F331326

General Info

Members Datasets Scaffolds Average Seq Length
219 148 438 387

Family's Representative Sequence

Representative Sequence 3300038725|Ga0400484_38334|Ga0400484_38334_3201_4583
Length 439
Sequence LKSYIIQRTINFLEVLMGYVVFLLNLTTIGIKFKPCVAMQTRISDQILTTEAGRKAESILRNCVHCGFCTATCPTYQLLSDELDSPRGRIYQIKQLLEGAEPSSGVEYGRLLEIGRHHMASQYQRPLRERVQRWLLRKVIPNSRYFSTLLRLGQTFKPLLPQKIGRTIPSKNNPSSAIWPSRDHSRKMLILDGCVQPSLAPSINLTTAQVLDRLGISLIPTPSAGCCGAVTHHLDDEDGARATARRNIDCWWPHLQAGAEALIVTASGCAQMIKDYGHLLADDPEYAEPARQLAAHTRDIAEIIHSEELEPLKQTTNNQTRIAFHSSCTLQHGQGLAGCVEAILERLGYRLTWVQDAHLCCGSAGTYSLLQPRLADELGRRKSRSLQAGEPDVIATANIGCQIHLQKHSTLPVIHWIELLNSDKLTQANSGEFDPKKIE

Samples

Sample ID Description Type Environment
1 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
5 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
6 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
7 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
8 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
12 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
13 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
14 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
15 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
16 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
17 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
18 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
19 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
20 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
21 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
22 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
23 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
24 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
25 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
26 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
27 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
29 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
30 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
31 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
32 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
34 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
38 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
39 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
40 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
41 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
42 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
43 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
44 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
45 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
46 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
47 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
48 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
49 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
50 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
51 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
52 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
53 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
54 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
55 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
56 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
57 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
58 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
59 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
60 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
61 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
62 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
63 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
64 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
65 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
66 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
67 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
68 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
69 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
70 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
71 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
72 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
73 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
74 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
75 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
76 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
77 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
78 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
79 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
80 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
81 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
82 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
