11175639 3300010375 Unclassified 884
90 Ga0105246_10382431 3300011119 Unclassified 1164
91 Ga0157374_10065456 3300013296 Bacteria 3413
92 Ga0157378_10019787 3300013297 Bacteria 5920
93 Ga0157378_10186130 3300013297 Bacteria 1956
94 Ga0157378_10370255 3300013297 Bacteria 1404
95 Ga0163162_10004423 3300013306 Bacteria 13529
96 Ga0157375_10195132 3300013308 Unclassified 2180
97 Ga0157375_10606973 3300013308 Bacteria 1253
98 Ga0163163_10028737 3300014325 Bacteria 5344
99 Ga0163163_10847520 3300014325 Bacteria 977
100 Ga0157380_10031967 3300014326 Bacteria 4043
101 Ga0157377_10887143 3300014745 Unclassified 665
102 Ga0157379_10247363 3300014968 Unclassified 1618
103 Ga0182005_1117540 3300015265 Unclassified 755
104 Ga0207647_10331255 3300025904 Unclassified 863
105 Ga0207645_10654123 3300025907 Unclassified 714
106 Ga0207684_10040737 3300025910 Bacteria 3938
107 Ga0207684_10947364 3300025910 Unclassified 722
108 Ga0207646_10000042 3300025922 Bacteria 186121
109 Ga0207646_10000481 3300025922 Bacteria 53432
110 Ga0207681_10066697 3300025923 Unclassified 2492
111 Ga0207650_10143550 3300025925 Unclassified 1878
112 Ga0207706_11524869 3300025933 Unclassified 544
113 Ga0207686_11020925 3300025934 Unclassified 672
114 Ga0207709_11258432 3300025935 Bacteria 611
115 Ga0207670_11782710 3300025936 Unclassified 523
116 Ga0207711_10410840 3300025941 Unclassified 1258
117 Ga0207703_10101748 3300026035 Unclassified 2437
118 Ga0207703_10187358 3300026035 Bacteria 1830
119 Ga0207708_10268377 3300026075 Unclassified 1379
120 Ga0207708_10344704 3300026075 Unclassified 1221
121 Ga0207641_11044330 3300026088 Bacteria 815
122 Ga0207648_10411123 3300026089 Unclassified 1227
123 Ga0207675_100006659 3300026118 Bacteria 10932
124 Ga0207675_100587510 3300026118 Bacteria 1116
125 Ga0268265_10679085 3300028380 Unclassified 993
126 Ga0268264_10780892 3300028381 Unclassified 953
127 Ga0307408_100087256 3300031548 Bacteria 2347
128 Ga0307406_10134550 3300031901 Unclassified 1740
129 Ga0307412_10438416 3300031911 Bacteria 1073
130 Ga0307409_100076182 3300031995 Unclassified 2689
131 Ga0307414_10104884 3300032004 Unclassified 2136
132 Ga0307415_101752959 3300032126 Bacteria 600
133 Ga0373937_0133226 3300036401 Bacteria 2322
134 Ga0373937_0455579 3300036401 Unclassified 1215
135 Ga0395900_0681190 3300037418 Bacteria 963
136 Ga0395898_0706643 3300037466 Bacteria 950
137 Ga0395901_0712821 3300038443 Bacteria 1000
138 Ga0439439_0100449 3300041406 Unclassified 796
139 Ga0439433_0060864 3300041999 Unclassified 900
140 Ga0439462_0005360 3300042015 Unclassified 3159
141 Ga0453683_0013823 3300044673 Bacteria 5251
142 Ga0453684_0172489 3300044712 Bacteria 2547
143 Ga0451576_0014427 3300045051 Bacteria 8794
144 Ga0451576_2147564 3300045051 Unclassified 574
145 Ga0495651_0000385 3300046462 Bacteria 34136
146 Ga0495653_0258181 3300046463 Unclassified 1153
147 Ga0495580_0302873 3300046472 Unclassified 1088
148 Ga0495664_0030970 3300046477 Bacteria 3135
149 Ga0495608_0020820 3300046511 Unclassified 4506
150 Ga0495618_0277352 3300046514 Unclassified 1046
151 Ga0495628_0000283 3300046516 Bacteria 45481
152 Ga0495630_0150255 3300046517 Unclassified 1772
153 Ga0495663_0000212 3300046525 Bacteria 23260
