F330122
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 218 | 66 | 434 | 174 |
Family's Representative Sequence
| Representative Sequence | 3300031691|Ga0316579_10105689|Ga0316579_101056892 |
| Length | 202 |
| Sequence | MLLPKRPRWKTSRNRAEEAIAVKVEKKKKIVKTIRIDVDKCNGCRACEVICSAFHATEKYSSNNPARSRIRVIRDPLRDIYVPVFAGDYTPAECAGRDIYTIDGKEYEECAFCRASCPSRDEFKEPDSGLPLKCDMCEDDPAQEEPLCVQWCLNDALIYEEREEEVXXXVKLDDMEIGLESMIDKYGLQKVIDALARMSTKE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 2 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 3 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 4 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 5 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 6 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 7 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 8 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 9 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 10 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 11 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 12 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 13 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 14 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 15 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 16 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 17 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 18 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 19 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 20 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 21 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 22 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 23 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 24 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 25 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 26 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 27 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 28 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 29 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 30 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 31 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 32 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 33 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 34 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 35 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 36 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 37 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 38 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 39 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 40 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 41 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 42 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 43 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 44 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 45 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 46 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 47 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 48 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 49 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 50 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 51 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 52 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 53 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 54 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 55 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 56 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 57 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 58 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 59 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 60 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 61 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 62 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 63 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 64 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 65 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 66 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.33 |
| Metatranscriptomes | 3.67 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 92.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0316579_10105689 | 3300031691 | Bacteria | 1350 |
| 2 | Ga0265323_10006869 | 3300028653 | Bacteria | 4759 |
| 3 | Ga0265324_10019056 | 3300029957 | Bacteria | 2474 |
| 4 | Ga0265330_10017389 | 3300031235 | Bacteria | 3312 |
| 5 | Ga0265329_10084776 | 3300031242 | Unclassified | 1004 |
| 6 | Ga0265327_10042351 | 3300031251 | Bacteria | 2445 |
| 7 | Ga0265316_10018968 | 3300031344 | Bacteria | 5902 |
| 8 | Ga0265316_10019832 | 3300031344 | Bacteria | 5740 |
| 9 | Ga0265316_10026501 | 3300031344 | Bacteria | 4819 |
| 10 | Ga0265316_10062009 | 3300031344 | Bacteria | 2902 |
| 11 | Ga0265316_10091347 | 3300031344 | Unclassified | 2322 |
| 12 | Ga0316575_10053773 | 3300031665 | Bacteria | 1604 |
| 13 | Ga0316575_10323906 | 3300031665 | Bacteria | 654 |
| 14 | Ga0316579_10001818 | 3300031691 | Bacteria | 7872 |
| 15 | Ga0316579_10003364 | 3300031691 | Bacteria | 6220 |
| 16 | Ga0316579_10060378 | 3300031691 | Bacteria | 1783 |
| 17 | Ga0316579_10081536 | 3300031691 | Bacteria | 1540 |
| 18 | Ga0316579_10264857 | 3300031691 | Bacteria | 831 |
| 19 | Ga0265314_10366260 | 3300031711 | Bacteria | 788 |
| 20 | Ga0265342_10097564 | 3300031712 | Bacteria | 1678 |
| 21 | Ga0316576_10001336 | 3300031727 | Bacteria | 13106 |
| 22 | Ga0316576_10002768 | 3300031727 | Bacteria | 10066 |
| 23 | Ga0316576_10005674 | 3300031727 | Bacteria | 7673 |
| 24 | Ga0316576_10026747 | 3300031727 | Bacteria | 4051 |
| 25 | Ga0316576_10037697 | 3300031727 | Bacteria | 3462 |
| 26 | Ga0316576_10037800 | 3300031727 | Bacteria | 3458 |
| 27 | Ga0316576_10058870 | 3300031727 | Bacteria | 2811 |
| 28 | Ga0316576_10063829 | 3300031727 | Bacteria | 2704 |
| 29 | Ga0316576_10069493 | 3300031727 | Unclassified | 2597 |
