F331387
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 219 | 106 | 438 | 133 |
Family's Representative Sequence
| Representative Sequence | 3300044683|Ga0466965_0007112|Ga0466965_0007112_3745_4197 |
| Length | 150 |
| Sequence | MAVMARGYPSAQVETLEEAMPGRQELPSTVARSPKKAQRTWIKAHDSAVETYGEGERAHRTAFSALKHSFEKVGDHWEPKKEKGPSDRQAERSTPAAGETAGGVDANASKQHLYDLAKRLKIEGRSRMTKAELVDAIGKANNRETARARS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 2 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 6 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 7 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 9 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 12 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 13 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 14 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 15 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 16 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 17 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 18 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 19 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 20 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 21 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 22 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 23 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 24 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 25 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 26 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 28 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 30 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 31 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 32 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 33 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 34 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 35 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 36 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 37 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 38 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 39 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 40 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 41 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 42 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 43 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 44 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 45 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 46 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 47 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 48 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 49 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 50 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 51 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 52 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 53 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 54 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 55 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 56 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 57 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 58 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 59 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 60 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 61 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 62 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 63 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 64 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 65 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 66 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 67 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 68 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 69 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 70 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 71 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 72 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 73 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 74 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 75 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 76 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 77 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 78 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 79 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 80 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 81 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 82 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 83 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 84 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 85 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 86 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 88 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 89 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 90 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 91 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 92 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 93 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 94 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 95 | 2808606700 | Arthrobacter agilis UMCV2 | Isolate | Rhizosphere |
| 96 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 97 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 98 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 99 | 2946003308 | Arthrobacter agilis W3I6 | Isolate | Rhizosphere |
| 100 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 101 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 102 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 103 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 104 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 105 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 106 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 77.63 |
| Metatranscriptomes | 13.24 |
| Isolates | 9.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.48 |
| Rhizosphere | 92.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466965_0007112 | 3300044683 | Bacteria | 5124 |
| 2 | Ga0007429J51699_1111723 | 3300003579 | Bacteria | 539 |
| 3 | Ga0070658_10281739 | 3300005327 | Bacteria | 1415 |
| 4 | Ga0070714_100102357 | 3300005435 | Bacteria | 2525 |
| 5 | Ga0070713_100374374 | 3300005436 | Bacteria | 1325 |
| 6 | Ga0070710_10000139 | 3300005437 | Bacteria | 33531 |
