F331387

General Info

Members Datasets Scaffolds Average Seq Length
219 106 438 133

Family's Representative Sequence

Representative Sequence 3300044683|Ga0466965_0007112|Ga0466965_0007112_3745_4197
Length 150
Sequence MAVMARGYPSAQVETLEEAMPGRQELPSTVARSPKKAQRTWIKAHDSAVETYGEGERAHRTAFSALKHSFEKVGDHWEPKKEKGPSDRQAERSTPAAGETAGGVDANASKQHLYDLAKRLKIEGRSRMTKAELVDAIGKANNRETARARS

Samples

Sample ID Description Type Environment
1 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
2 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
8 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
9 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
10 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
11 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
12 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
13 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
14 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
15 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
16 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
17 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
18 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
19 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
20 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
21 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
22 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
23 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
30 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
31 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
32 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
33 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
34 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
35 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
36 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
37 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
38 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
39 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
40 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
41 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
42 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
43 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
44 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
45 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
46 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
47 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
48 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
49 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
50 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
51 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
52 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
53 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
54 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
55 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
56 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
57 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
58 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
59 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
60 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
61 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
62 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
63 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
64 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
65 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
66 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
67 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
68 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
69 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
70 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
76 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
81 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
82 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
83 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
84 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
86 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
87 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
88 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
89 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
90 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
91 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
92 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
93 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
94 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
95 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
96 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
97 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
98 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
99 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
100 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
101 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
102 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
103 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
104 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
105 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
106 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.63
Metatranscriptomes 13.24
Isolates 9.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.48
Rhizosphere 92.24
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466965_0007112 3300044683 Bacteria 5124
2 Ga0007429J51699_1111723 3300003579 Bacteria 539
3 Ga0070658_10281739 3300005327 Bacteria 1415
4 Ga0070714_100102357 3300005435 Bacteria 2525
5 Ga0070713_100374374 3300005436 Bacteria 1325
6 Ga0070710_10000139 3300005437 Bacteria 33531
7 Ga0070679_100022457 3300005530 Bacteria 6166
8 Ga0068855_101542663 3300005563 Bacteria 681
9 Ga0070717_10500447 3300006028 Bacteria 1098
10 Ga0070712_100551474 3300006175 Bacteria 971
11 Ga0114129_11428988 3300009147 Bacteria 853
12 Ga0157370_10491355 3300013104 Bacteria 1128
13 Ga0157370_11733248 3300013104 Bacteria 561
14 Ga0197907_10163291 3300020069 Bacteria 932
15 Ga0197907_10583190 3300020069 Bacteria 914
16 Ga0197907_10658842 3300020069 Bacteria 2987
17 Ga0197907_11148968 3300020069 Bacteria 1198
18 Ga0206356_10777927 3300020070 Bacteria 738
19 Ga0206356_11540117 3300020070 Bacteria 591
20 Ga0206356_11868215 3300020070 Bacteria 780
21 Ga0206349_1372461 3300020075 Bacteria 875
22 Ga0206349_1702649 3300020075 Bacteria 2897
23 Ga0206351_10284584 3300020077 Bacteria 1196
24 Ga0206351_10428723 3300020077 Bacteria 890
25 Ga0206352_10801394 3300020078 Bacteria 872
26 Ga0206352_11318320 3300020078 Bacteria 590
27 Ga0206350_10262888 3300020080 Bacteria 828
28 Ga0206350_10971910 3300020080 Bacteria 2276
29 Ga0206350_11255629 3300020080 Bacteria 912
30 Ga0206350_11447607 3300020080 Bacteria 745
31 Ga0206354_10196785 3300020081 Bacteria 958
32 Ga0206353_10703029 3300020082 Bacteria 1565
33 Ga0206353_11508515 3300020082 Bacteria 826
34 Ga0154015_1176574 3300020610 Bacteria 927
35 Ga0154015_1310280 3300020610 Bacteria 1276
36 Ga0154015_1598239 3300020610 Bacteria 752
37 Ga0224712_10007500 3300022467 Bacteria 3180
38 Ga0224712_10076834 3300022467 Bacteria 1369
39 Ga0224712_10113897 3300022467 Bacteria 1163
40 Ga0224712_10230721 3300022467 Bacteria 850
41 Ga0224712_10559525 3300022467 Bacteria 556
42 Ga0207692_10002357 3300025898 Bacteria 7244
43 Ga0207692_10286663 3300025898 Bacteria 998
44 Ga0207705_10340695 3300025909 Bacteria 1154
45 Ga0207693_10113764 3300025915 Bacteria 2123
46 Ga0207663_10046115 3300025916 Bacteria 2684
47 Ga0207700_10059983 3300025928 Bacteria 2879
48 Ga0207667_11317877 3300025949 Bacteria 698
49 Ga0316177_1052174 3300030731 Bacteria 972
50 Ga0307408_100060350 3300031548 Bacteria 2764
51 Ga0307408_101161860 3300031548 Bacteria 718
52 Ga0307405_10403268 3300031731 Bacteria 1071
53 Ga0307413_10370919 3300031824 Bacteria 1112
54 Ga0307410_10079979 3300031852 Bacteria 2292
55 Ga0307410_10293546 3300031852 Bacteria 1280
56 Ga0307410_11091726 3300031852 Bacteria 691
57 Ga0307406_10117835 3300031901 Bacteria 1840
58 Ga0307412_10068408 3300031911 Bacteria 2415
59 Ga0307412_10708870 3300031911 Bacteria 865
60 Ga0307412_11682966 3300031911 Bacteria 581
