F331236

General Info

Members Datasets Scaffolds Average Seq Length
219 165 438 159

Family's Representative Sequence

Representative Sequence 3300031616|Ga0307508_10001920|Ga0307508_1000192018
Length 175
Sequence MNIRAVRFDHPDAVRLNDEVQAEYAERYDDEGDMTPLDVSHFDPPRGLYLIAYDETGRPVATGGWRGQERNEEGYEDGDAELKRMFVISEARGRGLARLILAALEDSARAAGRTRMVLETGIKQPEAIALYTSSGYEPVKKFGLYRFDELSRCLGKPLAVPEDPVHQKNQPGVAS

Samples

Sample ID Description Type Environment
1 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
9 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
10 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
11 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
12 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
13 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
14 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
15 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
16 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
17 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
18 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
20 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
21 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
22 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
23 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
25 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
26 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
27 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
28 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
29 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
30 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
31 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
32 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
33 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
34 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
35 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
36 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
37 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
38 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
39 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
40 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
41 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
42 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
43 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
44 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
45 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
46 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
47 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
48 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
49 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
50 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
51 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
52 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
53 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
54 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
55 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
56 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
57 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
58 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
59 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
60 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
61 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
62 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
63 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
64 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
65 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
66 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
67 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
68 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
69 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
70 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
71 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
72 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
73 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
74 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
75 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
76 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
77 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
78 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
79 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
80 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
81 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
82 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
83 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
84 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
