F329941
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 218 | 149 | 215 | 138 |
Family's Representative Sequence
| Representative Sequence | 3300013100|Ga0157373_10450547|Ga0157373_104505472 |
| Length | 155 |
| Sequence | LTFPQAPAYFLQALSPEQSMPRCRVTRRVHFNAAHRLHNPEATEGWNQATYGVCNNPNYHGHNYELIVQVTGTPDPATGYVMDMKVLSKITAEEVIERFDHKNLNLDTEFFQKLNPTAENIVIVIYNLLRTRIDAKLELKVRLHETERNFVEYPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2739367866 | Hymenobacter sp. YR204 | Isolate | Unclassified |
| 2 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 3 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 4 | 2958512119 | Flavobacterium sp. Sd200 | Isolate | Rhizosphere |
| 5 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 34 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 38 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 39 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 40 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 44 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 46 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 48 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 49 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 50 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 51 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 52 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 73 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 109 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 110 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 111 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 112 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 113 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 114 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 115 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 116 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 117 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 118 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 119 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 120 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 121 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 122 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 123 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 124 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 125 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 126 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 137 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 138 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 139 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 140 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 141 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 142 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 143 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 144 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 145 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 146 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 147 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 148 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 149 | 3300060244 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 2R_CW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.79 |
| Metatranscriptomes | 1.38 |
| Isolates | 1.83 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.42 |
| Nodule | 0 |
| Rhizoplane | 0.92 |
| Rhizosphere | 85.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10061358 | 3300003316 | Bacteria | 4965 |
| 2 | rootH1_10080978 | 3300003316 | Bacteria | 12372 |
| 3 | rootH2_10039028 | 3300003320 | Bacteria | 3118 |
| 4 | rootL2_10039178 | 3300003322 | Bacteria | 4477 |
| 5 | rootL2_10080012 | 3300003322 | Bacteria | 3106 |
| 6 | rootH1_10017748 | 3300003316 | Bacteria | 1169 |
| 7 | rootH1_10017748 | 3300003323 | Bacteria | 20274 |
| 8 | rootH1_10032442 | 3300003323 | Bacteria | 6027 |
| 9 | rootH1_10131799 | 3300003323 | Unclassified | 4097 |
| 10 | rootH1_10165299 | 3300003323 | Bacteria | 2173 |
| 11 | Ga0055536_1024319 | 3300003781 | Bacteria | 1756 |
| 12 | Ga0055531_10000087 | 3300003794 | Bacteria | 101553 |
| 13 | Ga0065165_1000266 | 3300005262 | Bacteria | 90228 |
| 14 | Ga0070670_100999159 | 3300005331 | Bacteria | 761 |
| 15 | Ga0068869_100221033 | 3300005334 | Bacteria | 1501 |
| 16 | Ga0070666_10053422 | 3300005335 | Bacteria | 2725 |
| 17 | Ga0070661_100168979 | 3300005344 | Bacteria | 1660 |
| 18 | Ga0070668_100003612 | 3300005347 | Bacteria | 11413 |
| 19 | Ga0070675_100270345 | 3300005354 | Bacteria | 1491 |