| 7 | Ga0070679_100022457 | 3300005530 | Bacteria | 6166 |
| 8 | Ga0068855_101542663 | 3300005563 | Bacteria | 681 |
| 9 | Ga0070717_10500447 | 3300006028 | Bacteria | 1098 |
| 10 | Ga0070712_100551474 | 3300006175 | Bacteria | 971 |
| 11 | Ga0114129_11428988 | 3300009147 | Bacteria | 853 |
| 12 | Ga0157370_10491355 | 3300013104 | Bacteria | 1128 |
| 13 | Ga0157370_11733248 | 3300013104 | Bacteria | 561 |
| 14 | Ga0197907_10163291 | 3300020069 | Bacteria | 932 |
| 15 | Ga0197907_10583190 | 3300020069 | Bacteria | 914 |
| 16 | Ga0197907_10658842 | 3300020069 | Bacteria | 2987 |
| 17 | Ga0197907_11148968 | 3300020069 | Bacteria | 1198 |
| 18 | Ga0206356_10777927 | 3300020070 | Bacteria | 738 |
| 19 | Ga0206356_11540117 | 3300020070 | Bacteria | 591 |
| 20 | Ga0206356_11868215 | 3300020070 | Bacteria | 780 |
| 21 | Ga0206349_1372461 | 3300020075 | Bacteria | 875 |
| 22 | Ga0206349_1702649 | 3300020075 | Bacteria | 2897 |
| 23 | Ga0206351_10284584 | 3300020077 | Bacteria | 1196 |
| 24 | Ga0206351_10428723 | 3300020077 | Bacteria | 890 |
| 25 | Ga0206352_10801394 | 3300020078 | Bacteria | 872 |
| 26 | Ga0206352_11318320 | 3300020078 | Bacteria | 590 |
| 27 | Ga0206350_10262888 | 3300020080 | Bacteria | 828 |
| 28 | Ga0206350_10971910 | 3300020080 | Bacteria | 2276 |
| 29 | Ga0206350_11255629 | 3300020080 | Bacteria | 912 |
| 30 | Ga0206350_11447607 | 3300020080 | Bacteria | 745 |
| 31 | Ga0206354_10196785 | 3300020081 | Bacteria | 958 |
| 32 | Ga0206353_10703029 | 3300020082 | Bacteria | 1565 |
| 33 | Ga0206353_11508515 | 3300020082 | Bacteria | 826 |
| 34 | Ga0154015_1176574 | 3300020610 | Bacteria | 927 |
| 35 | Ga0154015_1310280 | 3300020610 | Bacteria | 1276 |
| 36 | Ga0154015_1598239 | 3300020610 | Bacteria | 752 |
| 37 | Ga0224712_10007500 | 3300022467 | Bacteria | 3180 |
| 38 | Ga0224712_10076834 | 3300022467 | Bacteria | 1369 |
| 39 | Ga0224712_10113897 | 3300022467 | Bacteria | 1163 |
| 40 | Ga0224712_10230721 | 3300022467 | Bacteria | 850 |
| 41 | Ga0224712_10559525 | 3300022467 | Bacteria | 556 |
| 42 | Ga0207692_10002357 | 3300025898 | Bacteria | 7244 |
| 43 | Ga0207692_10286663 | 3300025898 | Bacteria | 998 |
| 44 | Ga0207705_10340695 | 3300025909 | Bacteria | 1154 |
| 45 | Ga0207693_10113764 | 3300025915 | Bacteria | 2123 |
| 46 | Ga0207663_10046115 | 3300025916 | Bacteria | 2684 |
| 47 | Ga0207700_10059983 | 3300025928 | Bacteria | 2879 |
| 48 | Ga0207667_11317877 | 3300025949 | Bacteria | 698 |
| 49 | Ga0316177_1052174 | 3300030731 | Bacteria | 972 |
| 50 | Ga0307408_100060350 | 3300031548 | Bacteria | 2764 |
| 51 | Ga0307408_101161860 | 3300031548 | Bacteria | 718 |
| 52 | Ga0307405_10403268 | 3300031731 | Bacteria | 1071 |
| 53 | Ga0307413_10370919 | 3300031824 | Bacteria | 1112 |
| 54 | Ga0307410_10079979 | 3300031852 | Bacteria | 2292 |
| 55 | Ga0307410_10293546 | 3300031852 | Bacteria | 1280 |
| 56 | Ga0307410_11091726 | 3300031852 | Bacteria | 691 |
| 57 | Ga0307406_10117835 | 3300031901 | Bacteria | 1840 |
| 58 | Ga0307412_10068408 | 3300031911 | Bacteria | 2415 |
| 59 | Ga0307412_10708870 | 3300031911 | Bacteria | 865 |
| 60 | Ga0307412_11682966 | 3300031911 | Bacteria | 581 |
| 61 | Ga0307409_100048634 | 3300031995 | Bacteria | 3229 |
