F331376

General Info

Members Datasets Scaffolds Average Seq Length
219 125 438 245

Family's Representative Sequence

Representative Sequence 3300042461|Ga0439460_0027935|Ga0439460_0027935_270_1109
Length 279
Sequence LFFARLSHSKDILEKRTNVQKTRSDPRSLIAICLAIGAFVSVSSAQSSLPDPVATFSILGFDPDTGEIGGAVQSRVFSVGNGVLWGEADVGVAATQAIVDVSYGPKALKLLASGMTPAAIVKAIWDSDPDPGYANQPWPKEGRQFAVMNTKGEYAAYTGPKATPWAGDKGGKFCTAQGNILAGEAVVTGMVDAFEKTTGHLSLRLMAALDAGQAAGGDKRGMQSANILVVGKGRGVWLNNDVVLRLQVDDSPEPLKELRRLVESWNQRREKGQQRPVGD

Samples

Sample ID Description Type Environment
1 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
72 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
73 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
80 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
81 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
82 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
83 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
84 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
85 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
86 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
87 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
88 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
89 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
90 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
91 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
92 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
93 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
103 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
104 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
105 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
106 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
107 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
108 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
109 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
110 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
111 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
112 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
113 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
114 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
115 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
116 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
117 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
118 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
119 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
120 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
121 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
122 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
123 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
124 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
125 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.28
Nodule 0
Rhizoplane 3.65
Rhizosphere 93.61
Stem 0
Stem Tuber 0
Unclassified 11.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439460_0027935 3300042461 Bacteria 1588
2 Ga0065712_10079092 3300005290 Bacteria 3261
3 Ga0065712_10138675 3300005290 Bacteria 1471
4 Ga0065712_10279852 3300005290 Bacteria 886
5 Ga0065715_10010295 3300005293 Bacteria 2568
6 Ga0065715_10114153 3300005293 Bacteria 2461
7 Ga0070683_100000107 3300005329 Bacteria 54632
8 Ga0070670_100004258 3300005331 Bacteria 11967
9 Ga0070670_100072397 3300005331 Bacteria 2959
10 Ga0070680_100025305 3300005336 Bacteria 4743
11 Ga0070682_100092907 3300005337 Bacteria 1977
12 Ga0070660_100031920 3300005339 Bacteria 3960
13 Ga0070689_100293660 3300005340 Bacteria 1351
14 Ga0070691_10067593 3300005341 Bacteria 1729
15 Ga0070691_10154379 3300005341 Bacteria 1179
16 Ga0070661_100257938 3300005344 Bacteria 1347