96 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
97 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
98 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
99 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
101 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
102 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
103 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
104 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
105 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
106 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
107 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
108 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
109 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
110 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
111 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
112 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
113 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
114 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
115 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
116 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
117 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
118 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
119 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
120 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
121 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
122 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
123 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
124 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
125 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
126 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
127 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
128 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
129 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
130 2643221647 Streptomyces sp. Root369 Isolate Unclassified
131 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
132 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
133 2643221714 Streptomyces sp. Root264 Isolate Unclassified
134 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
135 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
136 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
137 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
138 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
139 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
140 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
141 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
142 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
143 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
144 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
145 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
146 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
147 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
148 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
149 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
150 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
151 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
152 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
153 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
154 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
155 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
156 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
157 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
158 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
159 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
160 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
161 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
162 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
163 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
164 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
165 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.82
Metatranscriptomes 0.91
Isolates 18.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.05
Nodule 0.91
Rhizoplane 0
Rhizosphere 70.78
Stem 0
Stem Tuber 0
Unclassified 0.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307508_10001920 3300031616 Bacteria 22822
2 rootH1_10025198 3300003316 Bacteria 9784
3 rootH1_10025199 3300003316 Bacteria 1456
4 rootH2_10012043 3300003320 Bacteria 8446
5 rootL2_10087279 3300003322 Bacteria 2301
6 rootH1_10011797 3300003323 Bacteria 11984
7 Ga0006562J51391_1015909 3300003578 Bacteria 9613
8 Ga0070667_100031127 3300005367 Bacteria 4448
9 Ga0070672_100280065 3300005543 Bacteria 1409
10 Ga0075368_10006931 3300006042 Bacteria 3985
11 Ga0075363_100008400 3300006048 Bacteria 4804