83 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
84 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
85 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
86 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
87 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
88 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
89 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
90 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
91 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
92 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
93 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
94 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
95 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
96 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
97 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
98 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
99 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
100 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
101 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
102 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
103 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
104 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
105 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
106 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
107 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
108 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
109 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
110 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
111 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
112 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
113 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
114 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
115 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
116 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
117 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
118 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
119 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
120 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
121 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
122 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
123 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
124 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
125 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
126 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
127 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
131 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
132 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
133 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
134 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
135 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
136 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
137 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
138 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
139 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
140 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
141 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
142 2818991436 Collimonas arenae 515 Isolate Unclassified
143 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
144 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
145 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
146 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
147 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
148 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.98
Metatranscriptomes 0
Isolates 5.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.59
Nodule 0.91
Rhizoplane 2.28
Rhizosphere 72.15
Stem 0
Stem Tuber 0
Unclassified 0.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400484_38334 3300038725 Bacteria 11280
2 JGI25162J39368_1000032 3300002737 Bacteria 195871
3 JGI25165J46597_1000067 3300003214 Bacteria 196411
4 Ga0055538_1000033 3300003751 Bacteria 195914
5 Ga0055539_1000045 3300003752 Bacteria 195316
6 Ga0055533_1000054 3300003756 Bacteria 195914
7 Ga0055525_1000065 3300003759 Bacteria 195779
8 Ga0055541_1000031 3300003841 Bacteria 195914
9 Ga0070683_100091048 3300005329 Bacteria 2864
10 Ga0070670_100146777 3300005331 Bacteria 2041
11 Ga0068864_100109834 3300005618 Bacteria 2455
12 Ga0068863_100012486 3300005841 Bacteria 8200
13 Ga0068862_100057036 3300005844 Bacteria 3348
14 Ga0075366_10001381 3300006195 Bacteria 12153
15 Ga0075436_100005660 3300006914 Bacteria 8578
16 Ga0111539_10034812 3300009094 Bacteria 6102
17 Ga0157371_10000311 3300013102 Bacteria 63402
18 Ga0157378_10107171 3300013297 Bacteria 2557