| 30 | Ga0316576_10119142 | 3300031727 | Bacteria | 1981 |
| 31 | Ga0316576_10147344 | 3300031727 | Bacteria | 1773 |
| 32 | Ga0316576_10149009 | 3300031727 | Bacteria | 1763 |
| 33 | Ga0316576_10168773 | 3300031727 | Bacteria | 1651 |
| 34 | Ga0316576_10216607 | 3300031727 | Bacteria | 1441 |
| 35 | Ga0316576_10289616 | 3300031727 | Bacteria | 1225 |
| 36 | Ga0316576_10301907 | 3300031727 | Bacteria | 1196 |
| 37 | Ga0316576_10315001 | 3300031727 | Bacteria | 1168 |
| 38 | Ga0316576_10357907 | 3300031727 | Bacteria | 1085 |
| 39 | Ga0316576_10413145 | 3300031727 | Unclassified | 999 |
| 40 | Ga0316578_10000600 | 3300031728 | Bacteria | 12608 |
| 41 | Ga0316578_10003402 | 3300031728 | Bacteria | 7265 |
| 42 | Ga0316578_10006399 | 3300031728 | Bacteria | 5808 |
| 43 | Ga0316578_10016468 | 3300031728 | Bacteria | 4003 |
| 44 | Ga0316578_10032086 | 3300031728 | Bacteria | 2997 |
| 45 | Ga0316578_10032307 | 3300031728 | Bacteria | 2989 |
| 46 | Ga0316578_10067504 | 3300031728 | Bacteria | 2114 |
| 47 | Ga0316578_10146954 | 3300031728 | Bacteria | 1420 |
| 48 | Ga0316578_10153938 | 3300031728 | Bacteria | 1385 |
| 49 | Ga0316578_10251194 | 3300031728 | Bacteria | 1061 |
| 50 | Ga0316578_10413820 | 3300031728 | Bacteria | 798 |
| 51 | Ga0316577_10012394 | 3300031733 | Bacteria | 4645 |
| 52 | Ga0316577_10027345 | 3300031733 | Bacteria | 3180 |
| 53 | Ga0316577_10033909 | 3300031733 | Bacteria | 2852 |
| 54 | Ga0316577_10094574 | 3300031733 | Bacteria | 1674 |
| 55 | Ga0316577_10174821 | 3300031733 | Bacteria | 1212 |
| 56 | Ga0316577_10176753 | 3300031733 | Bacteria | 1205 |
| 57 | Ga0316577_10196190 | 3300031733 | Bacteria | 1141 |
| 58 | Ga0316577_10253639 | 3300031733 | Unclassified | 995 |
| 59 | Ga0316577_10286661 | 3300031733 | Bacteria | 932 |
| 60 | Ga0316577_10358912 | 3300031733 | Bacteria | 827 |
| 61 | Ga0316577_10450376 | 3300031733 | Unclassified | 731 |
| 62 | Ga0316583_10001493 | 3300032133 | Bacteria | 7844 |
| 63 | Ga0316583_10024644 | 3300032133 | Bacteria | 2148 |
| 64 | Ga0316583_10031289 | 3300032133 | Bacteria | 1894 |
| 65 | Ga0316583_10038279 | 3300032133 | Bacteria | 1700 |
| 66 | Ga0316583_10075137 | 3300032133 | Bacteria | 1181 |
| 67 | Ga0316583_10136276 | 3300032133 | Bacteria | 855 |
| 68 | Ga0316583_10137463 | 3300032133 | Bacteria | 851 |
| 69 | Ga0316585_10005375 | 3300032137 | Bacteria | 3612 |
| 70 | Ga0316585_10025295 | 3300032137 | Bacteria | 1840 |
| 71 | Ga0316585_10166104 | 3300032137 | Bacteria | 729 |
| 72 | Ga0316585_10196594 | 3300032137 | Bacteria | 667 |
| 73 | Ga0316580_10002103 | 3300032139 | Bacteria | 5414 |
| 74 | Ga0316580_10009371 | 3300032139 | Bacteria | 2940 |
| 75 | Ga0316580_10020593 | 3300032139 | Bacteria | 2032 |
| 76 | Ga0316580_10034819 | 3300032139 | Bacteria | 1558 |
| 77 | Ga0316580_10049760 | 3300032139 | Bacteria | 1292 |
| 78 | Ga0316593_10009562 | 3300032168 | Bacteria | 2743 |
| 79 | Ga0316592_1014266 | 3300033524 | Bacteria | 1646 |
| 80 | Ga0316592_1037932 | 3300033524 | Unclassified | 1061 |