12 Ga0075367_10043271 3300006178 Bacteria 2638
13 Ga0075428_100050945 3300006844 Bacteria 4539
14 Ga0075428_100068456 3300006844 Bacteria 3883
15 Ga0075430_100020094 3300006846 Bacteria 5683
16 Ga0075430_100326700 3300006846 Bacteria 1268
17 Ga0075431_100160665 3300006847 Bacteria 2310
18 Ga0075429_100070129 3300006880 Bacteria 3051
19 Ga0068865_100583174 3300006881 Bacteria 943
20 Ga0099826_10030729 3300006948 Bacteria 3894
21 Ga0114129_10002245 3300009147 Bacteria 26678
22 Ga0105242_10904326 3300009176 Bacteria 883
23 Ga0105246_10911609 3300011119 Bacteria 789
24 Ga0183367_1005 3300015688 Bacteria 652063
25 Ga0207426_1007842 3300025302 Bacteria 4413
26 Ga0207658_10157242 3300025986 Bacteria 1859
27 Ga0210000_1060239 3300027462 Unclassified 614
28 Ga0209282_1077340 3300027666 Bacteria 1789
29 Ga0307517_10009957 3300028786 Bacteria 13383
30 Ga0307515_10127666 3300028794 Bacteria 2827
31 Ga0268256_1007886 3300030500 Bacteria 3727
32 Ga0268256_1019283 3300030500 Bacteria 1872
33 Ga0307511_10000604 3300030521 Bacteria 38490
34 Ga0307512_10176754 3300030522 Bacteria 1209
35 Ga0307513_10243051 3300031456 Bacteria 1603
36 Ga0307509_10024927 3300031507 Bacteria 6687
37 Ga0307509_10051849 3300031507 Bacteria 4383
38 Ga0307508_10002946 3300031616 Bacteria 17599
39 Ga0307514_10292285 3300031649 Bacteria 921
40 Ga0307516_10021963 3300031730 Bacteria 6557
41 Ga0307516_10032500 3300031730 Bacteria 5254
42 Ga0307516_10099106 3300031730 Bacteria 2732
43 Ga0307516_10135842 3300031730 Bacteria 2233
44 Ga0307518_10027260 3300031838 Bacteria 4120
45 Ga0307518_10115977 3300031838 Bacteria 1902
46 Ga0307518_10173081 3300031838 Bacteria 1469
47 Ga0307510_10134411 3300033180 Bacteria 2135
48 Ga0395900_1607574 3300037418 Bacteria 561
49 Ga0395901_1025369 3300038443 Bacteria 799
50 Ga0451853_0741786 3300041512 Bacteria 2387
51 Ga0451853_2462945 3300041512 Bacteria 1071
52 Ga0439433_0006907 3300041999 Bacteria 2448
53 Ga0439442_003646 3300042002 Bacteria 3050
54 Ga0439448_0117163 3300042005 Bacteria 912
55 Ga0439449_0000629 3300042007 Bacteria 13232
56 Ga0439450_071707 3300042008 Bacteria 851
57 Ga0439454_055117 3300042011 Bacteria 679
58 Ga0439455_0082814 3300042012 Bacteria 873
59 Ga0439457_000334 3300042014 Bacteria 13014
60 Ga0439462_0029218 3300042015 Bacteria 1458
61 Ga0450900_006695 3300042136 Bacteria 1401
62 Ga0450903_000058 3300042138 Bacteria 22483
63 Ga0439458_0001464 3300042157 Bacteria 5946
64 Ga0439458_0012003 3300042157 Bacteria 1941
65 Ga0466969_0135049 3300044656 Bacteria 1143
66 Ga0466972_0001951 3300044658 Bacteria 10122
67 Ga0466972_0009067 3300044658 Bacteria 4996
68 Ga0466972_0026722 3300044658 Bacteria 2859
69 Ga0466965_0000076 3300044683 Bacteria 29433
70 Ga0466965_0035700 3300044683 Bacteria 2436
71 Ga0466965_0120551 3300044683 Bacteria 1354
72 Ga0466965_0638224 3300044683 Bacteria 607
73 Ga0466966_0000415 3300044684 Bacteria 27468
74 Ga0466966_0306462 3300044684 Bacteria 954
75 Ga0466966_0663386 3300044684 Bacteria 628
76 Ga0466961_0001528 3300044693 Bacteria 14328
77 Ga0466961_0132786 3300044693 Bacteria 1560
78 Ga0466963_0000217 3300044694 Bacteria 24560
79 Ga0466963_0053202 3300044694 Bacteria 2688
80 Ga0466963_0221707 3300044694 Bacteria 1324
81 Ga0466964_0011684 3300044706 Bacteria 3320
82 Ga0466971_0000287 3300044719 Bacteria 19329
83 Ga0466971_0056401 3300044719 Bacteria 1772
84 Ga0466968_0017739 3300044735 Bacteria 2849
85 Ga0466970_0000305 3300044765 Bacteria 23911
86 Ga0466970_0010874 3300044765 Bacteria 4629
87 Ga0466957_0007704 3300044842 Bacteria 6089
88 Ga0466960_0041969 3300044901 Bacteria 2169
89 Ga0466960_0114761 3300044901 Bacteria 1404
90 Ga0466959_0056654 3300045049 Bacteria 2859
91 Ga0466959_0416527 3300045049 Bacteria 912
92 Ga0466958_0101938 3300045836 Bacteria 1785
93 Ga0466967_0001268 3300045976 Bacteria 14312
94 Ga0466967_0152632 3300045976 Bacteria 2160
95 Ga0466967_0270245 3300045976 Bacteria 1629
96 Ga0466967_1670596 3300045976 Bacteria 634
97 Ga0495629_0010009 3300046459 Bacteria 6919
98 Ga0495629_0135544 3300046459 Bacteria 1714
99 Ga0495594_0136020 3300046499 Bacteria 1393
100 Ga0495632_0010400 3300046519 Bacteria 5516
101 Ga0495643_0002271 3300046522 Bacteria 15537
102 Ga0495622_0100881 3300046557 Bacteria 1323
103 Ga0495622_0133185 3300046557 Bacteria 1131
104 Ga0495625_0053803 3300046660 Bacteria 2877
105 Ga0495599_0076985 3300046678 Bacteria 2083
106 Ga0495658_0062048 3300046683 Bacteria 2148
107 Ga0495613_0000624 3300046689 Bacteria 28151
108 Ga0495613_0692677 3300046689 Bacteria 671
109 Ga0495670_0025804 3300046691 Bacteria 2908
110 Ga0495674_0124815 3300047319 Bacteria 2173
111 Ga0495676_0091273 3300047321 Bacteria 2277
112 Ga0495683_0150860 3300047323 Bacteria 1082
113 Ga0495683_0230672 3300047323 Bacteria 821