19 Ga0182008_10037628 3300014497 Bacteria 2421
20 Ga0182006_1008910 3300015261 Bacteria 4525
21 Ga0182007_10003695 3300015262 Bacteria 7155
22 Ga0182007_10023628 3300015262 Bacteria 2160
23 Ga0182005_1000118 3300015265 Bacteria 57357
24 Ga0163161_10022747 3300017792 Bacteria 4415
25 Ga0213872_10001027 3300021361 Bacteria 19464
26 Ga0213872_10017662 3300021361 Bacteria 3294
27 Ga0209760_101180 3300025207 Bacteria 2936
28 Ga0209784_100048 3300025224 Bacteria 198885
29 Ga0209566_100060 3300025225 Bacteria 198885
30 Ga0209674_100082 3300025226 Bacteria 198885
31 Ga0209563_100082 3300025230 Bacteria 198750
32 Ga0207427_100352 3300025231 Bacteria 29344
33 Ga0209437_100125 3300025233 Bacteria 198146
34 Ga0209677_100046 3300025253 Bacteria 198287
35 Ga0209233_1000138 3300025261 Bacteria 198287
36 Ga0207641_10106599 3300026088 Bacteria 2477
37 Ga0207676_10193591 3300026095 Bacteria 1791
38 Ga0268265_10027523 3300028380 Bacteria 4059
39 Ga0307408_100009775 3300031548 Bacteria 6324
40 Ga0316575_10003125 3300031665 Bacteria 5657
41 Ga0316575_10003500 3300031665 Bacteria 5423
42 Ga0316579_10000513 3300031691 Bacteria 12668
43 Ga0316576_10042903 3300031727 Bacteria 3261
44 Ga0316576_10227726 3300031727 Bacteria 1402
45 Ga0316578_10013582 3300031728 Bacteria 4324
46 Ga0307405_10010395 3300031731 Bacteria 4819
47 Ga0316577_10039567 3300031733 Bacteria 2638
48 Ga0316577_10066172 3300031733 Bacteria 2018
49 Ga0316577_10071831 3300031733 Bacteria 1931
50 Ga0307413_10013134 3300031824 Bacteria 4148
51 Ga0307410_10002961 3300031852 Bacteria 8378
52 Ga0307410_10029690 3300031852 Bacteria 3485
53 Ga0307406_10008898 3300031901 Bacteria 5611
54 Ga0307407_10004421 3300031903 Bacteria 5968
55 Ga0307409_100010819 3300031995 Bacteria 5705
56 Ga0307416_100003656 3300032002 Bacteria 9093
57 Ga0307414_10004917 3300032004 Bacteria 7307
58 Ga0307411_10010125 3300032005 Bacteria 5006
59 Ga0307415_100017918 3300032126 Bacteria 4260
60 Ga0316574_0001833 3300035398 Bacteria 10353
61 Ga0316574_0002312 3300035398 Bacteria 9502
62 Ga0316574_0003351 3300035398 Bacteria 8248
63 Ga0316574_0024165 3300035398 Bacteria 3635
64 Ga0316574_0080214 3300035398 Bacteria 2071
65 Ga0316582_0003024 3300036647 Bacteria 8112
66 Ga0316582_0014684 3300036647 Bacteria 4454
67 Ga0316582_0026730 3300036647 Bacteria 3477
68 Ga0316582_0118872 3300036647 Bacteria 1767
69 Ga0316584_0000050 3300036712 Bacteria 43702
70 Ga0316584_0006351 3300036712 Bacteria 8004
71 Ga0316584_0050255 3300036712 Bacteria 3117
72 Ga0316584_0071143 3300036712 Bacteria 2607
73 Ga0395899_0000085 3300037312 Bacteria 159118
74 Ga0395899_0001814 3300037312 Bacteria 17678
75 Ga0395899_0003151 3300037312 Bacteria 13099
76 Ga0395899_0063259 3300037312 Bacteria 2722
77 Ga0395900_0141526 3300037418 Bacteria 2463
78 Ga0395900_0178015 3300037418 Bacteria 2163
79 Ga0395905_0003556 3300037471 Bacteria 16602
80 Ga0395905_0006249 3300037471 Bacteria 12026
81 Ga0395905_0011544 3300037471 Bacteria 8536
82 Ga0400490_01499 3300038726 Bacteria 44067
83 Ga0400490_13522 3300038726 Bacteria 7734
84 Ga0400490_14003 3300038726 Bacteria 10921
85 Ga0400491_09015 3300038727 Bacteria 1959
86 Ga0400485_06850 3300038735 Bacteria 18543
87 Ga0400485_11431 3300038735 Bacteria 142174
88 Ga0400488_21510 3300038741 Unclassified 3978
89 Ga0400488_26570 3300038741 Unclassified 4682
90 Ga0400488_32668 3300038741 Bacteria 4743
91 Ga0400488_49012 3300038741 Bacteria 8580
92 Ga0400488_59742 3300038741 Bacteria 3761
93 Ga0400486_08845 3300038742 Bacteria 3482
94 Ga0400486_18012 3300038742 Bacteria 99609
95 Ga0400486_31269 3300038742 Bacteria 20584
96 Ga0400483_013172 3300039062 Bacteria 2268
97 Ga0400483_051300 3300039062 Bacteria 2207
98 Ga0400483_063369 3300039062 Bacteria 24033
99 Ga0400483_072804 3300039062 Bacteria 7149
100 Ga0400483_110957 3300039062 Bacteria 13309
101 Ga0400483_187275 3300039062 Bacteria 48736
102 Ga0400483_289360 3300039062 Bacteria 34211
103 Ga0400483_289844 3300039062 Bacteria 8157
104 Ga0400487_14076 3300039110 Bacteria 135338
105 Ga0400487_49572 3300039110 Bacteria 10408
106 Ga0400487_58238 3300039110 Bacteria 13457
107 Ga0400487_66024 3300039110 Bacteria 4362
108 Ga0436361_0297315 3300039447 Bacteria 14718
109 Ga0436361_0634085 3300039447 Bacteria 12411
110 Ga0436361_0707747 3300039447 Bacteria 26600
111 Ga0450904_000546 3300042139 Bacteria 7145
112 Ga0466972_0000283 3300044658 Bacteria 31634
113 Ga0466965_0008246 3300044683 Bacteria 4814
114 Ga0466966_0006647 3300044684 Bacteria 7659
115 Ga0466964_0007170 3300044706 Bacteria 4168
116 Ga0495627_000413 3300046453 Bacteria 37760
117 Ga0495627_025642 3300046453 Bacteria 1909
118 Ga0495592_0004898 3300046454 Bacteria 9856
119 Ga0495591_000196 3300046458 Bacteria 61706