154 Ga0495652_0001131 3300046529 Bacteria 30078
155 Ga0495640_0023906 3300046533 Bacteria 4445
156 Ga0495587_0003629 3300046536 Bacteria 10271
157 Ga0495598_0002467 3300046537 Bacteria 3823
158 Ga0495598_0086354 3300046537 Unclassified 1015
159 Ga0495621_0006271 3300046539 Unclassified 3461
160 Ga0495645_0020783 3300046543 Bacteria 4742
161 Ga0495667_0008999 3300046559 Bacteria 6784
162 Ga0495657_0017738 3300046675 Bacteria 5164
163 Ga0495599_0002592 3300046678 Bacteria 10538
164 Ga0495600_0000341 3300046809 Bacteria 24882
165 Ga0495604_0153397 3300047317 Unclassified 1634
166 Ga0495680_0012201 3300047322 Bacteria 7578
167 Ga0495675_0000599 3300047444 Bacteria 23250
168 Ga0495684_0004220 3300047471 Bacteria 11229
169 Ga0495602_0029131 3300048088 Bacteria 5269
170 Ga0496106_0187072 3300048909 Bacteria 1645
171 Ga0496108_0313510 3300048911 Bacteria 1367
172 Ga0496112_0478351 3300048915 Bacteria 1182
173 Ga0496113_0537379 3300048916 Bacteria 938
174 Ga0501290_001861 3300049513 Unclassified 2791
175 Ga0501291_013092 3300049514 Bacteria 1222
176 Ga0501292_001674 3300049515 Unclassified 2755
177 Ga0501296_000404 3300049519 Unclassified 4288
178 Ga0501297_010685 3300049520 Unclassified 1042
179 Ga0501297_032409 3300049520 Bacteria 702
180 Ga0501298_012798 3300049521 Unclassified 1476
181 Ga0501300_026692 3300049523 Unclassified 848
182 Ga0501038_0011801 3300049574 Bacteria 7972
183 Ga0501198_010641 3300049649 Unclassified 1362
184 Ga0501206_054888 3300049653 Unclassified 642
185 Ga0501211_008144 3300049658 Bacteria 1024
186 Ga0501216_011036 3300049660 Bacteria 1462
187 Ga0501223_016143 3300049663 Unclassified 1476
188 Ga0501223_065562 3300049663 Bacteria 713
189 Ga0501224_009138 3300049664 Unclassified 1449
190 Ga0501227_001709 3300049665 Unclassified 4870
191 Ga0501230_001295 3300049667 Unclassified 2949
192 Ga0501233_026315 3300049668 Unclassified 1284
193 Ga0501235_001873 3300049669 Unclassified 4498
194 Ga0501236_003095 3300049670 Unclassified 1931
195 Ga0501238_013020 3300049671 Bacteria 1129
196 Ga0501240_032104 3300049673 Unclassified 843
197 Ga0501243_000844 3300049675 Unclassified 4261
198 Ga0501250_003242 3300049680 Bacteria 1544
199 Ga0501251_008275 3300049681 Unclassified 1175
200 Ga0501253_067352 3300049683 Unclassified 784
201 Ga0501255_005309 3300049684 Bacteria 1282
202 Ga0501257_021303 3300049686 Bacteria 1528
203 Ga0501260_006822 3300049689 Bacteria 1105
204 Ga0501261_004684 3300049690 Unclassified 1699
205 Ga0501225_0046883 3300049705 Bacteria 1198
206 Ga0501225_0118023 3300049705 Unclassified 786
207 Ga0501245_001961 3300049708 Unclassified 2716
208 Ga0501263_018312 3300049760 Unclassified 925
209 Ga0501268_000952 3300049765 Unclassified 3420
210 Ga0501272_054787 3300049769 Bacteria 560
211 Ga0501273_002987 3300049770 Unclassified 1762
212 Ga0501274_033244 3300049771 Unclassified 591
213 Ga0501279_093695 3300049775 Unclassified 533
214 Ga0501283_012486 3300049779 Unclassified 1277
215 Ga0501226_009151 3300049853 Bacteria 1103
216 nmdc:mga05p37_814428_c1 3300050507 Unclassified 1019
217 nmdc:mga06r32_119594_c1 3300050510 Bacteria 2597
218 nmdc:mga0a205_9994_c1 3300050515 Bacteria 8706
219 Ga0495619_0445361 3300053085 Unclassified 893