| 62 | Ga0307409_101491741 | 3300031995 | Bacteria | 703 |
| 63 | Ga0307409_101905896 | 3300031995 | Bacteria | 624 |
| 64 | Ga0307409_102667479 | 3300031995 | Bacteria | 528 |
| 65 | Ga0307416_100057946 | 3300032002 | Bacteria | 3137 |
| 66 | Ga0307416_100103130 | 3300032002 | Bacteria | 2489 |
| 67 | Ga0307414_10116069 | 3300032004 | Bacteria | 2049 |
| 68 | Ga0307411_10187695 | 3300032005 | Bacteria | 1575 |
| 69 | Ga0307411_10724346 | 3300032005 | Bacteria | 869 |
| 70 | Ga0307415_100691849 | 3300032126 | Bacteria | 919 |
| 71 | Ga0373925_0271372 | 3300037068 | Bacteria | 1365 |
| 72 | Ga0451791_1352151 | 3300041451 | Bacteria | 1086 |
| 73 | Ga0451795_0697852 | 3300041456 | Bacteria | 1369 |
| 74 | Ga0451807_2731002 | 3300041486 | Bacteria | 616 |
| 75 | Ga0451841_0315406 | 3300041498 | Bacteria | 525 |
| 76 | Ga0451841_0454688 | 3300041498 | Bacteria | 556 |
| 77 | Ga0451853_2385593 | 3300041512 | Bacteria | 1039 |
| 78 | Ga0439449_0056574 | 3300042007 | Bacteria | 1448 |
| 79 | Ga0439449_0061729 | 3300042007 | Bacteria | 1383 |
| 80 | Ga0439449_0195100 | 3300042007 | Bacteria | 758 |
| 81 | Ga0466969_0013571 | 3300044656 | Bacteria | 4289 |
| 82 | Ga0466969_0017607 | 3300044656 | Bacteria | 3727 |
| 83 | Ga0466969_0030603 | 3300044656 | Bacteria | 2742 |
| 84 | Ga0466969_0060842 | 3300044656 | Bacteria | 1835 |
| 85 | Ga0466969_0146469 | 3300044656 | Bacteria | 1089 |
| 86 | Ga0466972_0010851 | 3300044658 | Bacteria | 4571 |
| 87 | Ga0466972_0019917 | 3300044658 | Bacteria | 3353 |
| 88 | Ga0466972_0023737 | 3300044658 | Bacteria | 3048 |
| 89 | Ga0466972_0041096 | 3300044658 | Bacteria | 2251 |
| 90 | Ga0466972_0090907 | 3300044658 | Bacteria | 1448 |
| 91 | Ga0466972_0152291 | 3300044658 | Bacteria | 1087 |
| 92 | Ga0466965_0000699 | 3300044683 | Bacteria | 12450 |
| 93 | Ga0466965_0012493 | 3300044683 | Bacteria | 3995 |
| 94 | Ga0466965_0112160 | 3300044683 | Bacteria | 1402 |
| 95 | Ga0466965_0440915 | 3300044683 | Bacteria | 724 |
| 96 | Ga0466966_0002351 | 3300044684 | Bacteria | 12346 |
| 97 | Ga0466966_0006905 | 3300044684 | Bacteria | 7521 |
| 98 | Ga0466966_0011096 | 3300044684 | Bacteria | 5982 |
| 99 | Ga0466966_0026068 | 3300044684 | Bacteria | 3817 |
| 100 | Ga0466966_0029659 | 3300044684 | Bacteria | 3557 |
| 101 | Ga0466966_0042645 | 3300044684 | Bacteria | 2911 |
| 102 | Ga0466966_0128692 | 3300044684 | Bacteria | 1551 |
| 103 | Ga0466966_0284266 | 3300044684 | Bacteria | 995 |
| 104 | Ga0466966_0354575 | 3300044684 | Bacteria | 881 |
| 105 | Ga0466961_0003351 | 3300044693 | Bacteria | 9998 |
| 106 | Ga0466961_0017252 | 3300044693 | Bacteria | 4637 |
| 107 | Ga0466961_0019567 | 3300044693 | Bacteria | 4355 |
| 108 | Ga0466961_0047821 | 3300044693 | Bacteria | 2735 |
| 109 | Ga0466961_0075741 | 3300044693 | Bacteria | 2133 |
| 110 | Ga0466961_0094114 | 3300044693 | Bacteria | 1891 |
| 111 | Ga0466963_0000275 | 3300044694 | Bacteria | 22896 |
| 112 | Ga0466963_0217745 | 3300044694 | Bacteria | 1337 |
| 113 | Ga0466964_0004335 | 3300044706 | Bacteria | 5227 |
| 114 | Ga0466971_0013308 | 3300044719 | Bacteria | 3612 |
| 115 | Ga0466971_0046755 | 3300044719 | Bacteria | 1945 |
| 116 | Ga0466971_0108684 | 3300044719 | Bacteria | 1278 |
| 117 | Ga0466971_0200500 | 3300044719 | Bacteria | 942 |
