F331046

General Info

Members Datasets Scaffolds Average Seq Length
219 150 438 247

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10095154|Ga0105242_100951542
Length 302
Sequence MTHFLVATIPVFAQLEAVMKHLLNWLHASLGLPWAWAIVATTVLVRIALVPLTIKQIHSMQSLQLHAPEMKRIQQKYKHDKQKQNEELMKFYRENKINPAASCLPMLLQIPVFIALYYTLRSFNENFLCTTAATDPNGSVATKAACQAIVDHTNLSFLHFIPSIAVGTTVFWGGYVLLVVYVASQMVSGLFMAPTAQKSQRVIFILMPLAFVFVIAHFPAGLVLYWCTTNLWTVGQGLITRRLVQRTPAPSPERRTSRTLPKEDEGTSGNGASSEPTAPTPAPAVTGRTRQVRRKKSGGRRR

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
39 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
40 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
55 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
56 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
57 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
58 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
59 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
60 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
61 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
62 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
63 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
64 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
65 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
66 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
67 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
68 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
69 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
70 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
71 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
72 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
73 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
74 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
81 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
82 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
83 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
84 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
87 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
88 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
89 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
90 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
91 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
92 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
93 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
94 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
95 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
96 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
97 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
98 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
99 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
100 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
101 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
102 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
103 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
104 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
105 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
106 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
107 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
108 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
109 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
110 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
111 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
112 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
113 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
114 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
115 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
116 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
117 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
118 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
119 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
120 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
121 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
122 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
126 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
127 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