220 Ga0501082_1366301 3300060353 Unclassified 619
221 Ga0065714_10022348
222 Ga0065704_10008803
223 Ga0065704_10138292
224 Ga0065712_10023479
225 Ga0065715_10028555
226 Ga0065715_10205547
227 Ga0065715_10574138
228 Ga0070690_100002209
229 Ga0070670_100109704
230 Ga0068869_100002890
231 Ga0070682_100000059
232 Ga0068868_100147575
233 Ga0070689_100070972
234 Ga0070669_100127057
235 Ga0070674_100569288
236 Ga0070701_10404378
237 Ga0070705_100083509
238 Ga0070700_100364072
239 Ga0070700_100386236
240 Ga0070700_100642247
241 Ga0070694_100088668
242 Ga0070694_100181323
243 Ga0070694_100263446
244 Ga0070694_100496878
245 Ga0070694_100572835
246 Ga0070694_100773298
247 Ga0070708_100022688
248 Ga0070662_100749046
249 Ga0068867_101495017
250 Ga0070685_10315724
251 Ga0070706_100088878
252 Ga0070706_100248153
253 Ga0070706_101185280
254 Ga0070706_101547384
255 Ga0070707_100000205
256 Ga0070707_100007438
257 Ga0070698_100001851
258 Ga0070698_100024094
259 Ga0070698_100083789
260 Ga0070698_100656429
261 Ga0070699_100085046
262 Ga0070699_100542692
263 Ga0070699_100941493
264 Ga0070697_100027536
265 Ga0070697_100106827
266 Ga0070697_100156170
267 Ga0070697_100272117
268 Ga0070697_100326547
269 Ga0070697_100416840
270 Ga0070686_100027979
271 Ga0070695_100150686
272 Ga0070695_100214736
273 Ga0070696_100147619
274 Ga0070696_100527493
275 Ga0070696_100591645
276 Ga0070693_100080095
277 Ga0070704_100486426
278 Ga0070704_102225755
279 Ga0068857_100855799
280 Ga0068854_100157057
281 Ga0070702_100392418
282 Ga0068859_100563410
283 Ga0068861_100001639
284 Ga0068861_100050010
285 Ga0068861_102038313
286 Ga0068870_10024146
287 Ga0068858_100015296
288 Ga0068862_100688312
289 Ga0081539_10002203
290 Ga0081539_10022842
291 Ga0081539_10206085
292 Ga0068871_100163338
293 Ga0075431_100252939
294 Ga0075433_10034733
295 Ga0075434_102353628
296 Ga0068865_100253622
297 Ga0097620_100563410
298 Ga0114129_10056616
299 Ga0105243_10286693
300 Ga0105243_10412247
301 Ga0105243_10416015
302 Ga0105243_10597839
303 Ga0105241_10388688
304 Ga0105242_11006052
305 Ga0105248_10548469
306 Ga0105249_10084212
307 Ga0105249_11688296
308 Ga0099796_10092279
309 Ga0105239_11175639
310 Ga0105246_10382431
311 Ga0157374_10065456
312 Ga0157378_10019787
313 Ga0157378_10186130
314 Ga0157378_10370255
315 Ga0163162_10004423
316 Ga0157375_10195132
317 Ga0157375_10606973
318 Ga0163163_10028737
319 Ga0163163_10847520
320 Ga0157380_10031967
321 Ga0157377_10887143
322 Ga0157379_10247363
323 Ga0182005_1117540
324 Ga0207647_10331255
325 Ga0207645_10654123
326 Ga0207684_10040737
327 Ga0207684_10947364
328 Ga0207646_10000042
329 Ga0207646_10000481
330 Ga0207681_10066697
331 Ga0207650_10143550
332 Ga0207706_11524869
333 Ga0207686_11020925
334 Ga0207709_11258432
335 Ga0207670_11782710
336 Ga0207711_10410840
337 Ga0207703_10101748
338 Ga0207703_10187358
339 Ga0207708_10268377
340 Ga0207708_10344704
341 Ga0207641_11044330
342 Ga0207648_10411123
343 Ga0207675_100006659
344 Ga0207675_100587510
345 Ga0268265_10679085
346 Ga0268264_10780892
347 Ga0307408_100087256
348 Ga0307406_10134550
349 Ga0307412_10438416
350 Ga0307409_100076182
351 Ga0307414_10104884
352 Ga0307415_101752959
353 Ga0373937_0133226
