F330946

General Info

Members Datasets Scaffolds Average Seq Length
219 87 438 265

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100004680|Ga0075428_10000468010
Length 264
Sequence VSATLPQLANDAVLDVRPDDQDAAIQVERWLQDYATSRDPQLREQIILAYLGTADRLASRYRHSRGTTPEDLTQTARAGLIAAVDRYDPDYGNPFVPYAVACVVGELKWHLRDTSWRLHVPRPLKEWALRLCRAADDLHQRLGRSPTVTELAECLDVGKDEVLEGLAAASSRQEVSLDQPVGDADLQLGDLLPAPGAKEEPEDLLALPGLVSVLPELERKVIVLRFFHDLDQYEIAARIGFSQMHVSRLQRRALARMRAQLVEP

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
4 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
7 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
8 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
9 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
10 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
11 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
12 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
13 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
14 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
15 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
16 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
17 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
18 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
19 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
20 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
21 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
22 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
23 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
24 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
25 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
26 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
27 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
28 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
29 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
30 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
31 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
32 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
33 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
34 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
35 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
36 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
37 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
38 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
39 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
40 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
41 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
42 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
43 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
44 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
45 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
46 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
47 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
48 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
49 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
50 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
51 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
52 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
53 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
54 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
55 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
56 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
57 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
58 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