61 Ga0307409_100048634 3300031995 Bacteria 3229
62 Ga0307409_101491741 3300031995 Bacteria 703
63 Ga0307409_101905896 3300031995 Bacteria 624
64 Ga0307409_102667479 3300031995 Bacteria 528
65 Ga0307416_100057946 3300032002 Bacteria 3137
66 Ga0307416_100103130 3300032002 Bacteria 2489
67 Ga0307414_10116069 3300032004 Bacteria 2049
68 Ga0307411_10187695 3300032005 Bacteria 1575
69 Ga0307411_10724346 3300032005 Bacteria 869
70 Ga0307415_100691849 3300032126 Bacteria 919
71 Ga0373925_0271372 3300037068 Bacteria 1365
72 Ga0451791_1352151 3300041451 Bacteria 1086
73 Ga0451795_0697852 3300041456 Bacteria 1369
74 Ga0451807_2731002 3300041486 Bacteria 616
75 Ga0451841_0315406 3300041498 Bacteria 525
76 Ga0451841_0454688 3300041498 Bacteria 556
77 Ga0451853_2385593 3300041512 Bacteria 1039
78 Ga0439449_0056574 3300042007 Bacteria 1448
79 Ga0439449_0061729 3300042007 Bacteria 1383
80 Ga0439449_0195100 3300042007 Bacteria 758
81 Ga0466969_0013571 3300044656 Bacteria 4289
82 Ga0466969_0017607 3300044656 Bacteria 3727
83 Ga0466969_0030603 3300044656 Bacteria 2742
84 Ga0466969_0060842 3300044656 Bacteria 1835
85 Ga0466969_0146469 3300044656 Bacteria 1089
86 Ga0466972_0010851 3300044658 Bacteria 4571
87 Ga0466972_0019917 3300044658 Bacteria 3353
88 Ga0466972_0023737 3300044658 Bacteria 3048
89 Ga0466972_0041096 3300044658 Bacteria 2251
90 Ga0466972_0090907 3300044658 Bacteria 1448
91 Ga0466972_0152291 3300044658 Bacteria 1087
92 Ga0466965_0000699 3300044683 Bacteria 12450
93 Ga0466965_0012493 3300044683 Bacteria 3995
94 Ga0466965_0112160 3300044683 Bacteria 1402
95 Ga0466965_0440915 3300044683 Bacteria 724
96 Ga0466966_0002351 3300044684 Bacteria 12346
97 Ga0466966_0006905 3300044684 Bacteria 7521
98 Ga0466966_0011096 3300044684 Bacteria 5982
99 Ga0466966_0026068 3300044684 Bacteria 3817
100 Ga0466966_0029659 3300044684 Bacteria 3557
101 Ga0466966_0042645 3300044684 Bacteria 2911
102 Ga0466966_0128692 3300044684 Bacteria 1551
103 Ga0466966_0284266 3300044684 Bacteria 995
104 Ga0466966_0354575 3300044684 Bacteria 881
105 Ga0466961_0003351 3300044693 Bacteria 9998
106 Ga0466961_0017252 3300044693 Bacteria 4637
107 Ga0466961_0019567 3300044693 Bacteria 4355
108 Ga0466961_0047821 3300044693 Bacteria 2735
109 Ga0466961_0075741 3300044693 Bacteria 2133
110 Ga0466961_0094114 3300044693 Bacteria 1891
111 Ga0466963_0000275 3300044694 Bacteria 22896
112 Ga0466963_0217745 3300044694 Bacteria 1337
113 Ga0466964_0004335 3300044706 Bacteria 5227
114 Ga0466971_0013308 3300044719 Bacteria 3612
115 Ga0466971_0046755 3300044719 Bacteria 1945
116 Ga0466971_0108684 3300044719 Bacteria 1278
117 Ga0466971_0200500 3300044719 Bacteria 942
118 Ga0466971_0230585 3300044719 Bacteria 879
119 Ga0466968_0146039 3300044735 Bacteria 1085
120 Ga0466970_0000487 3300044765 Bacteria 19510
121 Ga0466970_0006763 3300044765 Bacteria 5740
122 Ga0466970_0031425 3300044765 Bacteria 2804
123 Ga0466970_0102756 3300044765 Bacteria 1557
124 Ga0466970_0286464 3300044765 Bacteria 927
125 Ga0466970_0437386 3300044765 Bacteria 749
126 Ga0466970_0699091 3300044765 Bacteria 591
127 Ga0466957_0000049 3300044842 Bacteria 44603
128 Ga0466957_0011426 3300044842 Bacteria 5124
129 Ga0466960_0009542 3300044901 Bacteria 4004
130 Ga0466960_0055358 3300044901 Bacteria 1929
131 Ga0466960_0118759 3300044901 Bacteria 1382
132 Ga0466960_0419340 3300044901 Bacteria 774
133 Ga0466960_0481587 3300044901 Bacteria 725
134 Ga0466960_0792815 3300044901 Bacteria 573
135 Ga0466959_0000275 3300045049 Bacteria 31466
136 Ga0466959_0043794 3300045049 Bacteria 3298
137 Ga0466959_0047180 3300045049 Bacteria 3169
138 Ga0466959_0064718 3300045049 Bacteria 2654
139 Ga0466959_0145956 3300045049 Bacteria 1669
140 Ga0466959_0178382 3300045049 Bacteria 1487
141 Ga0466959_0443270 3300045049 Bacteria 881
142 Ga0466958_0039325 3300045836 Bacteria 2841
143 Ga0466958_0240740 3300045836 Bacteria 1156
144 Ga0466958_0650218 3300045836 Bacteria 686
145 Ga0466958_1114512 3300045836 Bacteria 515
146 Ga0466967_0002998 3300045976 Bacteria 10821
147 Ga0466967_0067559 3300045976 Bacteria 3189
148 Ga0466967_2272179 3300045976 Bacteria 538