120 Ga0495651_0001004 3300046462 Bacteria 21915
121 Ga0495653_0146345 3300046463 Bacteria 1655
122 Ga0495605_0012496 3300046474 Bacteria 4708
123 Ga0495605_0036375 3300046474 Bacteria 2483
124 Ga0495585_0008192 3300046492 Bacteria 6348
125 Ga0495585_0012008 3300046492 Bacteria 5113
126 Ga0495585_0017467 3300046492 Bacteria 4144
127 Ga0495596_0000648 3300046500 Bacteria 21862
128 Ga0495596_0002091 3300046500 Bacteria 10940
129 Ga0495596_0013648 3300046500 Bacteria 3438
130 Ga0495607_0064823 3300046501 Bacteria 2062
131 Ga0495583_0004060 3300046506 Bacteria 10755
132 Ga0495608_0018536 3300046511 Bacteria 4799
133 Ga0495608_0065129 3300046511 Bacteria 2387
134 Ga0495616_0000577 3300046513 Bacteria 27599
135 Ga0495618_0062248 3300046514 Bacteria 2368
136 Ga0495628_0000646 3300046516 Bacteria 31897
137 Ga0495628_0048612 3300046516 Bacteria 3362
138 Ga0495628_0195983 3300046516 Bacteria 1524
139 Ga0495631_0037470 3300046518 Bacteria 2160
140 Ga0495632_0000199 3300046519 Bacteria 61019
141 Ga0495643_0002570 3300046522 Bacteria 14178
142 Ga0495648_0002208 3300046524 Bacteria 18227
143 Ga0495666_0010812 3300046526 Bacteria 4551
144 Ga0495666_0016953 3300046526 Bacteria 3626
145 Ga0495642_0008013 3300046528 Bacteria 4042
146 Ga0495642_0008727 3300046528 Bacteria 3872
147 Ga0495652_0012939 3300046529 Bacteria 7520
148 Ga0495652_0036054 3300046529 Bacteria 4302
149 Ga0495652_0105907 3300046529 Bacteria 2271
150 Ga0495665_0001295 3300046531 Bacteria 13345
151 Ga0495665_0031263 3300046531 Bacteria 2849
152 Ga0495609_0003755 3300046538 Bacteria 8565
153 Ga0495645_0030082 3300046543 Bacteria 3955
154 Ga0495622_0001961 3300046557 Bacteria 10089
155 Ga0495622_0061931 3300046557 Bacteria 1732
156 Ga0495633_0000392 3300046558 Bacteria 46091
157 Ga0495656_0019478 3300046615 Bacteria 2619
158 Ga0495611_0003758 3300046648 Bacteria 6627
159 Ga0495635_0051238 3300046663 Bacteria 2845
160 Ga0495635_0078578 3300046663 Bacteria 2259
161 Ga0495661_0000043 3300046665 Bacteria 149067
162 Ga0495599_0001662 3300046678 Bacteria 12842
163 Ga0495599_0137656 3300046678 Bacteria 1515
164 Ga0495623_0075405 3300046679 Bacteria 2094
165 Ga0495623_0086733 3300046679 Bacteria 1929
166 Ga0495646_0002526 3300046680 Bacteria 11239
167 Ga0495646_0005611 3300046680 Bacteria 7938
168 Ga0495669_0005052 3300046684 Bacteria 5485
169 Ga0495624_0040755 3300046690 Bacteria 2973
170 Ga0495589_0033713 3300046794 Bacteria 2571
171 Ga0495589_0042573 3300046794 Bacteria 2263
172 Ga0495600_0007982 3300046809 Bacteria 6485
173 Ga0495581_0001182 3300047315 Bacteria 14322
174 Ga0495604_0021651 3300047317 Bacteria 5132
175 Ga0495604_0079213 3300047317 Bacteria 2464
176 Ga0495672_0000519 3300047320 Bacteria 44080
177 Ga0495676_0001893 3300047321 Bacteria 18369
178 Ga0495680_0022311 3300047322 Bacteria 5279
179 Ga0495683_0028235 3300047323 Bacteria 2869
180 Ga0495683_0054156 3300047323 Bacteria 2000
181 Ga0495687_000020 3300047443 Bacteria 337717
182 Ga0495675_0023811 3300047444 Bacteria 3901
183 Ga0495677_0026256 3300047445 Bacteria 2112
184 Ga0495673_0012821 3300047469 Bacteria 4424
185 Ga0495681_0001737 3300047470 Bacteria 16106
186 Ga0495681_0007428 3300047470 Bacteria 7004
187 Ga0495593_0068303 3300047673 Bacteria 1849
188 Ga0495602_0010315 3300048088 Bacteria 9699
189 Ga0495602_0050233 3300048088 Bacteria 3728
190 Ga0495602_0088818 3300048088 Bacteria 2572
191 Ga0495626_0021900 3300048091 Bacteria 3163
192 Ga0495626_0037769 3300048091 Bacteria 2293
193 Ga0496101_0092922 3300048904 Bacteria 2247
194 Ga0496105_0246350 3300048908 Bacteria 1449
195 Ga0496107_0046423 3300048910 Bacteria 3127
196 Ga0496114_0009496 3300048917 Bacteria 7720
197 Ga0496125_0003449 3300048928 Bacteria 19143
198 Ga0501034_0006340 3300049571 Bacteria 12741
199 Ga0501034_0100011 3300049571 Bacteria 2894
200 Ga0501042_0132701 3300049578 Bacteria 1795
201 Ga0501076_0143904 3300049592 Bacteria 1938
202 Ga0501230_011439 3300049667 Bacteria 1405
203 nmdc:mga03n38_27799_c1 3300050490 Bacteria 2350
204 nmdc:mga08y16_119868_c1 3300050511 Bacteria 2738
205 nmdc:mga08x19_545_c1 3300050514 Bacteria 24796
206 Ga0500595_015335 3300053119 Bacteria 2880
207 Ga0500574_002998 3300053141 Bacteria 2897
208 Ga0500619_002121 3300053154 Bacteria 3737
209 2608385111 2606217733 Bacteria 6360972
210 2644027987 2643221603 Bacteria 6147767
211 2723878747 2721755763 Bacteria 4464185
212 2765571002 2765235838 Bacteria 5445269
213 2819544679 2818991436 Bacteria 5376622
214 2839099305 2839094727 Bacteria 5534556
215 2857552366 2857547612 Bacteria 6179999
216 2900642062 2900634093 Bacteria 10263517
217 2932415190 2932410948 Bacteria 6312192
218 2932421162 2932416698 Bacteria 6315112
219 8055309070 8055301274 Bacteria 8587385
220 Ga0400484_38334