128 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
129 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
130 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
132 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
133 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
134 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
135 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
136 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
137 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
138 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
139 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
140 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
141 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
142 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
143 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
144 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
145 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
146 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
147 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
148 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
149 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
150 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 14.16
Rhizosphere 85.84
Stem 0
Stem Tuber 0
Unclassified 9.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10095154 3300009176 Bacteria 2514
2 Ga0070658_10231108 3300005327 Bacteria 1566
3 Ga0070683_100005234 3300005329 Bacteria 10796
4 Ga0070683_100046456 3300005329 Bacteria 4011
5 Ga0070690_100175721 3300005330 Unclassified 1477
6 Ga0070680_100108881 3300005336 Unclassified 2305
7 Ga0070680_100134861 3300005336 Bacteria 2067
8 Ga0068868_100477342 3300005338 Bacteria 1089
9 Ga0070709_10061962 3300005434 Bacteria 2383
10 Ga0070709_10270750 3300005434 Bacteria 1231
11 Ga0070714_100058073 3300005435 Bacteria 3313
12 Ga0070713_100073463 3300005436 Bacteria 2895
13 Ga0070710_10034726 3300005437 Bacteria 2745
14 Ga0070708_100039830 3300005445 Bacteria 4113
15 Ga0070681_10078141 3300005458 Bacteria 3266
16 Ga0070681_10362963 3300005458 Bacteria 1359
17 Ga0070706_100199955 3300005467 Bacteria 1867
18 Ga0070707_100005211 3300005468 Bacteria 12168
19 Ga0070707_100167313 3300005468 Bacteria 2143
20 Ga0070679_100069162 3300005530 Bacteria 3522
21 Ga0070684_100116729 3300005535 Bacteria 2398
22 Ga0070684_100207211 3300005535 Unclassified 1787
23 Ga0070697_100247109 3300005536 Bacteria 1525
24 Ga0070696_100335737 3300005546 Unclassified 1167
25 Ga0070704_100100926 3300005549 Bacteria 2174
26 Ga0068856_100143848 3300005614 Bacteria 2392
27 Ga0081455_10004500 3300005937 Bacteria 15585
28 Ga0081455_10188248 3300005937 Bacteria 1557
29 Ga0081540_1006152 3300005983 Bacteria 8810
30 Ga0081540_1012294 3300005983 Bacteria 5651
31 Ga0070717_10022481 3300006028 Bacteria 4984
32 Ga0070717_10035996 3300006028 Bacteria 4012
33 Ga0075432_10035142 3300006058 Bacteria 1741
34 Ga0070715_10002374 3300006163 Bacteria 5763
35 Ga0070716_100001579 3300006173 Bacteria 10238
36 Ga0070712_100020142 3300006175 Bacteria 4361
37 Ga0075428_100330541 3300006844 Bacteria 1637
38 Ga0075428_100337765 3300006844 Bacteria 1618
39 Ga0075431_100128074 3300006847 Bacteria 2619
40 Ga0075429_100117373 3300006880 Bacteria 2326
41 Ga0075436_100008138 3300006914 Bacteria 7179
42 Ga0075435_100560533 3300007076 Bacteria 990
43 Ga0105245_10025325 3300009098 Bacteria 5217
44 Ga0105242_10384587 3300009176 Unclassified 1305
45 Ga0105248_10208185 3300009177 Bacteria 2204
46 Ga0105248_10494404 3300009177 Bacteria 1379
47 Ga0105239_10126563 3300010375 Bacteria 2840
48 Ga0157375_10242635 3300013308 Bacteria 1961
49 Ga0163163_10201954 3300014325 Bacteria 2036
50 Ga0213873_10015016 3300021358 Bacteria 1727
51 Ga0213871_10004999 3300021441 Bacteria 2703
52 Ga0207692_10002424 3300025898 Bacteria 7152
53 Ga0207699_10321282 3300025906 Bacteria 1086
54 Ga0207699_10347520 3300025906 Bacteria 1046
55 Ga0207705_10037902 3300025909 Bacteria 3450
56 Ga0207707_10022656 3300025912 Bacteria 5493
57 Ga0207707_10466888 3300025912 Bacteria 1079
58 Ga0207693_10003722 3300025915 Bacteria 12998
59 Ga0207693_10014365 3300025915 Bacteria 6369