149 Ga0496100_0207526 3300048903 Bacteria 1431
150 Ga0496101_0219508 3300048904 Bacteria 1475
151 Ga0496102_0750882 3300048905 Bacteria 898
152 Ga0496104_0063178 3300048907 Bacteria 3511
153 Ga0496105_0010636 3300048908 Bacteria 7239
154 Ga0496110_0627699 3300048913 Bacteria 973
155 Ga0496110_1478029 3300048913 Bacteria 589
156 Ga0496114_0364437 3300048917 Bacteria 1279
157 Ga0496119_0534095 3300048922 Bacteria 541
158 Ga0501033_0001395 3300049570 Bacteria 21458
159 Ga0501034_0005491 3300049571 Bacteria 13838
160 Ga0501034_0005585 3300049571 Bacteria 13698
161 Ga0501034_0100281 3300049571 Bacteria 2890
162 Ga0501036_0000708 3300049572 Bacteria 24642
163 Ga0501036_0004974 3300049572 Bacteria 10746
164 Ga0501036_0010792 3300049572 Bacteria 7549
165 Ga0501037_0007156 3300049573 Bacteria 8156
166 Ga0501037_0040608 3300049573 Bacteria 3424
167 Ga0501038_0046326 3300049574 Bacteria 3770
168 Ga0501038_0119451 3300049574 Bacteria 2176
169 Ga0501038_0127173 3300049574 Bacteria 2096
170 Ga0501038_0213736 3300049574 Bacteria 1541
171 Ga0501039_0005602 3300049575 Bacteria 9505
172 Ga0501039_0052421 3300049575 Bacteria 3157
173 Ga0501042_0022000 3300049578 Bacteria 4451
174 Ga0501042_0709412 3300049578 Bacteria 731
175 Ga0501043_0001323 3300049579 Bacteria 21678
176 Ga0501043_0002101 3300049579 Bacteria 17012
177 Ga0501043_0102901 3300049579 Bacteria 2244
178 Ga0501046_0007593 3300049580 Bacteria 9511
179 Ga0501047_0000056 3300049581 Bacteria 143501
180 Ga0501047_0001121 3300049581 Bacteria 26603
181 Ga0501047_0072747 3300049581 Bacteria 3309
182 Ga0501047_0112377 3300049581 Bacteria 2606
183 Ga0501047_0577963 3300049581 Bacteria 947
184 Ga0501068_0468382 3300049584 Bacteria 816
185 Ga0501070_0002708 3300049586 Bacteria 15474
186 Ga0501070_0105199 3300049586 Bacteria 2333
187 Ga0501074_0005333 3300049590 Bacteria 9243
188 Ga0501074_0153382 3300049590 Bacteria 1646
189 Ga0501243_017037 3300049675 Bacteria 1177
190 Ga0501035_0004440 3300049822 Bacteria 13308
191 Ga0501044_0005645 3300049823 Bacteria 13894
192 Ga0501044_0099525 3300049823 Bacteria 2926
193 Ga0501044_0155776 3300049823 Bacteria 2264
194 Ga0501044_0195991 3300049823 Bacteria 1980
195 Ga0495655_0299204 3300053083 Bacteria 552
196 Ga0466962_0001236 3300061719 Bacteria 11763
197 Ga0466962_0012708 3300061719 Bacteria 4050
198 Ga0466962_0165044 3300061719 Bacteria 1077
199 Ga0466962_0290212 3300061719 Bacteria 808
200 2547408847 2547132111 Bacteria 8013147
201 2554260526 2554235005 Bacteria 6457341
202 2623498439 2622736605 Bacteria 4992138
203 2753071204 2751185734 Bacteria 8863695
204 2768643118 2767802112 Bacteria 6465194
205 2791912477 2791354901 Bacteria 8322202
206 2793982126 2791355406 Bacteria 11364898
207 2810363141 2808606700 Bacteria 3482157
208 2870721992 2870721527 Bacteria 9689237
209 2905928810 2905926851 Bacteria 4423176
210 2912723301 2912715099 Bacteria 9460473
211 2912723567 2912715099 Bacteria 9460473
212 2946006053 2946003308 Bacteria 3857229
213 2947224657 2947224130 Bacteria 9938529
214 3006498571 3006493962 Bacteria 8825450
215 8047894375 8047893842 Bacteria 11723082
216 8048364677 8048356638 Bacteria 11044339
217 8048371392 8048369669 Bacteria 11666822
218 8048380193 8048379754 Bacteria 11877923
219 8053946001 8053945823 Bacteria 8962862
220 Ga0466965_0007112
221 Ga0007429J51699_1111723
222 Ga0070658_10281739
223 Ga0070714_100102357
224 Ga0070713_100374374
225 Ga0070710_10000139
226 Ga0070679_100022457
227 Ga0068855_101542663
228 Ga0070717_10500447
229 Ga0070712_100551474
230 Ga0114129_11428988
231 Ga0157370_10491355
232 Ga0157370_11733248
233 Ga0197907_10163291
234 Ga0197907_10583190
235 Ga0197907_10658842
236 Ga0197907_11148968
237 Ga0206356_10777927
238 Ga0206356_11540117
239 Ga0206356_11868215
240 Ga0206349_1372461
241 Ga0206349_1702649
242 Ga0206351_10284584
243 Ga0206351_10428723
244 Ga0206352_10801394
245 Ga0206352_11318320
246 Ga0206350_10262888
247 Ga0206350_10971910
248 Ga0206350_11255629
249 Ga0206350_11447607
250 Ga0206354_10196785
251 Ga0206353_10703029
252 Ga0206353_11508515
253 Ga0154015_1176574
254 Ga0154015_1310280
255 Ga0154015_1598239