221 JGI25162J39368_1000032
222 JGI25165J46597_1000067
223 Ga0055538_1000033
224 Ga0055539_1000045
225 Ga0055533_1000054
226 Ga0055525_1000065
227 Ga0055541_1000031
228 Ga0070683_100091048
229 Ga0070670_100146777
230 Ga0068864_100109834
231 Ga0068863_100012486
232 Ga0068862_100057036
233 Ga0075366_10001381
234 Ga0075436_100005660
235 Ga0111539_10034812
236 Ga0157371_10000311
237 Ga0157378_10107171
238 Ga0182008_10037628
239 Ga0182006_1008910
240 Ga0182007_10003695
241 Ga0182007_10023628
242 Ga0182005_1000118
243 Ga0163161_10022747
244 Ga0213872_10001027
245 Ga0213872_10017662
246 Ga0209760_101180
247 Ga0209784_100048
248 Ga0209566_100060
249 Ga0209674_100082
250 Ga0209563_100082
251 Ga0207427_100352
252 Ga0209437_100125
253 Ga0209677_100046
254 Ga0209233_1000138
255 Ga0207641_10106599
256 Ga0207676_10193591
257 Ga0268265_10027523
258 Ga0307408_100009775
259 Ga0316575_10003125
260 Ga0316575_10003500
261 Ga0316579_10000513
262 Ga0316576_10042903
263 Ga0316576_10227726
264 Ga0316578_10013582
265 Ga0307405_10010395
266 Ga0316577_10039567
267 Ga0316577_10066172
268 Ga0316577_10071831
269 Ga0307413_10013134
270 Ga0307410_10002961
271 Ga0307410_10029690
272 Ga0307406_10008898
273 Ga0307407_10004421
274 Ga0307409_100010819
275 Ga0307416_100003656
276 Ga0307414_10004917
277 Ga0307411_10010125
278 Ga0307415_100017918
279 Ga0316574_0001833
280 Ga0316574_0002312
281 Ga0316574_0003351
282 Ga0316574_0024165
283 Ga0316574_0080214
284 Ga0316582_0003024
285 Ga0316582_0014684
286 Ga0316582_0026730
287 Ga0316582_0118872
288 Ga0316584_0000050
289 Ga0316584_0006351
290 Ga0316584_0050255
291 Ga0316584_0071143
292 Ga0395899_0000085
293 Ga0395899_0001814
294 Ga0395899_0003151
295 Ga0395899_0063259
296 Ga0395900_0141526
297 Ga0395900_0178015
298 Ga0395905_0003556
299 Ga0395905_0006249
300 Ga0395905_0011544
301 Ga0400490_01499
302 Ga0400490_13522
303 Ga0400490_14003
304 Ga0400491_09015
305 Ga0400485_06850
306 Ga0400485_11431
307 Ga0400488_21510
308 Ga0400488_26570
309 Ga0400488_32668
310 Ga0400488_49012
311 Ga0400488_59742
312 Ga0400486_08845
313 Ga0400486_18012
314 Ga0400486_31269
315 Ga0400483_013172
316 Ga0400483_051300
317 Ga0400483_063369
318 Ga0400483_072804
319 Ga0400483_110957
320 Ga0400483_187275
321 Ga0400483_289360
322 Ga0400483_289844
323 Ga0400487_14076
324 Ga0400487_49572
325 Ga0400487_58238
326 Ga0400487_66024
327 Ga0436361_0297315
328 Ga0436361_0634085
329 Ga0436361_0707747
330 Ga0450904_000546
331 Ga0466972_0000283
332 Ga0466965_0008246
333 Ga0466966_0006647
334 Ga0466964_0007170
335 Ga0495627_000413
336 Ga0495627_025642
337 Ga0495592_0004898
338 Ga0495591_000196
339 Ga0495651_0001004
340 Ga0495653_0146345
341 Ga0495605_0012496
342 Ga0495605_0036375
343 Ga0495585_0008192
344 Ga0495585_0012008
345 Ga0495585_0017467
346 Ga0495596_0000648
347 Ga0495596_0002091
348 Ga0495596_0013648
349 Ga0495607_0064823
350 Ga0495583_0004060
351 Ga0495608_0018536
352 Ga0495608_0065129
353 Ga0495616_0000577
354 Ga0495618_0062248
355 Ga0495628_0000646
356 Ga0495628_0048612
357 Ga0495628_0195983
358 Ga0495631_0037470
359 Ga0495632_0000199
360 Ga0495643_0002570
361 Ga0495648_0002208
362 Ga0495666_0010812
363 Ga0495666_0016953
364 Ga0495642_0008013
365 Ga0495642_0008727
366 Ga0495652_0012939
367 Ga0495652_0036054
368 Ga0495652_0105907
369 Ga0495665_0001295
370 Ga0495665_0031263
371 Ga0495609_0003755
372 Ga0495645_0030082
373 Ga0495622_0001961
374 Ga0495622_0061931
375 Ga0495633_0000392
376 Ga0495656_0019478
377 Ga0495611_0003758
378 Ga0495635_0051238
379 Ga0495635_0078578
380 Ga0495661_0000043
381 Ga0495599_0001662
382 Ga0495599_0137656
383 Ga0495623_0075405
384 Ga0495623_0086733
385 Ga0495646_0002526
386 Ga0495646_0005611
387 Ga0495669_0005052
388 Ga0495624_0040755
389 Ga0495589_0033713
390 Ga0495589_0042573
391 Ga0495600_0007982
392 Ga0495581_0001182
393 Ga0495604_0021651
394 Ga0495604_0079213
395 Ga0495672_0000519
396 Ga0495676_0001893
397 Ga0495680_0022311
398 Ga0495683_0028235
399 Ga0495683_0054156
400 Ga0495687_000020
401 Ga0495675_0023811
402 Ga0495677_0026256
403 Ga0495673_0012821
404 Ga0495681_0001737
405 Ga0495681_0007428
406 Ga0495593_0068303
407 Ga0495602_0010315
408 Ga0495602_0050233
409 Ga0495602_0088818
410 Ga0495626_0021900
411 Ga0495626_0037769
412 Ga0496101_0092922
413 Ga0496105_0246350
414 Ga0496107_0046423
415 Ga0496114_0009496
416 Ga0496125_0003449
417 Ga0501034_0006340
418 Ga0501034_0100011
419 Ga0501042_0132701
420 Ga0501076_0143904
421 Ga0501230_011439
422 nmdc:mga03n38_27799_c1
423 nmdc:mga08y16_119868_c1
424 nmdc:mga08x19_545_c1
425 Ga0500595_015335
426 Ga0500574_002998
427 Ga0500619_002121
428 2608385111
429 2644027987
430 2723878747
431 2765571002
432 2819544679
433 2839099305
434 2857552366
435 2900642062
436 2932415190
437 2932421162
438 8055309070