60 Ga0207652_10062743 3300025921 Bacteria 3212
61 Ga0207652_10097648 3300025921 Bacteria 2590
62 Ga0207652_10348767 3300025921 Bacteria 1336
63 Ga0207646_10025967 3300025922 Bacteria 5354
64 Ga0207646_10118877 3300025922 Bacteria 2374
65 Ga0207687_10220589 3300025927 Bacteria 1493
66 Ga0207664_10014151 3300025929 Bacteria 5753
67 Ga0207686_10211897 3300025934 Unclassified 1393
68 Ga0207686_10332912 3300025934 Bacteria 1138
69 Ga0207665_10002167 3300025939 Bacteria 13273
70 Ga0207661_10039119 3300025944 Bacteria 3721
71 Ga0207661_10068902 3300025944 Bacteria 2882
72 Ga0207712_10309705 3300025961 Unclassified 1299
73 Ga0207677_10236519 3300026023 Bacteria 1475
74 Ga0207677_10422150 3300026023 Bacteria 1136
75 Ga0207428_10002673 3300027907 Bacteria 17756
76 Ga0265334_10020430 3300028573 Bacteria 2711
77 Ga0265318_10018257 3300028577 Unclassified 2865
78 Ga0265336_10017112 3300028666 Bacteria 2362
79 Ga0265338_10001048 3300028800 Bacteria 46186
80 Ga0265338_10011458 3300028800 Bacteria 10238
81 Ga0265338_10196097 3300028800 Bacteria 1526
82 Ga0265324_10009630 3300029957 Bacteria 3762
83 Ga0265332_10012280 3300031238 Bacteria 3800
84 Ga0265339_10024939 3300031249 Bacteria 3439
85 Ga0265327_10048307 3300031251 Unclassified 2239
86 Ga0265327_10052676 3300031251 Bacteria 2117
87 Ga0265316_10151714 3300031344 Unclassified 1735
88 Ga0265313_10014857 3300031595 Bacteria 4573
89 Ga0265313_10146182 3300031595 Unclassified 1013
90 Ga0265342_10117861 3300031712 Unclassified 1497
91 Ga0307409_100045980 3300031995 Bacteria 3301
92 Ga0307416_100061765 3300032002 Bacteria 3060
93 Ga0373955_0204920 3300035172 Bacteria 1175
94 Ga0373942_0028164 3300035207 Bacteria 1467
95 Ga0373924_0038538 3300035410 Bacteria 1950
96 Ga0373931_0027126 3300035691 Bacteria 2921
97 Ga0373935_0044056 3300035692 Bacteria 2811
98 Ga0373937_0002550 3300036401 Bacteria 15130
99 Ga0373925_0095826 3300037068 Bacteria 2274
100 Ga0395899_0051158 3300037312 Bacteria 3066
101 Ga0395900_0023421 3300037418 Bacteria 6321
102 Ga0395900_0156269 3300037418 Bacteria 2329
103 Ga0395900_0179211 3300037418 Bacteria 2154
104 Ga0395900_0220646 3300037418 Bacteria 1911
105 Ga0395900_0224200 3300037418 Bacteria 1893
106 Ga0395898_0006202 3300037466 Bacteria 12808
107 Ga0395898_0173911 3300037466 Bacteria 2058
108 Ga0395898_0178181 3300037466 Bacteria 2031
109 Ga0395905_0130635 3300037471 Unclassified 2362
110 Ga0395905_0178902 3300037471 Unclassified 1991
111 Ga0395905_0560352 3300037471 Bacteria 1044
112 Ga0395901_0063775 3300038443 Bacteria 3835
113 Ga0395901_0558498 3300038443 Bacteria 1159
114 Ga0436360_0091142 3300039438 Bacteria 1067
115 Ga0436360_0542958 3300039438 Bacteria 4247
116 Ga0436360_0705341 3300039438 Bacteria 9110
117 Ga0436362_1288040 3300039453 Bacteria 1723
118 Ga0466972_0119067 3300044658 Bacteria 1246
119 Ga0466963_0004703 3300044694 Bacteria 7971
120 Ga0466964_0092909 3300044706 Bacteria 1316
121 Ga0451576_0173544 3300045051 Bacteria 2250
122 Ga0466958_0001692 3300045836 Bacteria 10629
123 Ga0466967_0017759 3300045976 Bacteria 5661
124 Ga0466967_0018103 3300045976 Bacteria 5620
125 Ga0466967_0133664 3300045976 Unclassified 2305
126 Ga0466967_0306933 3300045976 Bacteria 1528
127 Ga0495592_0000050 3300046454 Bacteria 111971
128 Ga0495603_0094976 3300046455 Bacteria 1742
129 Ga0495603_0195905 3300046455 Bacteria 1168
130 Ga0495641_0120660 3300046461 Bacteria 1170
131 Ga0495651_0000028 3300046462 Bacteria 105473
132 Ga0495653_0144094 3300046463 Bacteria 1672
133 Ga0495605_0100439 3300046474 Bacteria 1331
134 Ga0495608_0000555 3300046511 Bacteria 25761
135 Ga0495608_0039468 3300046511 Bacteria 3164
136 Ga0495618_0006266 3300046514 Bacteria 7220
137 Ga0495628_0000060 3300046516 Bacteria 87173
138 Ga0495628_0249803 3300046516 Bacteria 1325
139 Ga0495630_0038016 3300046517 Bacteria 3599
140 Ga0495652_0002771 3300046529 Bacteria 17711
141 Ga0495587_0000062 3300046536 Bacteria 91862
142 Ga0495645_0000418 3300046543 Bacteria 29334
143 Ga0495667_0023448 3300046559 Bacteria 4158
144 Ga0495667_0077489 3300046559 Bacteria 2162
145 Ga0495634_0155883 3300046642 Bacteria 1442
146 Ga0495634_0218168 3300046642 Unclassified 1178
147 Ga0495635_0017568 3300046663 Bacteria 4996
148 Ga0495657_0027728 3300046675 Bacteria 3993