114 Ga0495687_034819 3300047443 Bacteria 2270
115 Ga0495687_053928 3300047443 Bacteria 1690
116 Ga0495687_179498 3300047443 Bacteria 692
117 Ga0495687_212494 3300047443 Bacteria 605
118 Ga0495685_000311 3300047447 Bacteria 15935
119 Ga0495681_0048722 3300047470 Bacteria 2006
120 Ga0495593_0204291 3300047673 Bacteria 993
121 Ga0501309_073235 3300049129 Bacteria 566
122 Ga0501032_0023418 3300049569 Bacteria 4266
123 Ga0501032_0043138 3300049569 Bacteria 3056
124 Ga0501033_0004151 3300049570 Bacteria 11671
125 Ga0501033_0040803 3300049570 Bacteria 3465
126 Ga0501034_0009342 3300049571 Bacteria 10275
127 Ga0501034_0630310 3300049571 Bacteria 975
128 Ga0501036_0021395 3300049572 Bacteria 5437
129 Ga0501037_0010772 3300049573 Bacteria 6719
130 Ga0501037_0748845 3300049573 Bacteria 647
131 Ga0501038_0020262 3300049574 Bacteria 5983
132 Ga0501038_0379579 3300049574 Bacteria 1096
133 Ga0501039_0002822 3300049575 Bacteria 12983
134 Ga0501039_0566087 3300049575 Bacteria 891
135 Ga0501043_0021807 3300049579 Bacteria 5023
136 Ga0501043_0157430 3300049579 Bacteria 1776
137 Ga0501046_0012101 3300049580 Bacteria 7357
138 Ga0501047_0000023 3300049581 Bacteria 240478
139 Ga0501047_0013134 3300049581 Bacteria 7843
140 Ga0501047_0605202 3300049581 Bacteria 917
141 Ga0501070_0017983 3300049586 Bacteria 5932
142 Ga0501075_0475090 3300049591 Bacteria 954
143 Ga0501077_0180749 3300049593 Bacteria 1341
144 Ga0501241_073025 3300049758 Bacteria 704
145 Ga0501035_0332080 3300049822 Bacteria 1275
146 Ga0501035_0475610 3300049822 Bacteria 1031
147 Ga0501035_1143865 3300049822 Bacteria 606
148 Ga0501044_0064156 3300049823 Bacteria 3751
149 Ga0501044_0220419 3300049823 Bacteria 1847
150 Ga0501044_0405307 3300049823 Bacteria 1275
151 nmdc:mga03n38_9381_c1 3300050490 Bacteria 3559
152 nmdc:mga06z11_29438_c1 3300050494 Bacteria 2646
153 nmdc:mga07m45_54294_c2 3300050496 Bacteria 1813
154 nmdc:mga05p37_2802_c1 3300050507 Bacteria 20268
155 nmdc:mga09592_246017_c1 3300050508 Bacteria 1550
156 nmdc:mga09592_44840_c1 3300050508 Bacteria 3724
157 nmdc:mga0qj67_3756_c1 3300050509 Bacteria 10967
158 nmdc:mga0qj67_46768_c1 3300050509 Bacteria 3417
159 nmdc:mga06r32_126564_c1 3300050510 Bacteria 2524
160 nmdc:mga06r32_1517450_c1 3300050510 Bacteria 610
161 Ga0495619_0348399 3300053085 Bacteria 1025
162 Ga0500566_0018023 3300053094 Bacteria 4147
163 Ga0500650_0156999 3300053098 Bacteria 1050
164 Ga0500660_118943 3300053100 Bacteria 1105
165 Ga0500553_065876 3300053101 Bacteria 1681
166 Ga0500560_185507 3300053107 Bacteria 678
167 Ga0500614_017569 3300053123 Bacteria 1618
168 Ga0500652_003914 3300053131 Bacteria 4553
169 Ga0500658_0003469 3300053134 Bacteria 5956
170 Ga0500561_0000713 3300053137 Bacteria 5272
171 Ga0500573_0024902 3300053140 Bacteria 3441
172 Ga0500577_0293044 3300053142 Bacteria 710
173 Ga0500600_0022194 3300053149 Bacteria 3801
174 Ga0500616_0015489 3300053153 Bacteria 4358
175 Ga0500634_0003352 3300053161 Bacteria 7096
176 Ga0500636_0365921 3300053177 Bacteria 682
177 Ga0501082_0715203 3300060353 Bacteria 877
178 Ga0466962_0016037 3300061719 Bacteria 3614
179 Ga0466962_0119462 3300061719 Bacteria 1271
180 2547408008 2547132111 Bacteria 8013147
181 2554258033 2554235005 Bacteria 6457341
182 2558910848 2558860112 Bacteria 9931328
183 2643948273 2643221587 Bacteria 7586415
184 2644264114 2643221647 Bacteria 10741251
185 2644429746 2643221677 Bacteria 7584031
186 2644436998 2643221678 Bacteria 9540101
187 2644628747 2643221714 Bacteria 9015452
188 2786670435 2786546132 Bacteria 10419719
189 2808841896 2808606359 Bacteria 9866990
190 2811848817 2808606982 Bacteria 7791042
191 2812358356 2811994879 Bacteria 9313447
192 2862179551 2862178590 Bacteria 8583590
193 2862285498 2862281513 Bacteria 9621493
194 2877681254 2877676314 Bacteria 9512378
195 2899365422 2899359706 Bacteria 10940472
196 2912720200 2912715099 Bacteria 9460473
197 2918504381 2918501144 Bacteria 8668083
198 2919469661 2919468124 Bacteria 9133025
199 2935392562 2935390628 Bacteria 7043367
200 2946067521 2946064051 Bacteria 8957905
201 2946075769 2946072368 Bacteria 8999607
202 2954007658 2954002825 Bacteria 9173742
203 2954386399 2954380949 Bacteria 10050426
204 2954676780 2954673503 Bacteria 9685905
205 2954687386 2954682443 Bacteria 9862841
206 2954697071 2954691527 Bacteria 10720516
207 2954705064 2954701450 Bacteria 10834262
208 2954716382 2954711539 Bacteria 10867210
209 2954726327 2954721474 Bacteria 10456478
210 2954735483 2954731030 Bacteria 10243860
211 2954745251 2954740390 Bacteria 10229294
212 2954754338 2954749733 Bacteria 10366972
213 2954764226 2954759201 Bacteria 9358192
214 3003001748 3002998708 Bacteria 11715108
215 3006496214 3006493962 Bacteria 8825450
216 8033684535 8033684223 Bacteria 6906479