354 Ga0373937_0455579
355 Ga0395900_0681190
356 Ga0395898_0706643
357 Ga0395901_0712821
358 Ga0439439_0100449
359 Ga0439433_0060864
360 Ga0439462_0005360
361 Ga0453683_0013823
362 Ga0453684_0172489
363 Ga0451576_0014427
364 Ga0451576_2147564
365 Ga0495651_0000385
366 Ga0495653_0258181
367 Ga0495580_0302873
368 Ga0495664_0030970
369 Ga0495608_0020820
370 Ga0495618_0277352
371 Ga0495628_0000283
372 Ga0495630_0150255
373 Ga0495663_0000212
374 Ga0495652_0001131
375 Ga0495640_0023906
376 Ga0495587_0003629
377 Ga0495598_0002467
378 Ga0495598_0086354
379 Ga0495621_0006271
380 Ga0495645_0020783
381 Ga0495667_0008999
382 Ga0495657_0017738
383 Ga0495599_0002592
384 Ga0495600_0000341
385 Ga0495604_0153397
386 Ga0495680_0012201
387 Ga0495675_0000599
388 Ga0495684_0004220
389 Ga0495602_0029131
390 Ga0496106_0187072
391 Ga0496108_0313510
392 Ga0496112_0478351
393 Ga0496113_0537379
394 Ga0501290_001861
395 Ga0501291_013092
396 Ga0501292_001674
397 Ga0501296_000404
398 Ga0501297_010685
399 Ga0501297_032409
400 Ga0501298_012798
401 Ga0501300_026692
402 Ga0501038_0011801
403 Ga0501198_010641
404 Ga0501206_054888
405 Ga0501211_008144
406 Ga0501216_011036
407 Ga0501223_016143
408 Ga0501223_065562
409 Ga0501224_009138
410 Ga0501227_001709
411 Ga0501230_001295
412 Ga0501233_026315
413 Ga0501235_001873
414 Ga0501236_003095
415 Ga0501238_013020
416 Ga0501240_032104
417 Ga0501243_000844
418 Ga0501250_003242
419 Ga0501251_008275
420 Ga0501253_067352
421 Ga0501255_005309
422 Ga0501257_021303
423 Ga0501260_006822
424 Ga0501261_004684
425 Ga0501225_0046883
426 Ga0501225_0118023
427 Ga0501245_001961
428 Ga0501263_018312
429 Ga0501268_000952
430 Ga0501272_054787
431 Ga0501273_002987
432 Ga0501274_033244
433 Ga0501279_093695
434 Ga0501283_012486
435 Ga0501226_009151
436 nmdc:mga05p37_814428_c1
437 nmdc:mga06r32_119594_c1
438 nmdc:mga0a205_9994_c1
439 Ga0495619_0445361
440 Ga0501082_1366301

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

47

147

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ml8-assembly1.cif.gz_A-2 structural genomics 0.9365 20 150
1ml8-assembly1.cif.gz_A-2 structural genomics 0.9227 20 150
2e8c-assembly1.cif.gz_A crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5 0.9083 17 151
2e8c-assembly1.cif.gz_A crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5 0.8953 17 151
1lql-assembly4.cif.gz_G crystal structure of osmc like protein from mycoplasma pneumoniae 0.8527 16 148
ID Description Score Start End Superfamily
2egtA02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.952 54 151 3.30.300.20
1ml8A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9387 54 150 3.30.300.20
1ml8A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9294 54 150 3.30.300.20
2egtA02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9247 54 151 3.30.300.20
2e8fA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9237 20 151 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A7C2TV18-F1-model_v4 OsmC family peroxiredoxin 0.9661 20 152
AF-A0A2H5VLB9-F1-model_v4 Protein YhfA 0.9657 20 151
AF-A0A101G1M0-F1-model_v4 deleted 0.96 50 152
AF-B2PUV4-F1-model_v4 deleted 0.9573 20 150
AF-A0A4P6K5H4-F1-model_v4 OsmC family peroxiredoxin 0.9558 20 152 GO:0016020

Map