149 Ga0495657_0068460 3300046675 Bacteria 2326
150 Ga0495657_0116241 3300046675 Bacteria 1689
151 Ga0495599_0000542 3300046678 Bacteria 21674
152 Ga0495623_0000435 3300046679 Bacteria 27481
153 Ga0495646_0021583 3300046680 Bacteria 4067
154 Ga0495647_0059079 3300046681 Bacteria 1509
155 Ga0495624_0022222 3300046690 Bacteria 4197
156 Ga0495604_0000262 3300047317 Bacteria 46873
157 Ga0495676_0048727 3300047321 Bacteria 3413
158 Ga0495680_0043695 3300047322 Bacteria 3546
159 Ga0495675_0000020 3300047444 Bacteria 111526
160 Ga0495684_0024085 3300047471 Bacteria 4683
161 Ga0495602_0000222 3300048088 Bacteria 53050
162 Ga0495602_0097063 3300048088 Bacteria 2429
163 Ga0496100_0030731 3300048903 Bacteria 3333
164 Ga0496101_0024496 3300048904 Bacteria 4177
165 Ga0496101_0112703 3300048904 Bacteria 2049
166 Ga0496101_0138900 3300048904 Bacteria 1851
167 Ga0496102_0138564 3300048905 Bacteria 2280
168 Ga0496102_0242417 3300048905 Bacteria 1700
169 Ga0496104_0177932 3300048907 Bacteria 2037
170 Ga0496104_0240041 3300048907 Bacteria 1724
171 Ga0496104_0351027 3300048907 Bacteria 1388
172 Ga0496104_0578519 3300048907 Bacteria 1033
173 Ga0496105_0010509 3300048908 Bacteria 7281
174 Ga0496107_0015841 3300048910 Bacteria 5288
175 Ga0496107_0069954 3300048910 Bacteria 2548
176 Ga0496108_0048022 3300048911 Bacteria 3569
177 Ga0496109_0002156 3300048912 Bacteria 16361
178 Ga0496109_0088820 3300048912 Bacteria 2856
179 Ga0496110_0028717 3300048913 Bacteria 4780
180 Ga0496110_0424118 3300048913 Bacteria 1213
181 Ga0496111_0001604 3300048914 Bacteria 13081
182 Ga0496111_0023069 3300048914 Bacteria 4365
183 Ga0496111_0113011 3300048914 Unclassified 2001
184 Ga0496112_0096236 3300048915 Unclassified 2931
185 Ga0496112_0122428 3300048915 Bacteria 2572
186 Ga0496112_0132922 3300048915 Bacteria 2459
187 Ga0496113_0042289 3300048916 Bacteria 3366
188 Ga0496113_0135273 3300048916 Bacteria 1936
189 Ga0496114_0045251 3300048917 Bacteria 3655
190 Ga0496114_0045903 3300048917 Bacteria 3630
191 Ga0496114_0053475 3300048917 Bacteria 3366
192 Ga0496115_0004001 3300048918 Bacteria 10638
193 Ga0496115_0060838 3300048918 Bacteria 3043
194 Ga0501041_0153495 3300049577 Bacteria 1438
195 Ga0501067_0033429 3300049583 Bacteria 2853
196 Ga0501069_0012341 3300049585 Bacteria 4540
197 Ga0501071_0281482 3300049587 Bacteria 1259
198 Ga0501076_0331129 3300049592 Bacteria 1249
199 Ga0501077_0076369 3300049593 Unclassified 2122
200 Ga0501079_0056456 3300049741 Bacteria 3030
201 Ga0501081_0168988 3300049743 Bacteria 1578
202 Ga0501035_0077014 3300049822 Bacteria 2948
203 Ga0501035_0207895 3300049822 Unclassified 1676
204 nmdc:mga05p37_221396_c1 3300050507 Bacteria 2284
205 nmdc:mga05p37_45364_c1 3300050507 Bacteria 5407
206 nmdc:mga09592_88252_c1 3300050508 Bacteria 2648
207 nmdc:mga06r32_123996_c1 3300050510 Bacteria 2550
208 nmdc:mga08y16_200767_c1 3300050511 Unclassified 2067
209 nmdc:mga0n895_155080_c1 3300050512 Bacteria 2320
210 nmdc:mga0rr50_8326_c1 3300050513 Bacteria 6452
211 nmdc:mga08x19_1333_c1 3300050514 Bacteria 15319
212 nmdc:mga0a205_2416_c1 3300050515 Bacteria 16464
213 Ga0495601_0000858 3300053077 Bacteria 16563
214 Ga0495601_0133758 3300053077 Bacteria 1616
215 Ga0495595_0032683 3300053084 Bacteria 2344
216 Ga0495619_0004654 3300053085 Bacteria 8741
217 Ga0495619_0018451 3300053085 Bacteria 4426
218 Ga0530510_0003874 3300061734 Bacteria 10315
219 Ga0530510_0097056 3300061734 Bacteria 2154
220 Ga0105242_10095154
221 Ga0070658_10231108
222 Ga0070683_100005234
223 Ga0070683_100046456
224 Ga0070690_100175721
225 Ga0070680_100108881
226 Ga0070680_100134861
227 Ga0068868_100477342
228 Ga0070709_10061962
229 Ga0070709_10270750
230 Ga0070714_100058073
231 Ga0070713_100073463
232 Ga0070710_10034726
233 Ga0070708_100039830
234 Ga0070681_10078141
235 Ga0070681_10362963
236 Ga0070706_100199955
237 Ga0070707_100005211
238 Ga0070707_100167313
239 Ga0070679_100069162
240 Ga0070684_100116729
241 Ga0070684_100207211
242 Ga0070697_100247109
243 Ga0070696_100335737
244 Ga0070704_100100926
245 Ga0068856_100143848
246 Ga0081455_10004500
247 Ga0081455_10188248
248 Ga0081540_1006152
249 Ga0081540_1012294
250 Ga0070717_10022481
251 Ga0070717_10035996
252 Ga0075432_10035142