| 118 | Ga0466971_0230585 | 3300044719 | Bacteria | 879 |
| 119 | Ga0466968_0146039 | 3300044735 | Bacteria | 1085 |
| 120 | Ga0466970_0000487 | 3300044765 | Bacteria | 19510 |
| 121 | Ga0466970_0006763 | 3300044765 | Bacteria | 5740 |
| 122 | Ga0466970_0031425 | 3300044765 | Bacteria | 2804 |
| 123 | Ga0466970_0102756 | 3300044765 | Bacteria | 1557 |
| 124 | Ga0466970_0286464 | 3300044765 | Bacteria | 927 |
| 125 | Ga0466970_0437386 | 3300044765 | Bacteria | 749 |
| 126 | Ga0466970_0699091 | 3300044765 | Bacteria | 591 |
| 127 | Ga0466957_0000049 | 3300044842 | Bacteria | 44603 |
| 128 | Ga0466957_0011426 | 3300044842 | Bacteria | 5124 |
| 129 | Ga0466960_0009542 | 3300044901 | Bacteria | 4004 |
| 130 | Ga0466960_0055358 | 3300044901 | Bacteria | 1929 |
| 131 | Ga0466960_0118759 | 3300044901 | Bacteria | 1382 |
| 132 | Ga0466960_0419340 | 3300044901 | Bacteria | 774 |
| 133 | Ga0466960_0481587 | 3300044901 | Bacteria | 725 |
| 134 | Ga0466960_0792815 | 3300044901 | Bacteria | 573 |
| 135 | Ga0466959_0000275 | 3300045049 | Bacteria | 31466 |
| 136 | Ga0466959_0043794 | 3300045049 | Bacteria | 3298 |
| 137 | Ga0466959_0047180 | 3300045049 | Bacteria | 3169 |
| 138 | Ga0466959_0064718 | 3300045049 | Bacteria | 2654 |
| 139 | Ga0466959_0145956 | 3300045049 | Bacteria | 1669 |
| 140 | Ga0466959_0178382 | 3300045049 | Bacteria | 1487 |
| 141 | Ga0466959_0443270 | 3300045049 | Bacteria | 881 |
| 142 | Ga0466958_0039325 | 3300045836 | Bacteria | 2841 |
| 143 | Ga0466958_0240740 | 3300045836 | Bacteria | 1156 |
| 144 | Ga0466958_0650218 | 3300045836 | Bacteria | 686 |
| 145 | Ga0466958_1114512 | 3300045836 | Bacteria | 515 |
| 146 | Ga0466967_0002998 | 3300045976 | Bacteria | 10821 |
| 147 | Ga0466967_0067559 | 3300045976 | Bacteria | 3189 |
| 148 | Ga0466967_2272179 | 3300045976 | Bacteria | 538 |
| 149 | Ga0496100_0207526 | 3300048903 | Bacteria | 1431 |
| 150 | Ga0496101_0219508 | 3300048904 | Bacteria | 1475 |
| 151 | Ga0496102_0750882 | 3300048905 | Bacteria | 898 |
| 152 | Ga0496104_0063178 | 3300048907 | Bacteria | 3511 |
| 153 | Ga0496105_0010636 | 3300048908 | Bacteria | 7239 |
| 154 | Ga0496110_0627699 | 3300048913 | Bacteria | 973 |
| 155 | Ga0496110_1478029 | 3300048913 | Bacteria | 589 |
| 156 | Ga0496114_0364437 | 3300048917 | Bacteria | 1279 |
| 157 | Ga0496119_0534095 | 3300048922 | Bacteria | 541 |
| 158 | Ga0501033_0001395 | 3300049570 | Bacteria | 21458 |
| 159 | Ga0501034_0005491 | 3300049571 | Bacteria | 13838 |
| 160 | Ga0501034_0005585 | 3300049571 | Bacteria | 13698 |
| 161 | Ga0501034_0100281 | 3300049571 | Bacteria | 2890 |
| 162 | Ga0501036_0000708 | 3300049572 | Bacteria | 24642 |
| 163 | Ga0501036_0004974 | 3300049572 | Bacteria | 10746 |
| 164 | Ga0501036_0010792 | 3300049572 | Bacteria | 7549 |
| 165 | Ga0501037_0007156 | 3300049573 | Bacteria | 8156 |
| 166 | Ga0501037_0040608 | 3300049573 | Bacteria | 3424 |
| 167 | Ga0501038_0046326 | 3300049574 | Bacteria | 3770 |
| 168 | Ga0501038_0119451 | 3300049574 | Bacteria | 2176 |
| 169 | Ga0501038_0127173 | 3300049574 | Bacteria | 2096 |
| 170 | Ga0501038_0213736 | 3300049574 | Bacteria | 1541 |
| 171 | Ga0501039_0005602 | 3300049575 | Bacteria | 9505 |
| 172 | Ga0501039_0052421 | 3300049575 | Bacteria | 3157 |