217 8056211784 8056207758 Bacteria 8639239
218 8056447628 8056447290 Bacteria 7680491
219 8056671901 8056667051 Bacteria 6953971
220 Ga0307508_10001920
221 rootH1_10025198
222 rootH1_10025199
223 rootH2_10012043
224 rootL2_10087279
225 rootH1_10011797
226 Ga0006562J51391_1015909
227 Ga0070667_100031127
228 Ga0070672_100280065
229 Ga0075368_10006931
230 Ga0075363_100008400
231 Ga0075367_10043271
232 Ga0075428_100050945
233 Ga0075428_100068456
234 Ga0075430_100020094
235 Ga0075430_100326700
236 Ga0075431_100160665
237 Ga0075429_100070129
238 Ga0068865_100583174
239 Ga0099826_10030729
240 Ga0114129_10002245
241 Ga0105242_10904326
242 Ga0105246_10911609
243 Ga0183367_1005
244 Ga0207426_1007842
245 Ga0207658_10157242
246 Ga0210000_1060239
247 Ga0209282_1077340
248 Ga0307517_10009957
249 Ga0307515_10127666
250 Ga0268256_1007886
251 Ga0268256_1019283
252 Ga0307511_10000604
253 Ga0307512_10176754
254 Ga0307513_10243051
255 Ga0307509_10024927
256 Ga0307509_10051849
257 Ga0307508_10002946
258 Ga0307514_10292285
259 Ga0307516_10021963
260 Ga0307516_10032500
261 Ga0307516_10099106
262 Ga0307516_10135842
263 Ga0307518_10027260
264 Ga0307518_10115977
265 Ga0307518_10173081
266 Ga0307510_10134411
267 Ga0395900_1607574
268 Ga0395901_1025369
269 Ga0451853_0741786
270 Ga0451853_2462945
271 Ga0439433_0006907
272 Ga0439442_003646
273 Ga0439448_0117163
274 Ga0439449_0000629
275 Ga0439450_071707
276 Ga0439454_055117
277 Ga0439455_0082814
278 Ga0439457_000334
279 Ga0439462_0029218
280 Ga0450900_006695
281 Ga0450903_000058
282 Ga0439458_0001464
283 Ga0439458_0012003
284 Ga0466969_0135049
285 Ga0466972_0001951
286 Ga0466972_0009067
287 Ga0466972_0026722
288 Ga0466965_0000076
289 Ga0466965_0035700
290 Ga0466965_0120551
291 Ga0466965_0638224
292 Ga0466966_0000415
293 Ga0466966_0306462
294 Ga0466966_0663386
295 Ga0466961_0001528
296 Ga0466961_0132786
297 Ga0466963_0000217
298 Ga0466963_0053202
299 Ga0466963_0221707
300 Ga0466964_0011684
301 Ga0466971_0000287
302 Ga0466971_0056401
303 Ga0466968_0017739
304 Ga0466970_0000305
305 Ga0466970_0010874
306 Ga0466957_0007704
307 Ga0466960_0041969
308 Ga0466960_0114761
309 Ga0466959_0056654
310 Ga0466959_0416527
311 Ga0466958_0101938
312 Ga0466967_0001268
313 Ga0466967_0152632
314 Ga0466967_0270245
315 Ga0466967_1670596
316 Ga0495629_0010009
317 Ga0495629_0135544
318 Ga0495594_0136020
319 Ga0495632_0010400
320 Ga0495643_0002271
321 Ga0495622_0100881
322 Ga0495622_0133185
323 Ga0495625_0053803
324 Ga0495599_0076985
325 Ga0495658_0062048
326 Ga0495613_0000624
327 Ga0495613_0692677
328 Ga0495670_0025804
329 Ga0495674_0124815
330 Ga0495676_0091273
331 Ga0495683_0150860
332 Ga0495683_0230672
333 Ga0495687_034819
334 Ga0495687_053928
335 Ga0495687_179498
336 Ga0495687_212494
337 Ga0495685_000311
338 Ga0495681_0048722
339 Ga0495593_0204291
340 Ga0501309_073235
341 Ga0501032_0023418
342 Ga0501032_0043138
343 Ga0501033_0004151
344 Ga0501033_0040803
345 Ga0501034_0009342
346 Ga0501034_0630310
347 Ga0501036_0021395
348 Ga0501037_0010772
349 Ga0501037_0748845
350 Ga0501038_0020262
351 Ga0501038_0379579
352 Ga0501039_0002822
353 Ga0501039_0566087
354 Ga0501043_0021807
355 Ga0501043_0157430
356 Ga0501046_0012101
357 Ga0501047_0000023
358 Ga0501047_0013134
359 Ga0501047_0605202
360 Ga0501070_0017983
361 Ga0501075_0475090
362 Ga0501077_0180749
363 Ga0501241_073025
364 Ga0501035_0332080
365 Ga0501035_0475610
366 Ga0501035_1143865
367 Ga0501044_0064156
368 Ga0501044_0220419
369 Ga0501044_0405307
370 nmdc:mga03n38_9381_c1
371 nmdc:mga06z11_29438_c1
372 nmdc:mga07m45_54294_c2
373 nmdc:mga05p37_2802_c1
374 nmdc:mga09592_246017_c1
375 nmdc:mga09592_44840_c1
376 nmdc:mga0qj67_3756_c1
377 nmdc:mga0qj67_46768_c1
378 nmdc:mga06r32_126564_c1
379 nmdc:mga06r32_1517450_c1
380 Ga0495619_0348399
381 Ga0500566_0018023
382 Ga0500650_0156999
383 Ga0500660_118943
384 Ga0500553_065876
385 Ga0500560_185507
386 Ga0500614_017569
387 Ga0500652_003914
388 Ga0500658_0003469
389 Ga0500561_0000713
390 Ga0500573_0024902
391 Ga0500577_0293044
392 Ga0500600_0022194
393 Ga0500616_0015489
394 Ga0500634_0003352
395 Ga0500636_0365921
396 Ga0501082_0715203
397 Ga0466962_0016037
398 Ga0466962_0119462
399 2547408008
400 2554258033
401 2558910848
402 2643948273
403 2644264114
404 2644429746
405 2644436998
406 2644628747
407 2786670435
408 2808841896
409 2811848817
410 2812358356
411 2862179551
412 2862285498
413 2877681254
414 2899365422
415 2912720200
416 2918504381
417 2919469661
418 2935392562
419 2946067521
420 2946075769
421 2954007658
422 2954386399
423 2954676780
424 2954687386
425 2954697071
426 2954705064
427 2954716382
428 2954726327
429 2954735483
430 2954745251
431 2954754338
432 2954764226
433 3003001748
434 3006496214
435 8033684535
436 8056211784
437 8056447628
438 8056671901