253 Ga0070715_10002374
254 Ga0070716_100001579
255 Ga0070712_100020142
256 Ga0075428_100330541
257 Ga0075428_100337765
258 Ga0075431_100128074
259 Ga0075429_100117373
260 Ga0075436_100008138
261 Ga0075435_100560533
262 Ga0105245_10025325
263 Ga0105242_10384587
264 Ga0105248_10208185
265 Ga0105248_10494404
266 Ga0105239_10126563
267 Ga0157375_10242635
268 Ga0163163_10201954
269 Ga0213873_10015016
270 Ga0213871_10004999
271 Ga0207692_10002424
272 Ga0207699_10321282
273 Ga0207699_10347520
274 Ga0207705_10037902
275 Ga0207707_10022656
276 Ga0207707_10466888
277 Ga0207693_10003722
278 Ga0207693_10014365
279 Ga0207652_10062743
280 Ga0207652_10097648
281 Ga0207652_10348767
282 Ga0207646_10025967
283 Ga0207646_10118877
284 Ga0207687_10220589
285 Ga0207664_10014151
286 Ga0207686_10211897
287 Ga0207686_10332912
288 Ga0207665_10002167
289 Ga0207661_10039119
290 Ga0207661_10068902
291 Ga0207712_10309705
292 Ga0207677_10236519
293 Ga0207677_10422150
294 Ga0207428_10002673
295 Ga0265334_10020430
296 Ga0265318_10018257
297 Ga0265336_10017112
298 Ga0265338_10001048
299 Ga0265338_10011458
300 Ga0265338_10196097
301 Ga0265324_10009630
302 Ga0265332_10012280
303 Ga0265339_10024939
304 Ga0265327_10048307
305 Ga0265327_10052676
306 Ga0265316_10151714
307 Ga0265313_10014857
308 Ga0265313_10146182
309 Ga0265342_10117861
310 Ga0307409_100045980
311 Ga0307416_100061765
312 Ga0373955_0204920
313 Ga0373942_0028164
314 Ga0373924_0038538
315 Ga0373931_0027126
316 Ga0373935_0044056
317 Ga0373937_0002550
318 Ga0373925_0095826
319 Ga0395899_0051158
320 Ga0395900_0023421
321 Ga0395900_0156269
322 Ga0395900_0179211
323 Ga0395900_0220646
324 Ga0395900_0224200
325 Ga0395898_0006202
326 Ga0395898_0173911
327 Ga0395898_0178181
328 Ga0395905_0130635
329 Ga0395905_0178902
330 Ga0395905_0560352
331 Ga0395901_0063775
332 Ga0395901_0558498
333 Ga0436360_0091142
334 Ga0436360_0542958
335 Ga0436360_0705341
336 Ga0436362_1288040
337 Ga0466972_0119067
338 Ga0466963_0004703
339 Ga0466964_0092909
340 Ga0451576_0173544
341 Ga0466958_0001692
342 Ga0466967_0017759
343 Ga0466967_0018103
344 Ga0466967_0133664
345 Ga0466967_0306933
346 Ga0495592_0000050
347 Ga0495603_0094976
348 Ga0495603_0195905
349 Ga0495641_0120660
350 Ga0495651_0000028
351 Ga0495653_0144094
352 Ga0495605_0100439
353 Ga0495608_0000555
354 Ga0495608_0039468
355 Ga0495618_0006266
356 Ga0495628_0000060
357 Ga0495628_0249803
358 Ga0495630_0038016
359 Ga0495652_0002771
360 Ga0495587_0000062
361 Ga0495645_0000418
362 Ga0495667_0023448
363 Ga0495667_0077489
364 Ga0495634_0155883
365 Ga0495634_0218168
366 Ga0495635_0017568
367 Ga0495657_0027728
368 Ga0495657_0068460
369 Ga0495657_0116241
370 Ga0495599_0000542
371 Ga0495623_0000435
372 Ga0495646_0021583
373 Ga0495647_0059079
374 Ga0495624_0022222
375 Ga0495604_0000262
376 Ga0495676_0048727
377 Ga0495680_0043695
378 Ga0495675_0000020
379 Ga0495684_0024085
380 Ga0495602_0000222
381 Ga0495602_0097063
382 Ga0496100_0030731
383 Ga0496101_0024496
384 Ga0496101_0112703
385 Ga0496101_0138900
386 Ga0496102_0138564
387 Ga0496102_0242417
388 Ga0496104_0177932
389 Ga0496104_0240041
390 Ga0496104_0351027
391 Ga0496104_0578519
392 Ga0496105_0010509
393 Ga0496107_0015841
394 Ga0496107_0069954
395 Ga0496108_0048022
396 Ga0496109_0002156
397 Ga0496109_0088820
398 Ga0496110_0028717
399 Ga0496110_0424118
400 Ga0496111_0001604
401 Ga0496111_0023069
402 Ga0496111_0113011
403 Ga0496112_0096236
404 Ga0496112_0122428
405 Ga0496112_0132922
406 Ga0496113_0042289
407 Ga0496113_0135273
408 Ga0496114_0045251
409 Ga0496114_0045903
410 Ga0496114_0053475
411 Ga0496115_0004001
412 Ga0496115_0060838
413 Ga0501041_0153495
414 Ga0501067_0033429
415 Ga0501069_0012341
416 Ga0501071_0281482
417 Ga0501076_0331129
418 Ga0501077_0076369
419 Ga0501079_0056456
420 Ga0501081_0168988
421 Ga0501035_0077014
422 Ga0501035_0207895
423 nmdc:mga05p37_221396_c1
424 nmdc:mga05p37_45364_c1
425 nmdc:mga09592_88252_c1
426 nmdc:mga06r32_123996_c1
427 nmdc:mga08y16_200767_c1
428 nmdc:mga0n895_155080_c1
429 nmdc:mga0rr50_8326_c1
430 nmdc:mga08x19_1333_c1
431 nmdc:mga0a205_2416_c1
432 Ga0495601_0000858
433 Ga0495601_0133758
434 Ga0495595_0032683
435 Ga0495619_0004654
436 Ga0495619_0018451
437 Ga0530510_0003874
438 Ga0530510_0097056