59 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
60 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
61 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
62 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
63 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
64 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
65 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
66 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
67 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
68 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
69 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
70 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
71 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
72 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
75 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
76 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
77 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
78 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
79 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
80 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
81 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
82 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
83 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
84 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
85 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
86 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
87 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 11.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100004680 3300006844 Bacteria 15150
2 JGI25407J50210_10000844 3300003373 Bacteria 6592
3 JGI25407J50210_10006230 3300003373 Bacteria 2964
4 JGI25407J50210_10010467 3300003373 Bacteria 2361
5 JGI25407J50210_10021148 3300003373 Bacteria 1692
6 Ga0070698_100013550 3300005471 Bacteria 8632
7 Ga0081538_10000510 3300005981 Bacteria 43500
8 Ga0081538_10000590 3300005981 Bacteria 40274
9 Ga0081538_10000793 3300005981 Bacteria 34314
10 Ga0081538_10002823 3300005981 Bacteria 16619
11 Ga0081538_10003151 3300005981 Bacteria 15679
12 Ga0081538_10004982 3300005981 Bacteria 12098
13 Ga0081538_10006361 3300005981 Bacteria 10420
14 Ga0081538_10007130 3300005981 Bacteria 9710
15 Ga0081538_10009177 3300005981 Bacteria 8292
16 Ga0081538_10010061 3300005981 Bacteria 7797
17 Ga0081538_10012423 3300005981 Bacteria 6825
18 Ga0081538_10015278 3300005981 Bacteria 5953
19 Ga0081538_10016045 3300005981 Bacteria 5764
20 Ga0081538_10019247 3300005981 Bacteria 5083
21 Ga0081538_10020918 3300005981 Bacteria 4799
22 Ga0081538_10029842 3300005981 Bacteria 3716
23 Ga0081539_10002518 3300005985 Bacteria 25623
24 Ga0081539_10006897 3300005985 Bacteria 10593
25 Ga0075430_100035433 3300006846 Bacteria 4233
26 Ga0075430_100170357 3300006846 Unclassified 1811
27 Ga0075431_100181882 3300006847 Bacteria 2157
28 Ga0075429_100003640 3300006880 Bacteria 13128
29 Ga0114129_10010203 3300009147 Bacteria 13392
30 Ga0182008_10075154 3300014497 Bacteria 1662
31 Ga0182005_1035351 3300015265 Bacteria 1359
32 Ga0207428_10006711 3300027907 Bacteria 10568
33 Ga0307408_100039678 3300031548 Bacteria 3330
34 Ga0307408_100041028 3300031548 Bacteria 3280
35 Ga0307408_100099364 3300031548 Unclassified 2214
36 Ga0307405_10003633 3300031731 Bacteria 7136
37 Ga0307405_10006939 3300031731 Bacteria 5623
38 Ga0307405_10018828 3300031731 Bacteria 3818
39 Ga0307405_10023923 3300031731 Plasmid 3481