| 173 | Ga0501042_0022000 | 3300049578 | Bacteria | 4451 |
| 174 | Ga0501042_0709412 | 3300049578 | Bacteria | 731 |
| 175 | Ga0501043_0001323 | 3300049579 | Bacteria | 21678 |
| 176 | Ga0501043_0002101 | 3300049579 | Bacteria | 17012 |
| 177 | Ga0501043_0102901 | 3300049579 | Bacteria | 2244 |
| 178 | Ga0501046_0007593 | 3300049580 | Bacteria | 9511 |
| 179 | Ga0501047_0000056 | 3300049581 | Bacteria | 143501 |
| 180 | Ga0501047_0001121 | 3300049581 | Bacteria | 26603 |
| 181 | Ga0501047_0072747 | 3300049581 | Bacteria | 3309 |
| 182 | Ga0501047_0112377 | 3300049581 | Bacteria | 2606 |
| 183 | Ga0501047_0577963 | 3300049581 | Bacteria | 947 |
| 184 | Ga0501068_0468382 | 3300049584 | Bacteria | 816 |
| 185 | Ga0501070_0002708 | 3300049586 | Bacteria | 15474 |
| 186 | Ga0501070_0105199 | 3300049586 | Bacteria | 2333 |
| 187 | Ga0501074_0005333 | 3300049590 | Bacteria | 9243 |
| 188 | Ga0501074_0153382 | 3300049590 | Bacteria | 1646 |
| 189 | Ga0501243_017037 | 3300049675 | Bacteria | 1177 |
| 190 | Ga0501035_0004440 | 3300049822 | Bacteria | 13308 |
| 191 | Ga0501044_0005645 | 3300049823 | Bacteria | 13894 |
| 192 | Ga0501044_0099525 | 3300049823 | Bacteria | 2926 |
| 193 | Ga0501044_0155776 | 3300049823 | Bacteria | 2264 |
| 194 | Ga0501044_0195991 | 3300049823 | Bacteria | 1980 |
| 195 | Ga0495655_0299204 | 3300053083 | Bacteria | 552 |
| 196 | Ga0466962_0001236 | 3300061719 | Bacteria | 11763 |
| 197 | Ga0466962_0012708 | 3300061719 | Bacteria | 4050 |
| 198 | Ga0466962_0165044 | 3300061719 | Bacteria | 1077 |
| 199 | Ga0466962_0290212 | 3300061719 | Bacteria | 808 |
| 200 | 2547408847 | 2547132111 | Bacteria | 8013147 |
| 201 | 2554260526 | 2554235005 | Bacteria | 6457341 |
| 202 | 2623498439 | 2622736605 | Bacteria | 4992138 |
| 203 | 2753071204 | 2751185734 | Bacteria | 8863695 |
| 204 | 2768643118 | 2767802112 | Bacteria | 6465194 |
| 205 | 2791912477 | 2791354901 | Bacteria | 8322202 |
| 206 | 2793982126 | 2791355406 | Bacteria | 11364898 |
| 207 | 2810363141 | 2808606700 | Bacteria | 3482157 |
| 208 | 2870721992 | 2870721527 | Bacteria | 9689237 |
| 209 | 2905928810 | 2905926851 | Bacteria | 4423176 |
| 210 | 2912723301 | 2912715099 | Bacteria | 9460473 |
| 211 | 2912723567 | 2912715099 | Bacteria | 9460473 |
| 212 | 2946006053 | 2946003308 | Bacteria | 3857229 |
| 213 | 2947224657 | 2947224130 | Bacteria | 9938529 |
| 214 | 3006498571 | 3006493962 | Bacteria | 8825450 |
| 215 | 8047894375 | 8047893842 | Bacteria | 11723082 |
| 216 | 8048364677 | 8048356638 | Bacteria | 11044339 |
| 217 | 8048371392 | 8048369669 | Bacteria | 11666822 |
| 218 | 8048380193 | 8048379754 | Bacteria | 11877923 |
| 219 | 8053946001 | 8053945823 | Bacteria | 8962862 |
| 220 | Ga0466965_0007112 | |||
| 221 | Ga0007429J51699_1111723 | |||
| 222 | Ga0070658_10281739 | |||
| 223 | Ga0070714_100102357 | |||
| 224 | Ga0070713_100374374 | |||
| 225 | Ga0070710_10000139 | |||
| 226 | Ga0070679_100022457 | |||
| 227 | Ga0068855_101542663 | |||
| 228 | Ga0070717_10500447 | |||
| 229 | Ga0070712_100551474 | |||
| 230 | Ga0114129_11428988 | |||
| 231 | Ga0157370_10491355 | |||
| 232 | Ga0157370_11733248 | |||
| 233 | Ga0197907_10163291 | |||
| 234 | Ga0197907_10583190 | |||
| 235 | Ga0197907_10658842 | |||