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02096

60KD_IMP

60Kd inner membrane protein

34

242

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wvf-assembly1.cif.gz_A crystal structure of yidc from escherichia coli 0.8235 11 212
3wvf-assembly2.cif.gz_B crystal structure of yidc from escherichia coli 0.7964 11 212
3wo6-assembly1.cif.gz_A crystal structure of yidc from bacillus halodurans (form i) 0.7946 2 213
6al2-assembly2.cif.gz_B crystal structure of e. coli yidc at 2.8 a resolution 0.7786 14 212
3wo6-assembly1.cif.gz_A crystal structure of yidc from bacillus halodurans (form i) 0.7746 2 213
ID Description Score Start End Superfamily
af_Q59W68_11_255_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.3251 101 216 1.20.144.10
af_P06795_677_1021_1.20.1560.10 Mainly Alpha;Up-down Bundle;ABC transporter transmembrane region fold;ABC transporter type 1, transmembrane domain 0.313 2 217 1.20.1560.10
af_Q0J9M8_43_369_1.20.1560.10 Mainly Alpha;Up-down Bundle;ABC transporter transmembrane region fold;ABC transporter type 1, transmembrane domain 0.3119 2 219 1.20.1560.10
af_A0A2R8Q2K8_118_304_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.2841 84 238 1.20.144.10
af_Q9VNU2_20_247_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.2794 46 238 1.20.144.10
ID Description Score Start End GO Terms
AF-A0A640YAA0-F1-model_v4 YidC/Oxa1 family membrane protein insertase 0.8894 11 221 GO:0016020
GO:0032977
AF-A0A7W0H5A6-F1-model_v4 Membrane protein insertase YidC (Foldase YidC) (Membrane integrase YidC) (Membrane protein YidC) 0.8839 6 219 GO:0016020
GO:0032977
GO:0051205
AF-A0A7V9J838-F1-model_v4 Membrane protein insertase YidC (Foldase YidC) (Membrane integrase YidC) (Membrane protein YidC) 0.8778 6 143 GO:0005886
GO:0032977
GO:0051205
AF-A0A382VAV3-F1-model_v4 Membrane protein insertase YidC (Foldase YidC) (Membrane integrase YidC) 0.877 9 142 GO:0005886
GO:0015031
GO:0032977
GO:0051205
AF-A0A538J6D9-F1-model_v4 Membrane protein insertase YidC (Foldase YidC) (Membrane integrase YidC) (Membrane protein YidC) 0.8767 3 227 GO:0005886
GO:0032977
GO:0051205

Map