256 Ga0224712_10007500
257 Ga0224712_10076834
258 Ga0224712_10113897
259 Ga0224712_10230721
260 Ga0224712_10559525
261 Ga0207692_10002357
262 Ga0207692_10286663
263 Ga0207705_10340695
264 Ga0207693_10113764
265 Ga0207663_10046115
266 Ga0207700_10059983
267 Ga0207667_11317877
268 Ga0316177_1052174
269 Ga0307408_100060350
270 Ga0307408_101161860
271 Ga0307405_10403268
272 Ga0307413_10370919
273 Ga0307410_10079979
274 Ga0307410_10293546
275 Ga0307410_11091726
276 Ga0307406_10117835
277 Ga0307412_10068408
278 Ga0307412_10708870
279 Ga0307412_11682966
280 Ga0307409_100048634
281 Ga0307409_101491741
282 Ga0307409_101905896
283 Ga0307409_102667479
284 Ga0307416_100057946
285 Ga0307416_100103130
286 Ga0307414_10116069
287 Ga0307411_10187695
288 Ga0307411_10724346
289 Ga0307415_100691849
290 Ga0373925_0271372
291 Ga0451791_1352151
292 Ga0451795_0697852
293 Ga0451807_2731002
294 Ga0451841_0315406
295 Ga0451841_0454688
296 Ga0451853_2385593
297 Ga0439449_0056574
298 Ga0439449_0061729
299 Ga0439449_0195100
300 Ga0466969_0013571
301 Ga0466969_0017607
302 Ga0466969_0030603
303 Ga0466969_0060842
304 Ga0466969_0146469
305 Ga0466972_0010851
306 Ga0466972_0019917
307 Ga0466972_0023737
308 Ga0466972_0041096
309 Ga0466972_0090907
310 Ga0466972_0152291
311 Ga0466965_0000699
312 Ga0466965_0012493
313 Ga0466965_0112160
314 Ga0466965_0440915
315 Ga0466966_0002351
316 Ga0466966_0006905
317 Ga0466966_0011096
318 Ga0466966_0026068
319 Ga0466966_0029659
320 Ga0466966_0042645
321 Ga0466966_0128692
322 Ga0466966_0284266
323 Ga0466966_0354575
324 Ga0466961_0003351
325 Ga0466961_0017252
326 Ga0466961_0019567
327 Ga0466961_0047821
328 Ga0466961_0075741
329 Ga0466961_0094114
330 Ga0466963_0000275
331 Ga0466963_0217745
332 Ga0466964_0004335
333 Ga0466971_0013308
334 Ga0466971_0046755
335 Ga0466971_0108684
336 Ga0466971_0200500
337 Ga0466971_0230585
338 Ga0466968_0146039
339 Ga0466970_0000487
340 Ga0466970_0006763
341 Ga0466970_0031425
342 Ga0466970_0102756
343 Ga0466970_0286464
344 Ga0466970_0437386
345 Ga0466970_0699091
346 Ga0466957_0000049
347 Ga0466957_0011426
348 Ga0466960_0009542
349 Ga0466960_0055358
350 Ga0466960_0118759
351 Ga0466960_0419340
352 Ga0466960_0481587
353 Ga0466960_0792815
354 Ga0466959_0000275
355 Ga0466959_0043794
356 Ga0466959_0047180
357 Ga0466959_0064718
358 Ga0466959_0145956
359 Ga0466959_0178382
360 Ga0466959_0443270
361 Ga0466958_0039325
362 Ga0466958_0240740
363 Ga0466958_0650218
364 Ga0466958_1114512
365 Ga0466967_0002998
366 Ga0466967_0067559
367 Ga0466967_2272179
368 Ga0496100_0207526
369 Ga0496101_0219508
370 Ga0496102_0750882
371 Ga0496104_0063178
372 Ga0496105_0010636
373 Ga0496110_0627699
374 Ga0496110_1478029
375 Ga0496114_0364437
376 Ga0496119_0534095
377 Ga0501033_0001395
378 Ga0501034_0005491
379 Ga0501034_0005585
380 Ga0501034_0100281
381 Ga0501036_0000708
382 Ga0501036_0004974
383 Ga0501036_0010792
384 Ga0501037_0007156
385 Ga0501037_0040608
386 Ga0501038_0046326
387 Ga0501038_0119451
388 Ga0501038_0127173
389 Ga0501038_0213736
390 Ga0501039_0005602
391 Ga0501039_0052421
392 Ga0501042_0022000
393 Ga0501042_0709412
394 Ga0501043_0001323
395 Ga0501043_0002101
396 Ga0501043_0102901
397 Ga0501046_0007593
398 Ga0501047_0000056
399 Ga0501047_0001121
400 Ga0501047_0072747
401 Ga0501047_0112377
402 Ga0501047_0577963
403 Ga0501068_0468382
404 Ga0501070_0002708
405 Ga0501070_0105199
406 Ga0501074_0005333
407 Ga0501074_0153382
408 Ga0501243_017037
409 Ga0501035_0004440
410 Ga0501044_0005645
411 Ga0501044_0099525
412 Ga0501044_0155776
413 Ga0501044_0195991
414 Ga0495655_0299204
415 Ga0466962_0001236
416 Ga0466962_0012708
417 Ga0466962_0165044
418 Ga0466962_0290212
419 2547408847
420 2554260526
421 2623498439
422 2753071204
423 2768643118
424 2791912477
425 2793982126
426 2810363141
427 2870721992
428 2905928810
429 2912723301
430 2912723567
431 2946006053
432 2947224657
433 3006498571
434 8047894375
435 8048364677
436 8048371392
437 8048380193
438 8053946001

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06150

ChaB

ChaB

26

80

0.98

PF07498

Rho_N

Rho termination factor, N-terminal domain

110

145

0.93

Map