| 236 | Ga0197907_11148968 | |||
| 237 | Ga0206356_10777927 | |||
| 238 | Ga0206356_11540117 | |||
| 239 | Ga0206356_11868215 | |||
| 240 | Ga0206349_1372461 | |||
| 241 | Ga0206349_1702649 | |||
| 242 | Ga0206351_10284584 | |||
| 243 | Ga0206351_10428723 | |||
| 244 | Ga0206352_10801394 | |||
| 245 | Ga0206352_11318320 | |||
| 246 | Ga0206350_10262888 | |||
| 247 | Ga0206350_10971910 | |||
| 248 | Ga0206350_11255629 | |||
| 249 | Ga0206350_11447607 | |||
| 250 | Ga0206354_10196785 | |||
| 251 | Ga0206353_10703029 | |||
| 252 | Ga0206353_11508515 | |||
| 253 | Ga0154015_1176574 | |||
| 254 | Ga0154015_1310280 | |||
| 255 | Ga0154015_1598239 | |||
| 256 | Ga0224712_10007500 | |||
| 257 | Ga0224712_10076834 | |||
| 258 | Ga0224712_10113897 | |||
| 259 | Ga0224712_10230721 | |||
| 260 | Ga0224712_10559525 | |||
| 261 | Ga0207692_10002357 | |||
| 262 | Ga0207692_10286663 | |||
| 263 | Ga0207705_10340695 | |||
| 264 | Ga0207693_10113764 | |||
| 265 | Ga0207663_10046115 | |||
| 266 | Ga0207700_10059983 | |||
| 267 | Ga0207667_11317877 | |||
| 268 | Ga0316177_1052174 | |||
| 269 | Ga0307408_100060350 | |||
| 270 | Ga0307408_101161860 | |||
| 271 | Ga0307405_10403268 | |||
| 272 | Ga0307413_10370919 | |||
| 273 | Ga0307410_10079979 | |||
| 274 | Ga0307410_10293546 | |||
| 275 | Ga0307410_11091726 | |||
| 276 | Ga0307406_10117835 | |||
| 277 | Ga0307412_10068408 | |||
| 278 | Ga0307412_10708870 | |||
| 279 | Ga0307412_11682966 | |||
| 280 | Ga0307409_100048634 | |||
| 281 | Ga0307409_101491741 | |||
| 282 | Ga0307409_101905896 | |||
| 283 | Ga0307409_102667479 | |||
| 284 | Ga0307416_100057946 | |||
| 285 | Ga0307416_100103130 | |||
| 286 | Ga0307414_10116069 | |||
| 287 | Ga0307411_10187695 | |||
| 288 | Ga0307411_10724346 | |||
| 289 | Ga0307415_100691849 | |||
| 290 | Ga0373925_0271372 | |||
| 291 | Ga0451791_1352151 | |||
| 292 | Ga0451795_0697852 | |||
| 293 | Ga0451807_2731002 | |||
| 294 | Ga0451841_0315406 | |||
| 295 | Ga0451841_0454688 | |||
| 296 | Ga0451853_2385593 | |||
| 297 | Ga0439449_0056574 | |||
| 298 | Ga0439449_0061729 | |||
| 299 | Ga0439449_0195100 | |||
| 300 | Ga0466969_0013571 | |||
| 301 | Ga0466969_0017607 | |||
| 302 | Ga0466969_0030603 | |||
| 303 | Ga0466969_0060842 | |||
| 304 | Ga0466969_0146469 | |||
| 305 | Ga0466972_0010851 | |||
| 306 | Ga0466972_0019917 | |||
| 307 | Ga0466972_0023737 | |||
| 308 | Ga0466972_0041096 | |||
| 309 | Ga0466972_0090907 | |||
| 310 | Ga0466972_0152291 | |||
| 311 | Ga0466965_0000699 | |||
| 312 | Ga0466965_0012493 | |||
| 313 | Ga0466965_0112160 | |||
| 314 | Ga0466965_0440915 | |||
| 315 | Ga0466966_0002351 | |||
| 316 | Ga0466966_0006905 | |||
| 317 | Ga0466966_0011096 | |||
| 318 | Ga0466966_0026068 | |||
| 319 | Ga0466966_0029659 | |||
| 320 | Ga0466966_0042645 | |||
| 321 | Ga0466966_0128692 | |||
| 322 | Ga0466966_0284266 | |||
| 323 | Ga0466966_0354575 | |||
| 324 | Ga0466961_0003351 | |||
| 325 | Ga0466961_0017252 | |||
| 326 | Ga0466961_0019567 | |||
| 327 | Ga0466961_0047821 | |||
| 328 | Ga0466961_0075741 | |||
| 329 | Ga0466961_0094114 | |||
| 330 | Ga0466963_0000275 | |||
| 331 | Ga0466963_0217745 | |||
| 332 | Ga0466964_0004335 | |||
| 333 | Ga0466971_0013308 | |||
| 334 | Ga0466971_0046755 | |||