| 81 | Ga0316588_1012082 | 3300033528 | Bacteria | 1854 |
| 82 | Ga0316588_1071964 | 3300033528 | Bacteria | 850 |
| 83 | Ga0316596_1004390 | 3300033541 | Bacteria | 3160 |
| 84 | Ga0316596_1014209 | 3300033541 | Bacteria | 1972 |
| 85 | Ga0316596_1112940 | 3300033541 | Bacteria | 738 |
| 86 | Ga0316574_0004956 | 3300035398 | Bacteria | 7052 |
| 87 | Ga0316574_0012421 | 3300035398 | Bacteria | 4871 |
| 88 | Ga0316574_0012454 | 3300035398 | Bacteria | 4865 |
| 89 | Ga0316574_0014680 | 3300035398 | Bacteria | 4531 |
| 90 | Ga0316574_0031101 | 3300035398 | Bacteria | 3237 |
| 91 | Ga0316574_0070072 | 3300035398 | Bacteria | 2214 |
| 92 | Ga0316574_0110348 | 3300035398 | Bacteria | 1763 |
| 93 | Ga0316574_0264914 | 3300035398 | Bacteria | 1097 |
| 94 | Ga0316574_0451964 | 3300035398 | Bacteria | 805 |
| 95 | Ga0316574_0668318 | 3300035398 | Bacteria | 639 |
| 96 | Ga0316582_0001496 | 3300036647 | Bacteria | 10325 |
| 97 | Ga0316582_0012944 | 3300036647 | Bacteria | 4678 |
| 98 | Ga0316582_0021065 | 3300036647 | Bacteria | 3844 |
| 99 | Ga0316582_0033834 | 3300036647 | Bacteria | 3142 |
| 100 | Ga0316582_0041317 | 3300036647 | Bacteria | 2882 |
| 101 | Ga0316582_0044643 | 3300036647 | Bacteria | 2787 |
| 102 | Ga0316582_0089151 | 3300036647 | Bacteria | 2027 |
| 103 | Ga0316582_0131282 | 3300036647 | Bacteria | 1682 |
| 104 | Ga0316582_0157226 | 3300036647 | Bacteria | 1539 |
| 105 | Ga0316582_0205048 | 3300036647 | Bacteria | 1346 |
| 106 | Ga0316582_0400067 | 3300036647 | Bacteria | 946 |
| 107 | Ga0316582_0440718 | 3300036647 | Bacteria | 898 |
| 108 | Ga0316582_0458140 | 3300036647 | Bacteria | 879 |
| 109 | Ga0316582_0570536 | 3300036647 | Unclassified | 779 |
| 110 | Ga0316582_0620754 | 3300036647 | Bacteria | 744 |
| 111 | Ga0316582_0635178 | 3300036647 | Bacteria | 734 |
| 112 | Ga0316584_0000003 | 3300036712 | Bacteria | 75738 |
| 113 | Ga0316584_0004733 | 3300036712 | Bacteria | 9018 |
| 114 | Ga0316584_0032577 | 3300036712 | Bacteria | 3857 |
| 115 | Ga0316584_0034409 | 3300036712 | Bacteria | 3756 |
| 116 | Ga0316584_0034787 | 3300036712 | Bacteria | 3736 |
| 117 | Ga0316584_0039744 | 3300036712 | Bacteria | 3502 |
| 118 | Ga0316584_0054538 | 3300036712 | Bacteria | 2992 |
| 119 | Ga0316584_0057947 | 3300036712 | Bacteria | 2900 |
| 120 | Ga0316584_0059620 | 3300036712 | Bacteria | 2858 |
| 121 | Ga0316584_0092638 | 3300036712 | Bacteria | 2262 |
| 122 | Ga0316584_0120948 | 3300036712 | Bacteria | 1956 |
| 123 | Ga0316584_0176408 | 3300036712 | Bacteria | 1583 |
| 124 | Ga0316584_0250826 | 3300036712 | Bacteria | 1293 |
| 125 | Ga0316584_0263629 | 3300036712 | Bacteria | 1256 |
| 126 | Ga0316584_0299568 | 3300036712 | Bacteria | 1164 |
| 127 | Ga0316584_0367677 | 3300036712 | Bacteria | 1030 |
| 128 | Ga0316584_0394799 | 3300036712 | Bacteria | 986 |
| 129 | Ga0316584_0413083 | 3300036712 | Archaea | 959 |
| 130 | Ga0316584_0588797 | 3300036712 | Bacteria | 773 |
| 131 | Ga0316584_0622322 | 3300036712 | Archaea | 747 |
| 132 | Ga0316581_0028472 | 3300037588 | Bacteria | 1675 |