40 Ga0307405_10057670 3300031731 Unclassified 2440
41 Ga0307405_10125870 3300031731 Bacteria 1762
42 Ga0307405_10170686 3300031731 Bacteria 1551
43 Ga0307413_10027151 3300031824 Bacteria 3167
44 Ga0307413_10051339 3300031824 Bacteria 2484
45 Ga0307413_10129563 3300031824 Bacteria 1724
46 Ga0307413_10575929 3300031824 Unclassified 917
47 Ga0307410_10001344 3300031852 Bacteria 11023
48 Ga0307410_10017489 3300031852 Bacteria 4307
49 Ga0307410_10028938 3300031852 Bacteria 3521
50 Ga0307410_10055655 3300031852 Bacteria 2686
51 Ga0307410_10068800 3300031852 Unclassified 2446
52 Ga0307410_10130245 3300031852 Bacteria 1847
53 Ga0307410_10272079 3300031852 Bacteria 1325
54 Ga0307410_10381658 3300031852 Bacteria 1134
55 Ga0307406_10023219 3300031901 Plasmid 3687
56 Ga0307406_10025857 3300031901 Bacteria 3518
57 Ga0307406_10025886 3300031901 Bacteria 3516
58 Ga0307406_10075148 3300031901 Unclassified 2228
59 Ga0307406_10102630 3300031901 Bacteria 1951
60 Ga0307406_10153365 3300031901 Bacteria 1646
61 Ga0307406_10216227 3300031901 Bacteria 1421
62 Ga0307407_10003989 3300031903 Bacteria 6172
63 Ga0307407_10005073 3300031903 Bacteria 5677
64 Ga0307407_10031028 3300031903 Bacteria 2890
65 Ga0307407_10039067 3300031903 Bacteria 2636
66 Ga0307407_10086880 3300031903 Bacteria 1906
67 Ga0307407_10088768 3300031903 Bacteria 1889
68 Ga0307407_10093435 3300031903 Unclassified 1849
69 Ga0307407_10144499 3300031903 Bacteria 1538
70 Ga0307412_10058620 3300031911 Bacteria 2576
71 Ga0307412_10110306 3300031911 Bacteria 1963
72 Ga0307412_10212705 3300031911 Unclassified 1476
73 Ga0307412_10227076 3300031911 Bacteria 1435
74 Ga0307412_10265310 3300031911 Unclassified 1341
75 Ga0307412_10601400 3300031911 Unclassified 931
76 Ga0307409_100000169 3300031995 Bacteria 25439
77 Ga0307409_100002605 3300031995 Bacteria 9479
78 Ga0307409_100019222 3300031995 Bacteria 4619
79 Ga0307409_100024895 3300031995 Bacteria 4185
80 Ga0307409_100027182 3300031995 Bacteria 4050
81 Ga0307409_100073083 3300031995 Bacteria 2734
82 Ga0307409_100142003 3300031995 Bacteria 2070
83 Ga0307409_100184669 3300031995 Unclassified 1849
84 Ga0307409_100211234 3300031995 Bacteria 1744
85 Ga0307409_100216000 3300031995 Bacteria 1727
86 Ga0307409_100335948 3300031995 Bacteria 1419
87 Ga0307409_100533830 3300031995 Bacteria 1148
88 Ga0307409_100587510 3300031995 Bacteria 1099
89 Ga0307416_100002102 3300032002 Bacteria 11239
90 Ga0307416_100002953 3300032002 Bacteria 9912
91 Ga0307416_100013135 3300032002 Bacteria 5617
92 Ga0307416_100015190 3300032002 Bacteria 5306
93 Ga0307416_100034088 3300032002 Plasmid 3869
94 Ga0307416_100045738 3300032002 Bacteria 3448
95 Ga0307416_100054995 3300032002 Bacteria 3202
96 Ga0307416_100079438 3300032002 Bacteria 2764
97 Ga0307416_100101336 3300032002 Bacteria 2507
98 Ga0307416_100157826 3300032002 Bacteria 2091
99 Ga0307416_100190456 3300032002 Unclassified 1934
100 Ga0307416_100289592 3300032002 Bacteria 1620
101 Ga0307416_100404655 3300032002 Bacteria 1403
102 Ga0307416_100489684 3300032002 Bacteria 1291
103 Ga0307416_100580641 3300032002 Unclassified 1198
104 Ga0307416_100602449 3300032002 Bacteria 1178
105 Ga0307416_100654913 3300032002 Unclassified 1135
106 Ga0307414_10025990 3300032004 Bacteria 3761
107 Ga0307414_10067503 3300032004 Bacteria 2562
108 Ga0307414_10126833 3300032004 Bacteria 1973
109 Ga0307414_10179756 3300032004 Unclassified 1700
110 Ga0307414_10228651 3300032004 Bacteria 1532
111 Ga0307414_10279888 3300032004 Bacteria 1401
112 Ga0307414_10869039 3300032004 Unclassified 825