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02754

CCG

Cysteine-rich domain

188

274

0.95

PF02754

CCG

Cysteine-rich domain

322

406

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bkb-assembly1.cif.gz_B formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) 0.8281 129 373
5odq-assembly1.cif.gz_B heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with bromoethanesulfonate. 0.8099 130 373
7bkb-assembly1.cif.gz_B formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) 0.6919 129 373
5odq-assembly1.cif.gz_B heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with bromoethanesulfonate. 0.6847 130 373
2bi4-assembly1.cif.gz_A lactaldehyde:1,2-propanediol oxidoreductase of escherichia coli 0.6495 255 344
ID Description Score Start End Superfamily
af_P52074_302_386_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9845 271 353 3.40.30.10
af_P52074_170_256_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9547 132 219 3.40.30.10
af_P52074_302_386_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9506 271 353 3.40.30.10
af_P77252_132_217_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9475 271 353 3.40.30.10
af_P52074_170_256_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9121 132 219 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A3D0DXF3-F1-model_v4 Glycolate oxidase iron-sulfur subunit 0.9891 136 373 GO:0016491
GO:0046872
GO:0051539
AF-A0A4Q6GL32-F1-model_v4 Glycolate oxidase subunit GlcF (EC 1.1.99.14) 0.9852 114 373 GO:0019154
GO:0046872
GO:0051539
AF-A0A4Q6GL32-F1-model_v4 Glycolate oxidase subunit GlcF (EC 1.1.99.14) 0.9814 114 373 GO:0019154
GO:0046872
GO:0051539
AF-A0A2C9BM63-F1-model_v4 deleted 0.9777 131 360
AF-A0A7V2EZ44-F1-model_v4 Glycolate oxidase iron-sulfur subunit 0.9749 271 371 GO:0016491
GO:0046872
GO:0051539

Map