| 133 | Ga0316581_0050785 | 3300037588 | Unclassified | 1271 |
| 134 | Ga0400490_17993 | 3300038726 | Bacteria | 17364 |
| 135 | Ga0400490_54369 | 3300038726 | Bacteria | 3326 |
| 136 | Ga0400491_16196 | 3300038727 | Bacteria | 3186 |
| 137 | Ga0400491_17277 | 3300038727 | Bacteria | 1469 |
| 138 | Ga0400488_32921 | 3300038741 | Bacteria | 2103 |
| 139 | Ga0400488_39936 | 3300038741 | Bacteria | 11686 |
| 140 | Ga0400488_52092 | 3300038741 | Bacteria | 1068 |
| 141 | Ga0400488_61207 | 3300038741 | Bacteria | 2632 |
| 142 | Ga0400483_058147 | 3300039062 | Bacteria | 10652 |
| 143 | Ga0400483_058194 | 3300039062 | Unclassified | 3533 |
| 144 | Ga0400483_233830 | 3300039062 | Bacteria | 10713 |
| 145 | Ga0400489_02847 | 3300039093 | Unclassified | 1227 |
| 146 | Ga0400489_04933 | 3300039093 | Bacteria | 3056 |
| 147 | Ga0400489_20232 | 3300039093 | Bacteria | 5559 |
| 148 | Ga0400489_48117 | 3300039093 | Bacteria | 2056 |
| 149 | Ga0400489_72547 | 3300039093 | Bacteria | 1069 |
| 150 | Ga0400489_81148 | 3300039093 | Bacteria | 25216 |
| 151 | Ga0451577_0000694 | 3300042876 | Bacteria | 52819 |
| 152 | Ga0451577_0000834 | 3300042876 | Bacteria | 46038 |
| 153 | Ga0451577_0046672 | 3300042876 | Unclassified | 3875 |
| 154 | Ga0451577_0103605 | 3300042876 | Bacteria | 2543 |
| 155 | Ga0451577_0542409 | 3300042876 | Bacteria | 1056 |
| 156 | Ga0451577_1153572 | 3300042876 | Bacteria | 692 |
| 157 | Ga0453683_0000268 | 3300044673 | Bacteria | 68303 |
| 158 | Ga0453683_0000431 | 3300044673 | Bacteria | 47971 |
| 159 | Ga0453683_0000579 | 3300044673 | Bacteria | 40558 |
| 160 | Ga0453683_0000856 | 3300044673 | Bacteria | 29381 |
| 161 | Ga0453683_0074950 | 3300044673 | Bacteria | 2118 |
| 162 | Ga0453684_0000285 | 3300044712 | Bacteria | 218061 |
| 163 | Ga0453684_0002147 | 3300044712 | Bacteria | 49416 |
| 164 | Ga0453684_0002317 | 3300044712 | Bacteria | 46753 |
| 165 | Ga0453684_0004583 | 3300044712 | Bacteria | 28827 |
| 166 | Ga0453684_0139802 | 3300044712 | Bacteria | 2894 |
| 167 | Ga0453684_0374507 | 3300044712 | Bacteria | 1600 |
| 168 | Ga0453684_1108852 | 3300044712 | Bacteria | 835 |
| 169 | Ga0453684_1436015 | 3300044712 | Bacteria | 714 |
| 170 | Ga0451576_0007735 | 3300045051 | Bacteria | 12763 |
| 171 | Ga0451576_0079146 | 3300045051 | Bacteria | 3420 |
| 172 | Ga0451576_0130466 | 3300045051 | Bacteria | 2620 |
| 173 | Ga0451576_0303254 | 3300045051 | Unclassified | 1671 |
| 174 | Ga0451576_0327239 | 3300045051 | Bacteria | 1604 |
| 175 | Ga0451576_0348971 | 3300045051 | Bacteria | 1549 |
| 176 | Ga0451576_0426987 | 3300045051 | Bacteria | 1391 |
| 177 | Ga0495657_0153245 | 3300046675 | Bacteria | 1430 |
| 178 | Ga0495676_0279037 | 3300047321 | Bacteria | 1132 |
| 179 | Ga0501031_0154207 | 3300049568 | Bacteria | 1501 |
| 180 | Ga0501032_0190641 | 3300049569 | Bacteria | 1340 |
| 181 | Ga0501034_0255826 | 3300049571 | Bacteria | 1695 |
| 182 | Ga0501036_0000684 | 3300049572 | Bacteria | 25013 |
| 183 | Ga0501036_0164733 | 3300049572 | Bacteria | 1869 |