113 Ga0307411_10038275 3300032005 Bacteria 3024
114 Ga0307411_10041260 3300032005 Bacteria 2934
115 Ga0307411_10044433 3300032005 Bacteria 2850
116 Ga0307411_10101249 3300032005 Unclassified 2038
117 Ga0307411_10491639 3300032005 Bacteria 1035
118 Ga0307411_10647375 3300032005 Bacteria 914
119 Ga0307415_100000774 3300032126 Bacteria 14458
120 Ga0307415_100001397 3300032126 Bacteria 11518
121 Ga0307415_100017905 3300032126 Bacteria 4261
122 Ga0307415_100025048 3300032126 Bacteria 3738
123 Ga0307415_100036256 3300032126 Bacteria 3230
124 Ga0307415_100047680 3300032126 Unclassified 2885
125 Ga0307415_100059696 3300032126 Bacteria 2631
126 Ga0307415_100068803 3300032126 Bacteria 2479
127 Ga0307415_100111552 3300032126 Unclassified 2030
128 Ga0307415_100113847 3300032126 Unclassified 2012
129 Ga0307415_100138913 3300032126 Bacteria 1852
130 Ga0307415_100193964 3300032126 Unclassified 1605
131 Ga0307415_100206403 3300032126 Bacteria 1563
132 Ga0307415_100243769 3300032126 Bacteria 1455
133 Ga0307415_100275425 3300032126 Bacteria 1381
134 Ga0307415_100337621 3300032126 Bacteria 1263
135 Ga0395899_0360602 3300037312 Bacteria 970
136 Ga0395900_0022090 3300037418 Bacteria 6509
137 Ga0395900_0093845 3300037418 Bacteria 3082
138 Ga0395900_0303083 3300037418 Bacteria 1583
139 Ga0395898_0015093 3300037466 Bacteria 7929
140 Ga0395898_0046758 3300037466 Bacteria 4250
141 Ga0395898_0082896 3300037466 Bacteria 3091
142 Ga0395898_0401275 3300037466 Bacteria 1307
143 Ga0395905_0061194 3300037471 Bacteria 3521
144 Ga0395905_0326170 3300037471 Bacteria 1425
145 Ga0395901_0010990 3300038443 Bacteria 9174
146 Ga0395901_0043456 3300038443 Bacteria 4661
147 Ga0395901_0053847 3300038443 Bacteria 4181
148 Ga0395901_0056268 3300038443 Bacteria 4091
149 Ga0395901_0277040 3300038443 Bacteria 1744
150 Ga0395901_0463238 3300038443 Bacteria 1295
151 Ga0439443_003741 3300042003 Bacteria 1942
152 Ga0439448_0001456 3300042005 Bacteria 6136
153 Ga0439448_0031161 3300042005 Bacteria 1693
154 Ga0439448_0045214 3300042005 Unclassified 1433
155 Ga0439450_000004 3300042008 Bacteria 26188
156 Ga0439450_000119 3300042008 Bacteria 8286
157 Ga0439451_026030 3300042009 Bacteria 1179
158 Ga0439454_018729 3300042011 Bacteria 1000
159 Ga0439455_0001602 3300042012 Bacteria 3853
160 Ga0439463_000380 3300042016 Bacteria 12226
161 Ga0450913_000169 3300042117 Bacteria 2145
162 Ga0450914_002582 3300042118 Bacteria 1307
163 Ga0450922_009134 3300042124 Bacteria 941
164 Ga0450900_000357 3300042136 Bacteria 3415
165 Ga0450902_030600 3300042137 Bacteria 905
166 Ga0450905_003876 3300042142 Unclassified 1969
167 Ga0450905_021504 3300042142 Bacteria 954
168 Ga0439444_0002644 3300042437 Bacteria 2468
169 Ga0439464_0000109 3300042439 Bacteria 12582
170 Ga0439464_0015089 3300042439 Bacteria 2083
171 Ga0439464_0115064 3300042439 Bacteria 825
172 Ga0439460_0000112 3300042461 Bacteria 13977
173 Ga0439460_0027006 3300042461 Unclassified 1610
174 Ga0439460_0084744 3300042461 Bacteria 999
175 Ga0450916_005813 3300042530 Bacteria 1437
176 Ga0439440_0000031 3300042993 Bacteria 17654
177 Ga0439440_0004196 3300042993 Bacteria 2823
178 Ga0501031_0056390 3300049568 Bacteria 2559
179 Ga0501033_0014525 3300049570 Bacteria 5978
180 Ga0501036_0001265 3300049572 Bacteria 19361
181 Ga0501037_0004654 3300049573 Bacteria 9967
182 Ga0501038_0003770 3300049574 Bacteria 14105
183 Ga0501039_0000197 3300049575 Bacteria 43481
184 Ga0501040_0013023 3300049576 Bacteria 5468
185 Ga0501041_0000386 3300049577 Bacteria 22096