17 Ga0070669_100044122 3300005353 Bacteria 3249
18 Ga0070675_100221745 3300005354 Bacteria 1647
19 Ga0070675_100366667 3300005354 Unclassified 1280
20 Ga0070674_100089587 3300005356 Bacteria 2217
21 Ga0070663_100031200 3300005455 Bacteria 3661
22 Ga0070663_100034045 3300005455 Bacteria 3525
23 Ga0070678_100223053 3300005456 Bacteria 1567
24 Ga0070678_100336961 3300005456 Bacteria 1293
25 Ga0070662_100234221 3300005457 Bacteria 1470
26 Ga0070699_100256392 3300005518 Bacteria 1564
27 Ga0070679_100043696 3300005530 Bacteria 4462
28 Ga0070679_100211498 3300005530 Bacteria 1903
29 Ga0070684_100000837 3300005535 Bacteria 21638
30 Ga0070686_100059119 3300005544 Bacteria 2468
31 Ga0070686_100141684 3300005544 Bacteria 1674
32 Ga0070686_100180584 3300005544 Bacteria 1499
33 Ga0070686_100226573 3300005544 Unclassified 1353
34 Ga0070695_100171797 3300005545 Bacteria 1530
35 Ga0070693_100104849 3300005547 Bacteria 1729
36 Ga0070693_100429400 3300005547 Unclassified 922
37 Ga0068855_100147483 3300005563 Bacteria 2677
38 Ga0070664_100000303 3300005564 Bacteria 35797
39 Ga0068854_100019177 3300005578 Bacteria 4605
40 Ga0068852_100943556 3300005616 Unclassified 881
41 Ga0068859_100164240 3300005617 Bacteria 2299
42 Ga0068864_100355842 3300005618 Bacteria 1383
43 Ga0068858_100225151 3300005842 Bacteria 1777
44 Ga0081455_10011230 3300005937 Bacteria 9011
45 Ga0075368_10029899 3300006042 Unclassified 2108
46 Ga0075367_10009182 3300006178 Bacteria 5157
47 Ga0075367_10169886 3300006178 Bacteria 1358
48 Ga0075366_10047158 3300006195 Bacteria 2554
49 Ga0075428_100000995 3300006844 Bacteria 29993
50 Ga0075428_100081478 3300006844 Bacteria 3532
51 Ga0075428_100751162 3300006844 Unclassified 1038
52 Ga0075430_100003168 3300006846 Bacteria 13771
53 Ga0075430_100041557 3300006846 Bacteria 3890
54 Ga0075430_100046626 3300006846 Bacteria 3660
55 Ga0075430_100266239 3300006846 Bacteria 1419
56 Ga0075430_100416432 3300006846 Unclassified 1109
57 Ga0075431_100011342 3300006847 Bacteria 8979
58 Ga0075431_100015000 3300006847 Bacteria 7844
59 Ga0075431_100339514 3300006847 Bacteria 1512
60 Ga0075433_10011530 3300006852 Bacteria 7119
61 Ga0075433_10392258 3300006852 Bacteria 1225
62 Ga0075429_100001657 3300006880 Bacteria 18416
63 Ga0075429_100034584 3300006880 Bacteria 4392
64 Ga0097620_100164245 3300006931 Bacteria 2299
65 Ga0105240_10988273 3300009093 Unclassified 901
66 Ga0111539_10000201 3300009094 Bacteria 70327
67 Ga0114129_10000751 3300009147 Bacteria 41232
68 Ga0114129_10001134 3300009147 Bacteria 35181
69 Ga0114129_10005506 3300009147 Bacteria 17904
70 Ga0114129_10042024 3300009147 Bacteria 6437
71 Ga0114129_10049576 3300009147 Bacteria 5899
72 Ga0114129_10267692 3300009147 Bacteria 2287
73 Ga0105241_10405736 3300009174 Unclassified 1196
74 Ga0105238_10042354 3300009551 Bacteria 4611
75 Ga0157380_10220393 3300014326 Bacteria 1697
76 Ga0157380_10943258 3300014326 Bacteria 892
77 Ga0157379_10549638 3300014968 Bacteria 1074
78 Ga0207645_10002511 3300025907 Bacteria 14376
79 Ga0207654_10242769 3300025911 Unclassified 1204
80 Ga0207660_10018058 3300025917 Bacteria 4697
81 Ga0207657_10033381 3300025919 Bacteria 4640
82 Ga0207652_10109645 3300025921 Unclassified 2447
83 Ga0207652_10373185 3300025921 Bacteria 1288
84 Ga0207681_10044270 3300025923 Bacteria 2983
85 Ga0207650_10032641 3300025925 Bacteria 3766
86 Ga0207650_10047525 3300025925 Bacteria 3162
87 Ga0207659_10250995 3300025926 Bacteria 1436
88 Ga0207706_10134816 3300025933 Bacteria 2172
89 Ga0207669_10019982 3300025937 Bacteria 3501
90 Ga0207691_10077693 3300025940 Bacteria 2990
91 Ga0207661_10001959 3300025944 Bacteria 14163
92 Ga0207679_10077234 3300025945 Bacteria 2532
93 Ga0207667_10026280 3300025949 Bacteria 6362
94 Ga0207640_10263224 3300025981 Bacteria 1345
95 Ga0207703_10193694 3300026035 Unclassified 1802
96 Ga0207703_10246922 3300026035 Bacteria 1607
97 Ga0207678_10059392 3300026067 Bacteria 3290
98 Ga0207678_10085288 3300026067 Unclassified 2700
99 Ga0207708_10033150 3300026075 Bacteria 3923
100 Ga0207676_10309131 3300026095 Bacteria 1446
101 Ga0207683_10238419 3300026121 Bacteria 1659
102 Ga0207698_10353030 3300026142 Bacteria 1390
103 Ga0207428_10000445 3300027907 Bacteria 50527
104 Ga0307408_100050328 3300031548 Bacteria 2996
105 Ga0307408_100074593 3300031548 Bacteria 2518
106 Ga0307408_100803810 3300031548 Bacteria 854
107 Ga0307405_10008956 3300031731 Bacteria 5109
108 Ga0307407_10054072 3300031903 Bacteria 2313
109 Ga0307412_10023531 3300031911 Bacteria 3792
110 Ga0307409_100052878 3300031995 Bacteria 3117
111 Ga0307416_100084604 3300032002 Unclassified 2696
112 Ga0307416_100121479 3300032002 Bacteria 2329
113 Ga0307416_100145047 3300032002 Unclassified 2166
114 Ga0307414_10022760 3300032004 Bacteria 3960
115 Ga0307411_10280991 3300032005 Bacteria 1325
116 Ga0307411_10407437 3300032005 Bacteria 1126
117 Ga0307415_100011076 3300032126 Bacteria 5141
118 Ga0451853_1297657 3300041512 Bacteria 1024
119 Ga0439431_0028508 3300041997 Bacteria 1375
120 Ga0439462_0030859 3300042015 Bacteria 1418
121 Ga0450923_021764 3300042125 Bacteria 1252
122 Ga0439446_0010832 3300042156 Bacteria 2463
123 Ga0439446_0066020 3300042156 Bacteria 1100
124 Ga0439435_0107896 3300042436 Bacteria 861
125 Ga0439460_0033414 3300042461 Bacteria 1477
126 Ga0495663_0057315 3300046525 Bacteria 1219
127 Ga0496104_0001482 3300048907 Bacteria 20248
128 Ga0496105_0014831 3300048908 Bacteria 6204
129 Ga0496108_0000282 3300048911 Bacteria 43586
130 Ga0496109_0001192 3300048912 Bacteria 21610
131 Ga0496110_0011781 3300048913 Bacteria 7177
132 Ga0496111_0000460 3300048914 Bacteria 20673
133 Ga0496112_0001067 3300048915 Bacteria 20244
134 Ga0496112_0103169 3300048915 Bacteria 2821
135 Ga0501033_0134472 3300049570 Bacteria 1790
136 Ga0501036_0025048 3300049572 Bacteria 5032
137 Ga0501036_0253222 3300049572 Bacteria 1475
138 Ga0501036_0763282 3300049572 Unclassified 797
139 Ga0501037_0290921 3300049573 Bacteria 1136
140 Ga0501037_0407361 3300049573 Bacteria 932
141 Ga0501038_0152973 3300049574 Bacteria 1880
142 Ga0501039_0055350 3300049575 Bacteria 3072
143 Ga0501039_0237814 3300049575 Bacteria 1432
144 Ga0501039_0453108 3300049575 Bacteria 1008
145 Ga0501039_0549679 3300049575 Bacteria 906
146 Ga0501040_0024499 3300049576 Bacteria 4050
147 Ga0501041_0031967 3300049577 Archaea 3181
148 Ga0501041_0046884 3300049577 Bacteria 2630
149 Ga0501042_0030077 3300049578 Bacteria 3835
150 Ga0501042_0104526 3300049578 Bacteria 2038
151 Ga0501048_0048137 3300049582 Bacteria 3041
152 Ga0501048_0171517 3300049582 Bacteria 1537
153 Ga0501048_0483552 3300049582 Bacteria 887
154 Ga0501069_0045386 3300049585 Bacteria 2435
155 Ga0501071_0130810 3300049587 Unclassified 1864
156 Ga0501071_0421340 3300049587 Bacteria 1020
157 Ga0501071_0563747 3300049587 Bacteria 875
158 Ga0501072_0033263 3300049588 Bacteria 4040
159 Ga0501072_0063244 3300049588 Bacteria 2919
160 Ga0501072_0110008 3300049588 Bacteria 2193
161 Ga0501072_0283957 3300049588 Bacteria 1316
162 Ga0501075_0035134 3300049591 Bacteria 3737
163 Ga0501075_0047328 3300049591 Bacteria 3232
164 Ga0501076_0012394 3300049592 Bacteria 6372
165 Ga0501076_0027925 3300049592 Bacteria 4378
166 Ga0501076_0028612 3300049592 Bacteria 4328
167 Ga0501076_0034454 3300049592 Bacteria 3958
168 Ga0501076_0076614 3300049592 Bacteria 2682
169 Ga0501077_0043242 3300049593 Bacteria 2864
170 Ga0501233_057756 3300049668 Unclassified 956
171 Ga0501079_0014933 3300049741 Bacteria 5920
172 Ga0501079_0029509 3300049741 Bacteria 4211
173 Ga0501079_0235877 3300049741 Bacteria 1429
174 Ga0501079_0288744 3300049741 Unclassified 1283
175 Ga0501080_0091833 3300049742 Bacteria 2820
176 Ga0501080_0155016 3300049742 Bacteria 2116
177 Ga0501080_0352816 3300049742 Unclassified 1328
178 Ga0501081_0035790 3300049743 Archaea 3381
179 Ga0501081_0093201 3300049743 Bacteria 2120
180 Ga0501081_0231170 3300049743 Bacteria 1347
181 Ga0501045_0029642 3300049824 Bacteria 3956
182 Ga0501045_0114959 3300049824 Bacteria 1996
183 Ga0501045_0125322 3300049824 Unclassified 1908
184 Ga0501045_0162370 3300049824 Bacteria 1663
185 Ga0501045_0463659 3300049824 Unclassified 941
186 nmdc:mga06z11_13269_c1 3300050494 Bacteria 3612
187 nmdc:mga05p37_1089_c2 3300050507 Bacteria 22817
188 nmdc:mga05p37_13248_c1 3300050507 Bacteria 9872
189 nmdc:mga05p37_219984_c1 3300050507 Bacteria 2292
190 nmdc:mga05p37_227809_c1 3300050507 Bacteria 2247
191 nmdc:mga05p37_249398_c1 3300050507 Bacteria 2130
192 nmdc:mga05p37_638_c1 3300050507 Bacteria 38795
193 nmdc:mga05p37_7289_c1 3300050507 Bacteria 13048
194 nmdc:mga09592_2104_c1 3300050508 Bacteria 16079
195 nmdc:mga09592_617812_c1 3300050508 Unclassified 927
196 nmdc:mga0qj67_1418_c1 3300050509 Bacteria 16781
197 nmdc:mga0qj67_200359_c1 3300050509 Bacteria 1622
198 nmdc:mga0qj67_36301_c1 3300050509 Bacteria 3856
199 nmdc:mga06r32_289361_c1 3300050510 Bacteria 1625
200 nmdc:mga06r32_7742_c1 3300050510 Bacteria 9661
201 nmdc:mga06r32_95702_c1 3300050510 Bacteria 2907
202 nmdc:mga08y16_4743_c1 3300050511 Bacteria 14177
203 nmdc:mga08y16_734789_c1 3300050511 Bacteria 984
204 nmdc:mga0a205_272080_c1 3300050515 Bacteria 1571
205 nmdc:mga0a205_73367_c1 3300050515 Bacteria 1199
206 nmdc:mga0a205_7790_c1 3300050515 Bacteria 9724
207 Ga0501084_0126546 3300054114 Bacteria 2150
208 Ga0501084_0189555 3300054114 Unclassified 1735
209 Ga0590074_004954 3300059423 Bacteria 2200
210 Ga0590075_000167 3300059424 Bacteria 18069
211 Ga0590077_002354 3300059426 Bacteria 4068
212 Ga0501082_0114282 3300060353 Bacteria 2338
213 Ga0501082_0220553 3300060353 Unclassified 1650
214 Ga0501082_0282604 3300060353 Bacteria 1444
215 Ga0501082_0320376 3300060353 Bacteria 1351
216 Ga0501082_0747564 3300060353 Bacteria 856
217 Ga0530510_0020921 3300061734 Bacteria 4653
218 Ga0530510_0021950 3300061734 Bacteria 4544
219 Ga0530510_0302852 3300061734 Unclassified 1196
220 Ga0439460_0027935
221 Ga0065712_10079092
222 Ga0065712_10138675
223 Ga0065712_10279852
224 Ga0065715_10010295
225 Ga0065715_10114153
226 Ga0070683_100000107
227 Ga0070670_100004258
228 Ga0070670_100072397
229 Ga0070680_100025305
230 Ga0070682_100092907
231 Ga0070660_100031920
232 Ga0070689_100293660
233 Ga0070691_10067593
234 Ga0070691_10154379
235 Ga0070661_100257938
236 Ga0070669_100044122
237 Ga0070675_100221745
238 Ga0070675_100366667
239 Ga0070674_100089587
240 Ga0070663_100031200
241 Ga0070663_100034045
242 Ga0070678_100223053
243 Ga0070678_100336961
244 Ga0070662_100234221
245 Ga0070699_100256392
246 Ga0070679_100043696
247 Ga0070679_100211498
248 Ga0070684_100000837
249 Ga0070686_100059119
250 Ga0070686_100141684
251 Ga0070686_100180584
252 Ga0070686_100226573
253 Ga0070695_100171797
254 Ga0070693_100104849
255 Ga0070693_100429400
256 Ga0068855_100147483
257 Ga0070664_100000303
258 Ga0068854_100019177
259 Ga0068852_100943556
260 Ga0068859_100164240
261 Ga0068864_100355842
262 Ga0068858_100225151
263 Ga0081455_10011230
264 Ga0075368_10029899
265 Ga0075367_10009182
266 Ga0075367_10169886
267 Ga0075366_10047158
268 Ga0075428_100000995
269 Ga0075428_100081478
270 Ga0075428_100751162
271 Ga0075430_100003168
272 Ga0075430_100041557
273 Ga0075430_100046626
274 Ga0075430_100266239
275 Ga0075430_100416432
276 Ga0075431_100011342
277 Ga0075431_100015000
278 Ga0075431_100339514
279 Ga0075433_10011530
280 Ga0075433_10392258
281 Ga0075429_100001657
282 Ga0075429_100034584
283 Ga0097620_100164245
284 Ga0105240_10988273
285 Ga0111539_10000201
286 Ga0114129_10000751
287 Ga0114129_10001134
288 Ga0114129_10005506
289 Ga0114129_10042024
290 Ga0114129_10049576
291 Ga0114129_10267692
292 Ga0105241_10405736
293 Ga0105238_10042354
294 Ga0157380_10220393
295 Ga0157380_10943258
296 Ga0157379_10549638
297 Ga0207645_10002511
298 Ga0207654_10242769
299 Ga0207660_10018058
300 Ga0207657_10033381
301 Ga0207652_10109645
302 Ga0207652_10373185
303 Ga0207681_10044270
304 Ga0207650_10032641
305 Ga0207650_10047525
306 Ga0207659_10250995
307 Ga0207706_10134816
308 Ga0207669_10019982
309 Ga0207691_10077693
310 Ga0207661_10001959
311 Ga0207679_10077234
312 Ga0207667_10026280
313 Ga0207640_10263224
314 Ga0207703_10193694
315 Ga0207703_10246922
316 Ga0207678_10059392
317 Ga0207678_10085288
318 Ga0207708_10033150
319 Ga0207676_10309131
320 Ga0207683_10238419
321 Ga0207698_10353030
322 Ga0207428_10000445
323 Ga0307408_100050328
324 Ga0307408_100074593
325 Ga0307408_100803810
326 Ga0307405_10008956
327 Ga0307407_10054072
328 Ga0307412_10023531
329 Ga0307409_100052878
330 Ga0307416_100084604
331 Ga0307416_100121479
332 Ga0307416_100145047
333 Ga0307414_10022760
334 Ga0307411_10280991
335 Ga0307411_10407437
336 Ga0307415_100011076
337 Ga0451853_1297657
338 Ga0439431_0028508
339 Ga0439462_0030859
340 Ga0450923_021764
341 Ga0439446_0010832
342 Ga0439446_0066020
343 Ga0439435_0107896
344 Ga0439460_0033414
345 Ga0495663_0057315
346 Ga0496104_0001482
347 Ga0496105_0014831
348 Ga0496108_0000282
349 Ga0496109_0001192
350 Ga0496110_0011781
351 Ga0496111_0000460
352 Ga0496112_0001067
353 Ga0496112_0103169
354 Ga0501033_0134472
355 Ga0501036_0025048
356 Ga0501036_0253222
357 Ga0501036_0763282
358 Ga0501037_0290921
359 Ga0501037_0407361
360 Ga0501038_0152973
361 Ga0501039_0055350
362 Ga0501039_0237814
363 Ga0501039_0453108
364 Ga0501039_0549679
365 Ga0501040_0024499
366 Ga0501041_0031967
367 Ga0501041_0046884
368 Ga0501042_0030077
369 Ga0501042_0104526
370 Ga0501048_0048137
371 Ga0501048_0171517
372 Ga0501048_0483552
373 Ga0501069_0045386
374 Ga0501071_0130810
375 Ga0501071_0421340
376 Ga0501071_0563747
377 Ga0501072_0033263
378 Ga0501072_0063244
379 Ga0501072_0110008
380 Ga0501072_0283957
381 Ga0501075_0035134
382 Ga0501075_0047328
383 Ga0501076_0012394
384 Ga0501076_0027925
385 Ga0501076_0028612
386 Ga0501076_0034454
387 Ga0501076_0076614
388 Ga0501077_0043242
389 Ga0501233_057756
390 Ga0501079_0014933
391 Ga0501079_0029509
392 Ga0501079_0235877
393 Ga0501079_0288744
394 Ga0501080_0091833
395 Ga0501080_0155016
396 Ga0501080_0352816
397 Ga0501081_0035790
398 Ga0501081_0093201
399 Ga0501081_0231170
400 Ga0501045_0029642
401 Ga0501045_0114959
402 Ga0501045_0125322
403 Ga0501045_0162370
404 Ga0501045_0463659
405 nmdc:mga06z11_13269_c1
406 nmdc:mga05p37_1089_c2
407 nmdc:mga05p37_13248_c1
408 nmdc:mga05p37_219984_c1
409 nmdc:mga05p37_227809_c1
410 nmdc:mga05p37_249398_c1
411 nmdc:mga05p37_638_c1
412 nmdc:mga05p37_7289_c1
413 nmdc:mga09592_2104_c1
414 nmdc:mga09592_617812_c1
415 nmdc:mga0qj67_1418_c1
416 nmdc:mga0qj67_200359_c1
417 nmdc:mga0qj67_36301_c1
418 nmdc:mga06r32_289361_c1
419 nmdc:mga06r32_7742_c1
420 nmdc:mga06r32_95702_c1
421 nmdc:mga08y16_4743_c1
422 nmdc:mga08y16_734789_c1
423 nmdc:mga0a205_272080_c1
424 nmdc:mga0a205_73367_c1
425 nmdc:mga0a205_7790_c1
426 Ga0501084_0126546
427 Ga0501084_0189555
428 Ga0590074_004954
429 Ga0590075_000167
430 Ga0590077_002354
431 Ga0501082_0114282
432 Ga0501082_0220553
433 Ga0501082_0282604
434 Ga0501082_0320376
435 Ga0501082_0747564
436 Ga0530510_0020921
437 Ga0530510_0021950
438 Ga0530510_0302852

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06267

DUF1028

Family of unknown function (DUF1028)

55

258

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2imh-assembly3.cif.gz_A crystal structure of protein spo2555 from silicibacter pomeroyi, pfam duf1028 0.8016 29 211
2imh-assembly3.cif.gz_B crystal structure of protein spo2555 from silicibacter pomeroyi, pfam duf1028 0.8003 29 211
2imh-assembly3.cif.gz_B crystal structure of protein spo2555 from silicibacter pomeroyi, pfam duf1028 0.6813 29 211
2imh-assembly3.cif.gz_A crystal structure of protein spo2555 from silicibacter pomeroyi, pfam duf1028 0.6735 29 211
2gez-assembly2.cif.gz_H crystal structure of potassium-independent plant asparaginase 0.6266 32 155
ID Description Score Start End Superfamily
af_Q9VN97_12_123_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.7851 158 185 1.10.10.1740
2imhB01 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.7702 29 211 3.60.20.10
2imhB01 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.6855 29 211 3.60.20.10
af_Q3U2C5_34_188_3.50.30.30 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1; 0.6278 28 48 3.50.30.30
af_B8A6H5_37_186_3.50.30.30 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1; 0.6115 28 48 3.50.30.30
ID Description Score Start End GO Terms
AF-A0A7X6ARY6-F1-model_v4 DUF1028 domain-containing protein 0.9329 84 145
AF-A0A2S8BM97-F1-model_v4 Glycogen synthase (EC 2.4.1.11) 0.9215 30 185 GO:0004373
AF-A0A656GVX6-F1-model_v4 deleted 0.921 30 184
AF-A0A6V8CZ86-F1-model_v4 DUF1028 domain-containing protein 0.916 30 184
AF-A0A151BK25-F1-model_v4 DUF1028 domain-containing protein 0.9156 34 182

Map