| 184 | Ga0501037_0020790 | 3300049573 | Bacteria | 4846 |
| 185 | Ga0501038_0001383 | 3300049574 | Bacteria | 22170 |
| 186 | Ga0501039_0000346 | 3300049575 | Bacteria | 33196 |
| 187 | Ga0501039_0798743 | 3300049575 | Bacteria | 736 |
| 188 | Ga0501040_0000250 | 3300049576 | Bacteria | 31454 |
| 189 | Ga0501040_0341374 | 3300049576 | Bacteria | 1072 |
| 190 | Ga0501041_0000364 | 3300049577 | Bacteria | 22533 |
| 191 | Ga0501042_0005980 | 3300049578 | Bacteria | 7878 |
| 192 | Ga0501042_0533000 | 3300049578 | Bacteria | 853 |
| 193 | Ga0501043_0044588 | 3300049579 | Bacteria | 3487 |
| 194 | Ga0501046_0000370 | 3300049580 | Bacteria | 45444 |
| 195 | Ga0501046_0241403 | 3300049580 | Bacteria | 1332 |
| 196 | Ga0501047_0317294 | 3300049581 | Bacteria | 1399 |
| 197 | Ga0501048_0000714 | 3300049582 | Bacteria | 24287 |
| 198 | Ga0501048_0056150 | 3300049582 | Bacteria | 2794 |
| 199 | Ga0501068_0030051 | 3300049584 | Bacteria | 3221 |
| 200 | Ga0501069_0403129 | 3300049585 | Unclassified | 809 |
| 201 | Ga0501070_0006955 | 3300049586 | Bacteria | 9623 |
| 202 | Ga0501071_0003769 | 3300049587 | Bacteria | 9520 |
| 203 | Ga0501072_0002863 | 3300049588 | Bacteria | 12963 |
| 204 | Ga0501074_0023435 | 3300049590 | Bacteria | 4486 |
| 205 | Ga0501075_0001738 | 3300049591 | Bacteria | 14318 |
| 206 | Ga0501076_0000118 | 3300049592 | Bacteria | 43658 |
| 207 | Ga0501076_0371022 | 3300049592 | Bacteria | 1176 |
| 208 | Ga0501077_0002695 | 3300049593 | Bacteria | 10646 |
| 209 | Ga0501079_0000005 | 3300049741 | Bacteria | 85998 |
| 210 | Ga0501080_0644696 | 3300049742 | Unclassified | 938 |
| 211 | Ga0501081_0000118 | 3300049743 | Bacteria | 34243 |
| 212 | Ga0501035_0022072 | 3300049822 | Bacteria | 5847 |
| 213 | Ga0501045_0000142 | 3300049824 | Bacteria | 38183 |
| 214 | Ga0501045_0249953 | 3300049824 | Bacteria | 1320 |
| 215 | Ga0501084_0002181 | 3300054114 | Bacteria | 15696 |
| 216 | Ga0501082_0001258 | 3300060353 | Bacteria | 22271 |
| 217 | Ga0530510_0003567 | 3300061734 | Bacteria | 10712 |
| 218 | Ga0316579_10105689 | |||
| 219 | Ga0265323_10006869 | |||
| 220 | Ga0265324_10019056 | |||
| 221 | Ga0265330_10017389 | |||
| 222 | Ga0265329_10084776 | |||
| 223 | Ga0265327_10042351 | |||
| 224 | Ga0265316_10018968 | |||
| 225 | Ga0265316_10019832 | |||
| 226 | Ga0265316_10026501 | |||
| 227 | Ga0265316_10062009 | |||
| 228 | Ga0265316_10091347 | |||
| 229 | Ga0316575_10053773 | |||
| 230 | Ga0316575_10323906 | |||
| 231 | Ga0316579_10001818 | |||
| 232 | Ga0316579_10003364 | |||
| 233 | Ga0316579_10060378 | |||
| 234 | Ga0316579_10081536 | |||
| 235 | Ga0316579_10264857 | |||
| 236 | Ga0265314_10366260 | |||
| 237 | Ga0265342_10097564 | |||
| 238 | Ga0316576_10001336 | |||
| 239 | Ga0316576_10002768 | |||
| 240 | Ga0316576_10005674 | |||
| 241 | Ga0316576_10026747 | |||
| 242 | Ga0316576_10037697 | |||
| 243 | Ga0316576_10037800 | |||
| 244 | Ga0316576_10058870 | |||
| 245 | Ga0316576_10063829 | |||
| 246 | Ga0316576_10069493 | |||