186 Ga0501042_0000047 3300049578 Bacteria 41013
187 Ga0501043_0014330 3300049579 Bacteria 6204
188 Ga0501046_0004211 3300049580 Bacteria 13106
189 Ga0501048_0000421 3300049582 Bacteria 29745
190 Ga0501068_0057458 3300049584 Bacteria 2359
191 Ga0501070_0166051 3300049586 Bacteria 1819
192 Ga0501071_0000182 3300049587 Bacteria 27901
193 Ga0501072_0000195 3300049588 Bacteria 44197
194 Ga0501074_0005153 3300049590 Bacteria 9392
195 Ga0501075_0001875 3300049591 Bacteria 13871
196 Ga0501076_0000217 3300049592 Bacteria 34870
197 Ga0501077_0000722 3300049593 Bacteria 19993
198 Ga0501079_0000200 3300049741 Bacteria 34694
199 Ga0501080_0126671 3300049742 Bacteria 2365
200 Ga0501081_0017575 3300049743 Bacteria 4737
201 Ga0501083_0071188 3300049744 Bacteria 2312
202 Ga0501035_0006620 3300049822 Bacteria 10847
203 Ga0501044_0196469 3300049823 Bacteria 1977
204 Ga0501045_0002185 3300049824 Bacteria 13258
205 nmdc:mga05p37_277403_c1 3300050507 Bacteria 2001
206 nmdc:mga05p37_326675_c1 3300050507 Bacteria 1814
207 nmdc:mga09592_4681_c1 3300050508 Bacteria 11070
208 nmdc:mga0qj67_177420_c1 3300050509 Unclassified 1730
209 nmdc:mga06r32_216581_c1 3300050510 Bacteria 1903
210 nmdc:mga06r32_31265_c1 3300050510 Bacteria 4998
211 nmdc:mga08y16_48603_c1 3300050511 Bacteria 4440
212 nmdc:mga0n895_80159_c1 3300050512 Bacteria 3252
213 nmdc:mga0a205_3053_c1 3300050515 Bacteria 14849
214 Ga0501084_0001592 3300054114 Bacteria 17976
215 Ga0590074_007260 3300059423 Bacteria 1841
216 Ga0590075_003739 3300059424 Bacteria 3610
217 Ga0590077_004324 3300059426 Bacteria 2919
218 Ga0501082_0002495 3300060353 Bacteria 16119
219 Ga0530510_0001379 3300061734 Bacteria 16278
220 Ga0075428_100004680
221 JGI25407J50210_10000844
222 JGI25407J50210_10006230
223 JGI25407J50210_10010467
224 JGI25407J50210_10021148
225 Ga0070698_100013550
226 Ga0081538_10000510
227 Ga0081538_10000590
228 Ga0081538_10000793
229 Ga0081538_10002823
230 Ga0081538_10003151
231 Ga0081538_10004982
232 Ga0081538_10006361
233 Ga0081538_10007130
234 Ga0081538_10009177
235 Ga0081538_10010061
236 Ga0081538_10012423
237 Ga0081538_10015278
238 Ga0081538_10016045
239 Ga0081538_10019247
240 Ga0081538_10020918
241 Ga0081538_10029842
242 Ga0081539_10002518
243 Ga0081539_10006897
244 Ga0075430_100035433
245 Ga0075430_100170357
246 Ga0075431_100181882
247 Ga0075429_100003640
248 Ga0114129_10010203
249 Ga0182008_10075154
250 Ga0182005_1035351
251 Ga0207428_10006711
252 Ga0307408_100039678
253 Ga0307408_100041028
254 Ga0307408_100099364
255 Ga0307405_10003633
256 Ga0307405_10006939
257 Ga0307405_10018828
258 Ga0307405_10023923
259 Ga0307405_10057670
260 Ga0307405_10125870
261 Ga0307405_10170686
262 Ga0307413_10027151
263 Ga0307413_10051339
264 Ga0307413_10129563
265 Ga0307413_10575929
266 Ga0307410_10001344
267 Ga0307410_10017489
268 Ga0307410_10028938
269 Ga0307410_10055655
270 Ga0307410_10068800
271 Ga0307410_10130245
272 Ga0307410_10272079
273 Ga0307410_10381658
274 Ga0307406_10023219
275 Ga0307406_10025857
276 Ga0307406_10025886
277 Ga0307406_10075148
278 Ga0307406_10102630
279 Ga0307406_10153365
280 Ga0307406_10216227
281 Ga0307407_10003989
282 Ga0307407_10005073
283 Ga0307407_10031028
284 Ga0307407_10039067
285 Ga0307407_10086880
286 Ga0307407_10088768
287 Ga0307407_10093435
288 Ga0307407_10144499
289 Ga0307412_10058620
290 Ga0307412_10110306
291 Ga0307412_10212705
292 Ga0307412_10227076
293 Ga0307412_10265310
294 Ga0307412_10601400
295 Ga0307409_100000169
296 Ga0307409_100002605
297 Ga0307409_100019222
298 Ga0307409_100024895
299 Ga0307409_100027182
300 Ga0307409_100073083
301 Ga0307409_100142003
302 Ga0307409_100184669
303 Ga0307409_100211234
304 Ga0307409_100216000
305 Ga0307409_100335948
306 Ga0307409_100533830
307 Ga0307409_100587510
308 Ga0307416_100002102
309 Ga0307416_100002953
310 Ga0307416_100013135
311 Ga0307416_100015190
312 Ga0307416_100034088
313 Ga0307416_100045738
314 Ga0307416_100054995
315 Ga0307416_100079438
316 Ga0307416_100101336
317 Ga0307416_100157826
318 Ga0307416_100190456
319 Ga0307416_100289592
320 Ga0307416_100404655
321 Ga0307416_100489684
322 Ga0307416_100580641
323 Ga0307416_100602449
324 Ga0307416_100654913
325 Ga0307414_10025990
326 Ga0307414_10067503
327 Ga0307414_10126833
328 Ga0307414_10179756
329 Ga0307414_10228651
330 Ga0307414_10279888
331 Ga0307414_10869039
332 Ga0307411_10038275
333 Ga0307411_10041260
334 Ga0307411_10044433
335 Ga0307411_10101249
336 Ga0307411_10491639
337 Ga0307411_10647375
338 Ga0307415_100000774
339 Ga0307415_100001397
340 Ga0307415_100017905
341 Ga0307415_100025048
342 Ga0307415_100036256
343 Ga0307415_100047680
344 Ga0307415_100059696
345 Ga0307415_100068803
346 Ga0307415_100111552
347 Ga0307415_100113847
348 Ga0307415_100138913
349 Ga0307415_100193964
350 Ga0307415_100206403
351 Ga0307415_100243769
352 Ga0307415_100275425
353 Ga0307415_100337621
354 Ga0395899_0360602
355 Ga0395900_0022090
356 Ga0395900_0093845
357 Ga0395900_0303083
358 Ga0395898_0015093
359 Ga0395898_0046758
360 Ga0395898_0082896
361 Ga0395898_0401275
362 Ga0395905_0061194
363 Ga0395905_0326170
364 Ga0395901_0010990
365 Ga0395901_0043456
366 Ga0395901_0053847
367 Ga0395901_0056268
368 Ga0395901_0277040
369 Ga0395901_0463238
370 Ga0439443_003741
371 Ga0439448_0001456
372 Ga0439448_0031161
373 Ga0439448_0045214
374 Ga0439450_000004
375 Ga0439450_000119
376 Ga0439451_026030
377 Ga0439454_018729
378 Ga0439455_0001602
379 Ga0439463_000380
380 Ga0450913_000169
381 Ga0450914_002582
382 Ga0450922_009134
383 Ga0450900_000357
384 Ga0450902_030600
385 Ga0450905_003876
386 Ga0450905_021504
387 Ga0439444_0002644
388 Ga0439464_0000109
389 Ga0439464_0015089
390 Ga0439464_0115064
391 Ga0439460_0000112
392 Ga0439460_0027006
393 Ga0439460_0084744
394 Ga0450916_005813
395 Ga0439440_0000031
396 Ga0439440_0004196
397 Ga0501031_0056390
398 Ga0501033_0014525
399 Ga0501036_0001265
400 Ga0501037_0004654
401 Ga0501038_0003770
402 Ga0501039_0000197
403 Ga0501040_0013023
404 Ga0501041_0000386
405 Ga0501042_0000047
406 Ga0501043_0014330
407 Ga0501046_0004211
408 Ga0501048_0000421
409 Ga0501068_0057458
410 Ga0501070_0166051
411 Ga0501071_0000182
412 Ga0501072_0000195
413 Ga0501074_0005153
414 Ga0501075_0001875
415 Ga0501076_0000217
416 Ga0501077_0000722
417 Ga0501079_0000200
418 Ga0501080_0126671
419 Ga0501081_0017575
420 Ga0501083_0071188
421 Ga0501035_0006620
422 Ga0501044_0196469
423 Ga0501045_0002185
424 nmdc:mga05p37_277403_c1
425 nmdc:mga05p37_326675_c1
426 nmdc:mga09592_4681_c1
427 nmdc:mga0qj67_177420_c1
428 nmdc:mga06r32_216581_c1
429 nmdc:mga06r32_31265_c1
430 nmdc:mga08y16_48603_c1
431 nmdc:mga0n895_80159_c1
432 nmdc:mga0a205_3053_c1
433 Ga0501084_0001592
434 Ga0590074_007260
435 Ga0590075_003739
436 Ga0590077_004324
437 Ga0501082_0002495
438 Ga0530510_0001379

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04545

Sigma70_r4

Sigma-70, region 4

210

259

0.96

PF04542

Sigma70_r2

Sigma-70 region 2

46

117

0.92

PF08281

Sigma70_r4_2

Sigma-70, region 4

204

257

0.92

PF04539

Sigma70_r3

Sigma-70 region 3

126

204

0.89

Map