| 335 | Ga0466971_0108684 | |||
| 336 | Ga0466971_0200500 | |||
| 337 | Ga0466971_0230585 | |||
| 338 | Ga0466968_0146039 | |||
| 339 | Ga0466970_0000487 | |||
| 340 | Ga0466970_0006763 | |||
| 341 | Ga0466970_0031425 | |||
| 342 | Ga0466970_0102756 | |||
| 343 | Ga0466970_0286464 | |||
| 344 | Ga0466970_0437386 | |||
| 345 | Ga0466970_0699091 | |||
| 346 | Ga0466957_0000049 | |||
| 347 | Ga0466957_0011426 | |||
| 348 | Ga0466960_0009542 | |||
| 349 | Ga0466960_0055358 | |||
| 350 | Ga0466960_0118759 | |||
| 351 | Ga0466960_0419340 | |||
| 352 | Ga0466960_0481587 | |||
| 353 | Ga0466960_0792815 | |||
| 354 | Ga0466959_0000275 | |||
| 355 | Ga0466959_0043794 | |||
| 356 | Ga0466959_0047180 | |||
| 357 | Ga0466959_0064718 | |||
| 358 | Ga0466959_0145956 | |||
| 359 | Ga0466959_0178382 | |||
| 360 | Ga0466959_0443270 | |||
| 361 | Ga0466958_0039325 | |||
| 362 | Ga0466958_0240740 | |||
| 363 | Ga0466958_0650218 | |||
| 364 | Ga0466958_1114512 | |||
| 365 | Ga0466967_0002998 | |||
| 366 | Ga0466967_0067559 | |||
| 367 | Ga0466967_2272179 | |||
| 368 | Ga0496100_0207526 | |||
| 369 | Ga0496101_0219508 | |||
| 370 | Ga0496102_0750882 | |||
| 371 | Ga0496104_0063178 | |||
| 372 | Ga0496105_0010636 | |||
| 373 | Ga0496110_0627699 | |||
| 374 | Ga0496110_1478029 | |||
| 375 | Ga0496114_0364437 | |||
| 376 | Ga0496119_0534095 | |||
| 377 | Ga0501033_0001395 | |||
| 378 | Ga0501034_0005491 | |||
| 379 | Ga0501034_0005585 | |||
| 380 | Ga0501034_0100281 | |||
| 381 | Ga0501036_0000708 | |||
| 382 | Ga0501036_0004974 | |||
| 383 | Ga0501036_0010792 | |||
| 384 | Ga0501037_0007156 | |||
| 385 | Ga0501037_0040608 | |||
| 386 | Ga0501038_0046326 | |||
| 387 | Ga0501038_0119451 | |||
| 388 | Ga0501038_0127173 | |||
| 389 | Ga0501038_0213736 | |||
| 390 | Ga0501039_0005602 | |||
| 391 | Ga0501039_0052421 | |||
| 392 | Ga0501042_0022000 | |||
| 393 | Ga0501042_0709412 | |||
| 394 | Ga0501043_0001323 | |||
| 395 | Ga0501043_0002101 | |||
| 396 | Ga0501043_0102901 | |||
| 397 | Ga0501046_0007593 | |||
| 398 | Ga0501047_0000056 | |||
| 399 | Ga0501047_0001121 | |||
| 400 | Ga0501047_0072747 | |||
| 401 | Ga0501047_0112377 | |||
| 402 | Ga0501047_0577963 | |||
| 403 | Ga0501068_0468382 | |||
| 404 | Ga0501070_0002708 | |||
| 405 | Ga0501070_0105199 | |||
| 406 | Ga0501074_0005333 | |||
| 407 | Ga0501074_0153382 | |||
| 408 | Ga0501243_017037 | |||
| 409 | Ga0501035_0004440 | |||
| 410 | Ga0501044_0005645 | |||
| 411 | Ga0501044_0099525 | |||
| 412 | Ga0501044_0155776 | |||
| 413 | Ga0501044_0195991 | |||
| 414 | Ga0495655_0299204 | |||
| 415 | Ga0466962_0001236 | |||
| 416 | Ga0466962_0012708 | |||
| 417 | Ga0466962_0165044 | |||
| 418 | Ga0466962_0290212 | |||
| 419 | 2547408847 | |||
| 420 | 2554260526 | |||
| 421 | 2623498439 | |||
| 422 | 2753071204 | |||
| 423 | 2768643118 | |||
| 424 | 2791912477 | |||
| 425 | 2793982126 | |||
| 426 | 2810363141 | |||
| 427 | 2870721992 | |||
| 428 | 2905928810 | |||
| 429 | 2912723301 | |||
| 430 | 2912723567 | |||
| 431 | 2946006053 | |||
| 432 | 2947224657 | |||
| 433 | 3006498571 | |||
| 434 | 8047894375 | |||
| 435 | 8048364677 | |||
| 436 | 8048371392 | |||
| 437 | 8048380193 | |||
| 438 | 8053946001 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy