F330529

General Info

Members Datasets Scaffolds Average Seq Length
218 160 436 384

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2751185734|2753073025
Length 437
Sequence NEVFGADVVRRGWGCQLGVGELTRKSELARAREFGLPPAIRSLPEAVIAEVSALTVPFFTQSATFSELWPMMRGHIVEVVENGKFSHGRKVLELEGALAAYTGAAHVIGVNSGTDALVLLLRACGLRTGDEVVVPAFSFIASASSVVLAGGRPVFADVEPDGYGLDPGSVAAVAGPRTRFVMPVHLFHHLADMTGLGEVARRLGLTVVEDSAEAIGMRYDGVHAGLLGAGGVLSFFPTKTLGALGDAGAVVTNDPDVAEAVSALRHHGRFGRTIDNFPGIATTTDLVGVNSKMDDVQAAVLLAKLGRLEADIRRRAVLAGRYAEALAGVPGVRKLPSVVTRRGSVRGVFYVYVVEVDRRDELAAHLAGLGVGTETYYPVPLHLQPCFADLGHRPGDFPHAEAACRRTLALPLYPDLPLRDVDRVCDAIRSFYLGRRA

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
79 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
83 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
84 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
85 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
86 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
87 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
88 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
89 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
90 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
91 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
92 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
93 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
94 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
95 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
96 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
97 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
98 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
102 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
103 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
104 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
105 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
107 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
111 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
112 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
113 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
114 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
115 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
116 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
117 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
118 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
123 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
124 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
125 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
126 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
127 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
130 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
131 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
140 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
141 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
143 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
146 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
147 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
150 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
151 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
152 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
153 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
154 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
155 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
156 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
157 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
158 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
159 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
160 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.41
Metatranscriptomes 0.46
Isolates 4.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.75
Nodule 0.46
Rhizoplane 1.38
Rhizosphere 89.91
Stem 0
Stem Tuber 0
Unclassified 3.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10008895 3300005290 Bacteria 2956
2 Ga0070676_10025933 3300005328 Bacteria 3317
3 Ga0070683_100113526 3300005329 Bacteria 2557
4 Ga0070690_100230025 3300005330 Bacteria 1303
5 Ga0070670_100049686 3300005331 Bacteria 3606
6 Ga0070670_100252404 3300005331 Bacteria 1537
7 Ga0068869_100130918 3300005334 Bacteria 1928
8 Ga0070666_10045508 3300005335 Bacteria 2942
9 Ga0070661_100040132 3300005344 Bacteria 3413
10 Ga0070659_100009543 3300005366 Bacteria 7132
11 Ga0070667_100064319 3300005367 Bacteria 3112
12 Ga0070709_10040259 3300005434 Bacteria 2872
13 Ga0070714_100078797 3300005435 Bacteria 2864
14 Ga0070713_100160814 3300005436 Unclassified 2004
15 Ga0070701_10015483 3300005438 Bacteria 3524
16 Ga0070708_100012114 3300005445 Bacteria 7029
17 Ga0068867_100124075 3300005459 Bacteria 1999
18 Ga0070685_10002179 3300005466 Bacteria 10113
19 Ga0070707_100136462 3300005468 Bacteria 2387
20 Ga0070707_100251382 3300005468 Bacteria 1720
21 Ga0070698_100022609 3300005471 Bacteria 6576
22 Ga0070699_100187407 3300005518 Bacteria 1837
23 Ga0070699_100284455 3300005518 Bacteria 1481
24 Ga0070679_100018473 3300005530 Bacteria 6766
25 Ga0070697_100078599 3300005536 Bacteria 2715
26 Ga0070697_100084100 3300005536 Bacteria 2624
27 Ga0068853_100021001 3300005539 Bacteria 5435
28 Ga0070672_100008865 3300005543 Bacteria 6909
29 Ga0070665_100002320 3300005548 Bacteria 21133
30 Ga0070665_100025472 3300005548 Bacteria 5959
31 Ga0068855_100020681 3300005563 Bacteria 7892
32 Ga0068857_100168551 3300005577 Bacteria 1990
33 Ga0068859_100016473 3300005617 Bacteria 7424
34 Ga0068860_100393435 3300005843 Bacteria 1370
35 Ga0081539_10002862 3300005985 Bacteria 22944
36 Ga0075368_10052872 3300006042 Bacteria 1616
37 Ga0075362_10012456 3300006177 Bacteria 3379
38 Ga0075367_10009935 3300006178 Bacteria 4986
39 Ga0075369_10013062 3300006186 Bacteria 3288
40 Ga0075428_100000009 3300006844 Bacteria 266370
41 Ga0075428_100022772 3300006844 Bacteria 6932
42 Ga0075428_100172311 3300006844 Bacteria 2345
43 Ga0075430_100001803 3300006846 Bacteria 17516
44 Ga0075430_100007184 3300006846 Bacteria 9395
45 Ga0075430_100017583 3300006846 Bacteria 6088
46 Ga0075430_100024565 3300006846 Bacteria 5126
47 Ga0075431_100042382 3300006847 Bacteria 4694
48 Ga0075431_100090782 3300006847 Bacteria 3153
49 Ga0075429_100004907 3300006880 Bacteria 11526
50 Ga0075429_100027090 3300006880 Bacteria 4976
51 Ga0075429_100054362 3300006880 Bacteria 3482
52 Ga0075429_100129529 3300006880 Bacteria 2207
53 Ga0097620_100016473 3300006931 Bacteria 7424
54 Ga0075435_100066152 3300007076 Bacteria 2940
55 Ga0105240_10113486 3300009093 Bacteria 3274
56 Ga0111539_10000010 3300009094 Bacteria 366246
57 Ga0111539_10000223 3300009094 Bacteria 68170
58 Ga0111539_10000479 3300009094 Bacteria 50473
59 Ga0111539_10002007 3300009094 Bacteria 27162
60 Ga0114129_10012709 3300009147 Bacteria 11984
61 Ga0114129_10026888 3300009147 Bacteria 8145
62 Ga0114129_10041771 3300009147 Bacteria 6457
63 Ga0114129_10339517 3300009147 Bacteria 1993
64 Ga0114129_10607707 3300009147 Bacteria 1416
65 Ga0105243_10005626 3300009148 Bacteria 9755
66 Ga0105241_10009060 3300009174 Bacteria 7318
67 Ga0105241_10137067 3300009174 Bacteria 1988
68 Ga0105248_10015070 3300009177 Bacteria 8513
69 Ga0105238_10129471 3300009551 Bacteria 2502
70 Ga0105238_10206291 3300009551 Bacteria 1941
71 Ga0105249_10315188 3300009553 Bacteria 1574
72 Ga0105239_10150705 3300010375 Bacteria 2595
73 Ga0157373_10006388 3300013100 Bacteria 8807
74 Ga0157369_10016483 3300013105 Bacteria 8310
75 Ga0157369_10127818 3300013105 Unclassified 2693
76 Ga0157374_10178111 3300013296 Bacteria 2076
77 Ga0157378_10006151 3300013297 Bacteria 10512
78 Ga0157372_10016431 3300013307 Bacteria 7941
79 Ga0157375_10047310 3300013308 Bacteria 4200
80 Ga0157380_10032478 3300014326 Bacteria 4016
81 Ga0157380_10054293 3300014326 Bacteria 3179
82 Ga0207697_10004316 3300025315 Bacteria 6812
83 Ga0207680_10057961 3300025903 Bacteria 2346
84 Ga0207685_10007865 3300025905 Bacteria 3001
85 Ga0207699_10168187 3300025906 Bacteria 1465
86 Ga0207705_10001023 3300025909 Bacteria 22693
87 Ga0207693_10008916 3300025915 Bacteria 8191
88 Ga0207652_10103652 3300025921 Bacteria 2515
89 Ga0207646_10041183 3300025922 Bacteria 4154
90 Ga0207694_10033166 3300025924 Bacteria 3956
91 Ga0207650_10025057 3300025925 Bacteria 4248
92 Ga0207664_10060124 3300025929 Bacteria 3028
93 Ga0207665_10002652 3300025939 Bacteria 12020
94 Ga0207689_10144642 3300025942 Bacteria 1959
95 Ga0207667_10321198 3300025949 Unclassified 1581
96 Ga0207651_10018260 3300025960 Bacteria 4168
97 Ga0207639_10072843 3300026041 Bacteria 2691
98 Ga0207683_10020701 3300026121 Bacteria 5627
99 Ga0207698_10093105 3300026142 Unclassified 2473
100 Ga0207428_10000034 3300027907 Bacteria 231306
101 Ga0207428_10000049 3300027907 Bacteria 179267
102 Ga0207428_10000386 3300027907 Bacteria 55130
103 Ga0207428_10004710 3300027907 Bacteria 12903
104 Ga0207428_10017851 3300027907 Bacteria 6081
105 Ga0265354_1000174 3300028016 Bacteria 11911
106 Ga0268266_10028178 3300028379 Bacteria 4775
107 Ga0265319_1000462 3300028563 Bacteria 28799
108 Ga0265318_10000573 3300028577 Bacteria 25932
109 Ga0265338_10042566 3300028800 Bacteria 4227
110 Ga0265770_1004529 3300030878 Unclassified 1898
111 Ga0265330_10000130 3300031235 Bacteria 60078
112 Ga0265332_10000338 3300031238 Bacteria 35493
113 Ga0265328_10007217 3300031239 Bacteria 4647
114 Ga0265320_10001023 3300031240 Bacteria 20844
115 Ga0265325_10006067 3300031241 Bacteria 7392
116 Ga0265325_10030744 3300031241 Bacteria 2878
117 Ga0265329_10000121 3300031242 Bacteria 36998
118 Ga0265340_10005477 3300031247 Bacteria 7046
119 Ga0265339_10001091 3300031249 Bacteria 20585
120 Ga0265331_10000764 3300031250 Bacteria 26866
121 Ga0265316_10007873 3300031344 Bacteria 9973
122 Ga0307513_10018852 3300031456 Bacteria 8232
123 Ga0265313_10000128 3300031595 Bacteria 76766
124 Ga0307508_10065144 3300031616 Bacteria 3211
125 Ga0265314_10001019 3300031711 Bacteria 32654
126 Ga0265342_10000737 3300031712 Bacteria 33604
127 Ga0307413_10115274 3300031824 Bacteria 1808
128 Ga0307518_10003022 3300031838 Bacteria 12173
129 Ga0307409_100288042 3300031995 Bacteria 1522
130 Ga0307415_100146000 3300032126 Bacteria 1814
131 Ga0316583_10004479 3300032133 Bacteria 4985
132 Ga0373936_0087632 3300035113 Bacteria 1302
133 Ga0373939_0064245 3300035114 Unclassified 1178
134 Ga0373946_0031371 3300035171 Bacteria 2128
135 Ga0373935_0020742 3300035692 Bacteria 4018
136 Ga0373935_0036670 3300035692 Bacteria 3067
137 Ga0373947_0000039 3300035725 Bacteria 63474
138 Ga0373947_0008594 3300035725 Bacteria 5880
139 Ga0316582_0035611 3300036647 Bacteria 3075
140 Ga0316582_0238926 3300036647 Bacteria 1244
141 Ga0316582_0261263 3300036647 Bacteria 1187
142 Ga0373925_0103945 3300037068 Bacteria 2187
143 Ga0395905_0020278 3300037471 Bacteria 6299
144 Ga0395905_0033198 3300037471 Bacteria 4848
145 Ga0436364_0048729 3300037853 Bacteria 13211
146 Ga0436364_0500314 3300037853 Bacteria 1272
147 Ga0400489_67483 3300039093 Unclassified 2118
148 Ga0436363_0575845 3300039450 Bacteria 7523
149 Ga0451807_2026360 3300041486 Bacteria 1488
150 Ga0450920_015090 3300042122 Bacteria 1467
151 Ga0439434_0010883 3300042435 Bacteria 2686
152 Ga0451577_0000033 3300042876 Bacteria 378714
153 Ga0453683_0000769 3300044673 Bacteria 31853
154 Ga0453684_0000109 3300044712 Bacteria 361015
155 Ga0453684_0056606 3300044712 Bacteria 5085
156 Ga0453684_0125237 3300044712 Bacteria 3094
157 Ga0451576_0032200 3300045051 Bacteria 5587
158 Ga0451576_0404406 3300045051 Bacteria 1431
159 Ga0495594_0000429 3300046499 Bacteria 21145
160 Ga0495625_0028973 3300046660 Bacteria 4145
161 Ga0495588_0028546 3300046674 Bacteria 2793
162 Ga0495623_0036218 3300046679 Bacteria 3162
163 Ga0495613_0001183 3300046689 Bacteria 19930
164 Ga0495636_0001098 3300047318 Bacteria 10166
165 Ga0495687_000659 3300047443 Bacteria 39619
166 Ga0495685_006585 3300047447 Bacteria 3809
167 Ga0496109_0209169 3300048912 Bacteria 1835
168 Ga0496115_0021308 3300048918 Bacteria 5006
169 Ga0496126_0114770 3300048929 Bacteria 2343
170 Ga0501032_0005837 3300049569 Bacteria 9105
171 Ga0501032_0017904 3300049569 Bacteria 4971
172 Ga0501033_0019207 3300049570 Bacteria 5167
173 Ga0501033_0046795 3300049570 Bacteria 3216
174 Ga0501033_0066724 3300049570 Bacteria 2646
175 Ga0501036_0005654 3300049572 Bacteria 10145
176 Ga0501036_0033661 3300049572 Bacteria 4333
177 Ga0501036_0194630 3300049572 Bacteria 1706
178 Ga0501037_0007430 3300049573 Bacteria 8012
179 Ga0501037_0076108 3300049573 Bacteria 2437
180 Ga0501039_0051246 3300049575 Bacteria 3194
181 Ga0501042_0015459 3300049578 Bacteria 5227
182 Ga0501046_0031700 3300049580 Bacteria 4282
183 Ga0501048_0008160 3300049582 Bacteria 7921
184 Ga0501070_0028362 3300049586 Bacteria 4695
185 Ga0501072_0113170 3300049588 Bacteria 2161
186 Ga0501035_0004218 3300049822 Bacteria 13660
187 Ga0501035_0039983 3300049822 Bacteria 4240
188 Ga0501035_0267375 3300049822 Bacteria 1448
189 Ga0501044_0007411 3300049823 Bacteria 12066
190 Ga0501044_0021463 3300049823 Bacteria 6887
191 Ga0501044_0038951 3300049823 Bacteria 4962
192 nmdc:mga03683_13332_c1 3300050489 Bacteria 3023
193 nmdc:mga05p37_255997_c1 3300050507 Bacteria 2098
194 nmdc:mga05p37_29310_c1 3300050507 Bacteria 6717
195 nmdc:mga05p37_47177_c1 3300050507 Bacteria 5298
196 nmdc:mga09592_13830_c1 3300050508 Bacteria 6594
197 nmdc:mga09592_5941_c1 3300050508 Bacteria 9949
198 nmdc:mga09592_65426_c1 3300050508 Bacteria 3080
199 nmdc:mga0qj67_132546_c1 3300050509 Bacteria 2019
200 nmdc:mga0qj67_47439_c1 3300050509 Bacteria 3394
201 nmdc:mga0qj67_6655_c1 3300050509 Bacteria 8490
202 nmdc:mga06r32_122808_c1 3300050510 Bacteria 2563
203 nmdc:mga08y16_1098_c1 3300050511 Bacteria 26638
204 nmdc:mga08y16_10_c1 3300050511 Bacteria 470512
205 nmdc:mga08y16_3194_c1 3300050511 Bacteria 16958
206 nmdc:mga0rr50_139326_c1 3300050513 Unclassified 1950
207 Ga0500645_003299 3300053730 Bacteria 6642
208 Ga0466962_0020011 3300061719 Bacteria 3217
209 Ga0466962_0022054 3300061719 Bacteria 3059
210 2753073025 2751185734 Bacteria 8863695
211 2586059771 2585427649 Bacteria 9053857
212 2753460513 2751185821 Bacteria 6189929
213 2812361243 2811994879 Bacteria 9313447
214 2819741793 2818991472 Bacteria 10089953
215 2838666709 2838661181 Bacteria 7385261
216 2870723668 2870721527 Bacteria 9689237
217 2912727334 2912723979 Bacteria 8557534
218 8047714503 8047710418 Bacteria 11023148
219 Ga0065712_10008895
220 Ga0070676_10025933
221 Ga0070683_100113526
222 Ga0070690_100230025
223 Ga0070670_100049686
224 Ga0070670_100252404
225 Ga0068869_100130918
226 Ga0070666_10045508
227 Ga0070661_100040132
228 Ga0070659_100009543
229 Ga0070667_100064319
230 Ga0070709_10040259
231 Ga0070714_100078797
232 Ga0070713_100160814
233 Ga0070701_10015483
234 Ga0070708_100012114
235 Ga0068867_100124075
236 Ga0070685_10002179
237 Ga0070707_100136462
238 Ga0070707_100251382
239 Ga0070698_100022609
240 Ga0070699_100187407
241 Ga0070699_100284455
242 Ga0070679_100018473
243 Ga0070697_100078599
244 Ga0070697_100084100
245 Ga0068853_100021001
246 Ga0070672_100008865
247 Ga0070665_100002320
248 Ga0070665_100025472
249 Ga0068855_100020681
250 Ga0068857_100168551
251 Ga0068859_100016473
252 Ga0068860_100393435
253 Ga0081539_10002862
254 Ga0075368_10052872
255 Ga0075362_10012456
256 Ga0075367_10009935
257 Ga0075369_10013062
258 Ga0075428_100000009
259 Ga0075428_100022772
260 Ga0075428_100172311
261 Ga0075430_100001803
262 Ga0075430_100007184
263 Ga0075430_100017583
264 Ga0075430_100024565
265 Ga0075431_100042382
266 Ga0075431_100090782
267 Ga0075429_100004907
268 Ga0075429_100027090
269 Ga0075429_100054362
270 Ga0075429_100129529
271 Ga0097620_100016473
272 Ga0075435_100066152
273 Ga0105240_10113486
274 Ga0111539_10000010
275 Ga0111539_10000223
276 Ga0111539_10000479
277 Ga0111539_10002007
278 Ga0114129_10012709
279 Ga0114129_10026888
280 Ga0114129_10041771
281 Ga0114129_10339517
282 Ga0114129_10607707
283 Ga0105243_10005626
284 Ga0105241_10009060
285 Ga0105241_10137067
286 Ga0105248_10015070
287 Ga0105238_10129471
288 Ga0105238_10206291
289 Ga0105249_10315188
290 Ga0105239_10150705
291 Ga0157373_10006388
292 Ga0157369_10016483
293 Ga0157369_10127818
294 Ga0157374_10178111
295 Ga0157378_10006151
296 Ga0157372_10016431
297 Ga0157375_10047310
298 Ga0157380_10032478
299 Ga0157380_10054293
300 Ga0207697_10004316
301 Ga0207680_10057961
302 Ga0207685_10007865
303 Ga0207699_10168187
304 Ga0207705_10001023
305 Ga0207693_10008916
306 Ga0207652_10103652
307 Ga0207646_10041183
308 Ga0207694_10033166
309 Ga0207650_10025057
310 Ga0207664_10060124
311 Ga0207665_10002652
312 Ga0207689_10144642
313 Ga0207667_10321198
314 Ga0207651_10018260
315 Ga0207639_10072843
316 Ga0207683_10020701
317 Ga0207698_10093105
318 Ga0207428_10000034
319 Ga0207428_10000049
320 Ga0207428_10000386
321 Ga0207428_10004710
322 Ga0207428_10017851
323 Ga0265354_1000174
324 Ga0268266_10028178
325 Ga0265319_1000462
326 Ga0265318_10000573
327 Ga0265338_10042566
328 Ga0265770_1004529
329 Ga0265330_10000130
330 Ga0265332_10000338
331 Ga0265328_10007217
332 Ga0265320_10001023
333 Ga0265325_10006067
334 Ga0265325_10030744
335 Ga0265329_10000121
336 Ga0265340_10005477
337 Ga0265339_10001091
338 Ga0265331_10000764
339 Ga0265316_10007873
340 Ga0307513_10018852
341 Ga0265313_10000128
342 Ga0307508_10065144
343 Ga0265314_10001019
344 Ga0265342_10000737
345 Ga0307413_10115274
346 Ga0307518_10003022
347 Ga0307409_100288042
348 Ga0307415_100146000
349 Ga0316583_10004479
350 Ga0373936_0087632
351 Ga0373939_0064245
352 Ga0373946_0031371
353 Ga0373935_0020742
354 Ga0373935_0036670
355 Ga0373947_0000039
356 Ga0373947_0008594
357 Ga0316582_0035611
358 Ga0316582_0238926
359 Ga0316582_0261263
360 Ga0373925_0103945
361 Ga0395905_0020278
362 Ga0395905_0033198
363 Ga0436364_0048729
364 Ga0436364_0500314
365 Ga0400489_67483
366 Ga0436363_0575845
367 Ga0451807_2026360
368 Ga0450920_015090
369 Ga0439434_0010883
370 Ga0451577_0000033
371 Ga0453683_0000769
372 Ga0453684_0000109
373 Ga0453684_0056606
374 Ga0453684_0125237
375 Ga0451576_0032200
376 Ga0451576_0404406
377 Ga0495594_0000429
378 Ga0495625_0028973
379 Ga0495588_0028546
380 Ga0495623_0036218
381 Ga0495613_0001183
382 Ga0495636_0001098
383 Ga0495687_000659
384 Ga0495685_006585
385 Ga0496109_0209169
386 Ga0496115_0021308
387 Ga0496126_0114770
388 Ga0501032_0005837
389 Ga0501032_0017904
390 Ga0501033_0019207
391 Ga0501033_0046795
392 Ga0501033_0066724
393 Ga0501036_0005654
394 Ga0501036_0033661
395 Ga0501036_0194630
396 Ga0501037_0007430
397 Ga0501037_0076108
398 Ga0501039_0051246
399 Ga0501042_0015459
400 Ga0501046_0031700
401 Ga0501048_0008160
402 Ga0501070_0028362
403 Ga0501072_0113170
404 Ga0501035_0004218
405 Ga0501035_0039983
406 Ga0501035_0267375
407 Ga0501044_0007411
408 Ga0501044_0021463
409 Ga0501044_0038951
410 nmdc:mga03683_13332_c1
411 nmdc:mga05p37_255997_c1
412 nmdc:mga05p37_29310_c1
413 nmdc:mga05p37_47177_c1
414 nmdc:mga09592_13830_c1
415 nmdc:mga09592_5941_c1
416 nmdc:mga09592_65426_c1
417 nmdc:mga0qj67_132546_c1
418 nmdc:mga0qj67_47439_c1
419 nmdc:mga0qj67_6655_c1
420 nmdc:mga06r32_122808_c1
421 nmdc:mga08y16_1098_c1
422 nmdc:mga08y16_10_c1
423 nmdc:mga08y16_3194_c1
424 nmdc:mga0rr50_139326_c1
425 Ga0500645_003299
426 Ga0466962_0020011
427 Ga0466962_0022054
428 2753073025
429 2586059771
430 2753460513
431 2812361243
432 2819741793
433 2838666709
434 2870723668
435 2912727334
436 8047714503

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01041

DegT_DnrJ_EryC1

DegT/DnrJ/EryC1/StrS aminotransferase family

71

429

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3frk-assembly1.cif.gz_B x-ray structure of qdtb from t. thermosaccharolyticum in complex with a plp:tdp-3-aminoquinovose aldimine 0.9535 1 385
7b0d-assembly1.cif.gz_B sugar transaminase from archaeoglobus veneficus 0.9498 1 391
3nys-assembly1.cif.gz_A x-ray structure of the k185a mutant of wbpe (wlbe) from pseudomonas aeruginosa in complex with plp at 1.45 angstrom resolution 0.9495 3 384
3nu7-assembly1.cif.gz_A wbpe, an aminotransferase from pseudomonas aeruginosa involved in o-antigen assembly in complex with the cofactor pmp 0.9491 3 383
3frk-assembly1.cif.gz_B x-ray structure of qdtb from t. thermosaccharolyticum in complex with a plp:tdp-3-aminoquinovose aldimine 0.9484 1 385
ID Description Score Start End Superfamily
5u1zA01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9563 6 257 3.40.640.10
2ogeD01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9433 1 258 3.40.640.10
2ogeD01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9394 1 258 3.40.640.10
5u1zA01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9328 6 257 3.40.640.10
3frkB02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9316 260 385 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A2V5MJH0-F1-model_v4 Transcriptional regulator 0.9855 1 387 GO:0000271
GO:0008483
GO:0030170
AF-A0A2V5MJH0-F1-model_v4 Transcriptional regulator 0.973 1 387 GO:0000271
GO:0008483
GO:0030170
AF-A0A7W1L4E0-F1-model_v4 DegT/DnrJ/EryC1/StrS family aminotransferase 0.9729 201 386 GO:0000271
GO:0008483
GO:0030170
AF-A0A7V4B0S5-F1-model_v4 Erythromycin biosynthesis sensory transduction protein eryC1 0.9697 156 367 GO:0000271
GO:0008483
GO:0030170
AF-A0A7X7J125-F1-model_v4 Erythromycin biosynthesis sensory transduction protein eryC1 0.9694 190 382 GO:0000271
GO:0008483
GO:0030170

Map