| 247 | Ga0316576_10119142 | |||
| 248 | Ga0316576_10147344 | |||
| 249 | Ga0316576_10149009 | |||
| 250 | Ga0316576_10168773 | |||
| 251 | Ga0316576_10216607 | |||
| 252 | Ga0316576_10289616 | |||
| 253 | Ga0316576_10301907 | |||
| 254 | Ga0316576_10315001 | |||
| 255 | Ga0316576_10357907 | |||
| 256 | Ga0316576_10413145 | |||
| 257 | Ga0316578_10000600 | |||
| 258 | Ga0316578_10003402 | |||
| 259 | Ga0316578_10006399 | |||
| 260 | Ga0316578_10016468 | |||
| 261 | Ga0316578_10032086 | |||
| 262 | Ga0316578_10032307 | |||
| 263 | Ga0316578_10067504 | |||
| 264 | Ga0316578_10146954 | |||
| 265 | Ga0316578_10153938 | |||
| 266 | Ga0316578_10251194 | |||
| 267 | Ga0316578_10413820 | |||
| 268 | Ga0316577_10012394 | |||
| 269 | Ga0316577_10027345 | |||
| 270 | Ga0316577_10033909 | |||
| 271 | Ga0316577_10094574 | |||
| 272 | Ga0316577_10174821 | |||
| 273 | Ga0316577_10176753 | |||
| 274 | Ga0316577_10196190 | |||
| 275 | Ga0316577_10253639 | |||
| 276 | Ga0316577_10286661 | |||
| 277 | Ga0316577_10358912 | |||
| 278 | Ga0316577_10450376 | |||
| 279 | Ga0316583_10001493 | |||
| 280 | Ga0316583_10024644 | |||
| 281 | Ga0316583_10031289 | |||
| 282 | Ga0316583_10038279 | |||
| 283 | Ga0316583_10075137 | |||
| 284 | Ga0316583_10136276 | |||
| 285 | Ga0316583_10137463 | |||
| 286 | Ga0316585_10005375 | |||
| 287 | Ga0316585_10025295 | |||
| 288 | Ga0316585_10166104 | |||
| 289 | Ga0316585_10196594 | |||
| 290 | Ga0316580_10002103 | |||
| 291 | Ga0316580_10009371 | |||
| 292 | Ga0316580_10020593 | |||
| 293 | Ga0316580_10034819 | |||
| 294 | Ga0316580_10049760 | |||
| 295 | Ga0316593_10009562 | |||
| 296 | Ga0316592_1014266 | |||
| 297 | Ga0316592_1037932 | |||
| 298 | Ga0316588_1012082 | |||
| 299 | Ga0316588_1071964 | |||
| 300 | Ga0316596_1004390 | |||
| 301 | Ga0316596_1014209 | |||
| 302 | Ga0316596_1112940 | |||
| 303 | Ga0316574_0004956 | |||
| 304 | Ga0316574_0012421 | |||
| 305 | Ga0316574_0012454 | |||
| 306 | Ga0316574_0014680 | |||
| 307 | Ga0316574_0031101 | |||
| 308 | Ga0316574_0070072 | |||
| 309 | Ga0316574_0110348 | |||
| 310 | Ga0316574_0264914 | |||
| 311 | Ga0316574_0451964 | |||
| 312 | Ga0316574_0668318 | |||
| 313 | Ga0316582_0001496 | |||
| 314 | Ga0316582_0012944 | |||
| 315 | Ga0316582_0021065 | |||
| 316 | Ga0316582_0033834 | |||
| 317 | Ga0316582_0041317 | |||
| 318 | Ga0316582_0044643 | |||
| 319 | Ga0316582_0089151 | |||
| 320 | Ga0316582_0131282 | |||
| 321 | Ga0316582_0157226 | |||
| 322 | Ga0316582_0205048 | |||
| 323 | Ga0316582_0400067 | |||
| 324 | Ga0316582_0440718 | |||
| 325 | Ga0316582_0458140 | |||
| 326 | Ga0316582_0570536 | |||
| 327 | Ga0316582_0620754 | |||
| 328 | Ga0316582_0635178 | |||
| 329 | Ga0316584_0000003 | |||
| 330 | Ga0316584_0004733 | |||
| 331 | Ga0316584_0032577 | |||
| 332 | Ga0316584_0034409 | |||
| 333 | Ga0316584_0034787 | |||
| 334 | Ga0316584_0039744 | |||
| 335 | Ga0316584_0054538 | |||
| 336 | Ga0316584_0057947 | |||
| 337 | Ga0316584_0059620 | |||
| 338 | Ga0316584_0092638 | |||
| 339 | Ga0316584_0120948 | |||