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

13

136

0.77

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

44

143

0.77

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

45

138

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lod-assembly1.cif.gz_A the crystal structure of the putative acyl-coa n-acyltransferase from klebsiella pneumoniae subsp.pneumoniae mgh 78578 0.9045 4 161
3lod-assembly1.cif.gz_A the crystal structure of the putative acyl-coa n-acyltransferase from klebsiella pneumoniae subsp.pneumoniae mgh 78578 0.8747 4 161
3pp9-assembly2.cif.gz_C 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.8011 39 161
3c26-assembly1.cif.gz_A-2 crystal structure of a putative acetyltransferase (np_394282.1) from thermoplasma acidophilum at 2.00 a resolution 0.7956 52 142
3v8h-assembly1.cif.gz_D crystal structure of thymidylate synthase from burkholderia thailandensis 0.792 118 161
ID Description Score Start End Superfamily
3lodA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9045 4 161 3.40.630.30
af_A0A286YBP0_57_178_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8807 43 147 3.40.630.30
af_Q54IL8_181_295_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8756 52 139 3.40.630.30
3lodA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8747 4 161 3.40.630.30
af_Q0D8A4_1_78_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8731 82 142 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A652JSE8-F1-model_v4 GNAT family N-acetyltransferase 1.005 68 160 GO:0016747
AF-A0A7D5ZKG4-F1-model_v4 GNAT family N-acetyltransferase 1.004 5 161 GO:0016747
AF-A0A367HLD5-F1-model_v4 GNAT family N-acetyltransferase 1.004 5 160 GO:0016747
AF-A0A6I6FRC0-F1-model_v4 GNAT family N-acetyltransferase 1.003 5 160 GO:0016747
AF-A0A1C5F6P0-F1-model_v4 Acetyltransferase (GNAT) family protein 1.003 5 160 GO:0016747

Map