| 340 | Ga0316584_0176408 | |||
| 341 | Ga0316584_0250826 | |||
| 342 | Ga0316584_0263629 | |||
| 343 | Ga0316584_0299568 | |||
| 344 | Ga0316584_0367677 | |||
| 345 | Ga0316584_0394799 | |||
| 346 | Ga0316584_0413083 | |||
| 347 | Ga0316584_0588797 | |||
| 348 | Ga0316584_0622322 | |||
| 349 | Ga0316581_0028472 | |||
| 350 | Ga0316581_0050785 | |||
| 351 | Ga0400490_17993 | |||
| 352 | Ga0400490_54369 | |||
| 353 | Ga0400491_16196 | |||
| 354 | Ga0400491_17277 | |||
| 355 | Ga0400488_32921 | |||
| 356 | Ga0400488_39936 | |||
| 357 | Ga0400488_52092 | |||
| 358 | Ga0400488_61207 | |||
| 359 | Ga0400483_058147 | |||
| 360 | Ga0400483_058194 | |||
| 361 | Ga0400483_233830 | |||
| 362 | Ga0400489_02847 | |||
| 363 | Ga0400489_04933 | |||
| 364 | Ga0400489_20232 | |||
| 365 | Ga0400489_48117 | |||
| 366 | Ga0400489_72547 | |||
| 367 | Ga0400489_81148 | |||
| 368 | Ga0451577_0000694 | |||
| 369 | Ga0451577_0000834 | |||
| 370 | Ga0451577_0046672 | |||
| 371 | Ga0451577_0103605 | |||
| 372 | Ga0451577_0542409 | |||
| 373 | Ga0451577_1153572 | |||
| 374 | Ga0453683_0000268 | |||
| 375 | Ga0453683_0000431 | |||
| 376 | Ga0453683_0000579 | |||
| 377 | Ga0453683_0000856 | |||
| 378 | Ga0453683_0074950 | |||
| 379 | Ga0453684_0000285 | |||
| 380 | Ga0453684_0002147 | |||
| 381 | Ga0453684_0002317 | |||
| 382 | Ga0453684_0004583 | |||
| 383 | Ga0453684_0139802 | |||
| 384 | Ga0453684_0374507 | |||
| 385 | Ga0453684_1108852 | |||
| 386 | Ga0453684_1436015 | |||
| 387 | Ga0451576_0007735 | |||
| 388 | Ga0451576_0079146 | |||
| 389 | Ga0451576_0130466 | |||
| 390 | Ga0451576_0303254 | |||
| 391 | Ga0451576_0327239 | |||
| 392 | Ga0451576_0348971 | |||
| 393 | Ga0451576_0426987 | |||
| 394 | Ga0495657_0153245 | |||
| 395 | Ga0495676_0279037 | |||
| 396 | Ga0501031_0154207 | |||
| 397 | Ga0501032_0190641 | |||
| 398 | Ga0501034_0255826 | |||
| 399 | Ga0501036_0000684 | |||
| 400 | Ga0501036_0164733 | |||
| 401 | Ga0501037_0020790 | |||
| 402 | Ga0501038_0001383 | |||
| 403 | Ga0501039_0000346 | |||
| 404 | Ga0501039_0798743 | |||
| 405 | Ga0501040_0000250 | |||
| 406 | Ga0501040_0341374 | |||
| 407 | Ga0501041_0000364 | |||
| 408 | Ga0501042_0005980 | |||
| 409 | Ga0501042_0533000 | |||
| 410 | Ga0501043_0044588 | |||
| 411 | Ga0501046_0000370 | |||
| 412 | Ga0501046_0241403 | |||
| 413 | Ga0501047_0317294 | |||
| 414 | Ga0501048_0000714 | |||
| 415 | Ga0501048_0056150 | |||
| 416 | Ga0501068_0030051 | |||
| 417 | Ga0501069_0403129 | |||
| 418 | Ga0501070_0006955 | |||
| 419 | Ga0501071_0003769 | |||
| 420 | Ga0501072_0002863 | |||
| 421 | Ga0501074_0023435 | |||
| 422 | Ga0501075_0001738 | |||
| 423 | Ga0501076_0000118 | |||
| 424 | Ga0501076_0371022 | |||
| 425 | Ga0501077_0002695 | |||
| 426 | Ga0501079_0000005 | |||
| 427 | Ga0501080_0644696 | |||
| 428 | Ga0501081_0000118 | |||
| 429 | Ga0501035_0022072 | |||
| 430 | Ga0501045_0000142 | |||
| 431 | Ga0501045_0249953 | |||
| 432 | Ga0501084_0002181 | |||
| 433 | Ga0501082_0001258 | |||
| 434 | Ga0530510_0003567 |