| 20 | Ga0070674_100026112 | 3300005356 | Bacteria | 3811 |
| 21 | Ga0070673_100878738 | 3300005364 | Bacteria | 830 |
| 22 | Ga0070659_101196185 | 3300005366 | Bacteria | 672 |
| 23 | Ga0070709_10150311 | 3300005434 | Bacteria | 1609 |
| 24 | Ga0070708_100795902 | 3300005445 | Unclassified | 889 |
| 25 | Ga0070663_100019282 | 3300005455 | Bacteria | 4492 |
| 26 | Ga0070685_10524065 | 3300005466 | Bacteria | 842 |
| 27 | Ga0070699_100341480 | 3300005518 | Bacteria | 1348 |
| 28 | Ga0070679_102014294 | 3300005530 | Bacteria | 526 |
| 29 | Ga0070697_100026466 | 3300005536 | Bacteria | 4635 |
| 30 | Ga0068853_100000874 | 3300005539 | Bacteria | 21037 |
| 31 | Ga0068853_100032104 | 3300005539 | Bacteria | 4447 |
| 32 | Ga0068853_100193166 | 3300005539 | Bacteria | 1850 |
| 33 | Ga0068853_100809985 | 3300005539 | Bacteria | 897 |
| 34 | Ga0070672_100033813 | 3300005543 | Bacteria | 3875 |
| 35 | Ga0070672_100119770 | 3300005543 | Bacteria | 2154 |
| 36 | Ga0070695_100331086 | 3300005545 | Bacteria | 1135 |
| 37 | Ga0070665_100000013 | 3300005548 | Bacteria | 484927 |
| 38 | Ga0068855_100097958 | 3300005563 | Bacteria | 3378 |
| 39 | Ga0068855_101001038 | 3300005563 | Bacteria | 878 |
| 40 | Ga0068857_100008489 | 3300005577 | Bacteria | 8880 |
| 41 | Ga0068854_100020712 | 3300005578 | Bacteria | 4456 |
| 42 | Ga0068856_100199380 | 3300005614 | Bacteria | 2016 |
| 43 | Ga0068856_101285497 | 3300005614 | Unclassified | 747 |
| 44 | Ga0068852_100002206 | 3300005616 | Bacteria | 13369 |
| 45 | Ga0068852_100019930 | 3300005616 | Bacteria | 5323 |
| 46 | Ga0068852_100542125 | 3300005616 | Bacteria | 1163 |
| 47 | Ga0068852_102028703 | 3300005616 | Bacteria | 597 |
| 48 | Ga0068852_102061945 | 3300005616 | Bacteria | 592 |
| 49 | Ga0068864_100193014 | 3300005618 | Bacteria | 1868 |
| 50 | Ga0068861_100967103 | 3300005719 | Bacteria | 811 |
| 51 | Ga0068851_10300758 | 3300005834 | Bacteria | 922 |
| 52 | Ga0068870_10326762 | 3300005840 | Unclassified | 976 |
| 53 | Ga0068858_100568619 | 3300005842 | Bacteria | 1098 |
| 54 | Ga0068860_100000596 | 3300005843 | Bacteria | 43134 |
| 55 | Ga0068860_100086641 | 3300005843 | Bacteria | 2981 |
| 56 | Ga0068862_100527334 | 3300005844 | Unclassified | 1125 |
| 57 | Ga0068862_100595671 | 3300005844 | Bacteria | 1061 |
| 58 | Ga0070717_10250724 | 3300006028 | Bacteria | 1564 |
| 59 | Ga0075366_10719836 | 3300006195 | Bacteria | 620 |
| 60 | Ga0097621_100154339 | 3300006237 | Bacteria | 1970 |
| 61 | Ga0068871_100122232 | 3300006358 | Bacteria | 2200 |
| 62 | Ga0068871_100282062 | 3300006358 | Bacteria | 1453 |
| 63 | Ga0075428_100007490 | 3300006844 | Bacteria | 12094 |
| 64 | Ga0075428_100558010 | 3300006844 | Bacteria | 1224 |
| 65 | Ga0075430_101062053 | 3300006846 | Bacteria | 667 |
| 66 | Ga0075431_100099081 | 3300006847 | Bacteria | 3008 |
| 67 | Ga0075429_100016828 | 3300006880 | Bacteria | 6329 |
| 68 | Ga0075429_101532533 | 3300006880 | Bacteria | 580 |
| 69 | Ga0068865_100851536 | 3300006881 | Bacteria | 790 |
| 70 | Ga0105240_10002998 | 3300009093 | Bacteria | 26564 |
| 71 | Ga0105240_10022461 | 3300009093 | Bacteria | 8362 |
| 72 | Ga0105240_10044300 | 3300009093 | Bacteria | 5655 |
| 73 | Ga0105240_10342207 | 3300009093 | Bacteria | 1699 |
| 74 | Ga0105241_10000863 | 3300009174 | Bacteria | 23000 |
| 75 | Ga0105241_10185156 | 3300009174 | Bacteria | 1730 |
| 76 | Ga0105241_10981330 | 3300009174 | Unclassified | 789 |
| 77 | Ga0105248_10015606 | 3300009177 | Bacteria | 8373 |
| 78 | Ga0105248_10516983 | 3300009177 | Bacteria | 1346 |
| 79 | Ga0105237_10006921 | 3300009545 | Bacteria | 12505 |
| 80 | Ga0105237_10012741 | 3300009545 | Bacteria | 8845 |
| 81 | Ga0105237_10033058 | 3300009545 | Bacteria | 5239 |
| 82 | Ga0105237_12270279 | 3300009545 | Bacteria | 552 |
| 83 | Ga0105238_10083431 | 3300009551 | Bacteria | 3185 |
| 84 | Ga0105238_10098021 | 3300009551 | Bacteria | 2916 |
| 85 | Ga0105249_10288109 | 3300009553 | Unclassified | 1643 |
| 86 | Ga0105249_10325503 | 3300009553 | Bacteria | 1549 |
| 87 | Ga0105239_10008565 | 3300010375 | Bacteria | 11608 |
| 88 | Ga0105239_10065178 | 3300010375 | Bacteria | 4000 |
| 89 | Ga0105239_10701574 | 3300010375 | Unclassified | 1157 |
| 90 | Ga0157373_10450547 | 3300013100 | Bacteria | 926 |
| 91 | Ga0157371_10001805 | 3300013102 | Bacteria | 21630 |
| 92 | Ga0157371_10116766 | 3300013102 | Bacteria | 1896 |
| 93 | Ga0157371_10122345 | 3300013102 | Bacteria | 1850 |
| 94 | Ga0157371_10214082 | 3300013102 | Bacteria | 1383 |
| 95 | Ga0157370_10005721 | 3300013104 | Bacteria | 13898 |
| 96 | Ga0157370_10789267 | 3300013104 | Bacteria | 864 |
| 97 | Ga0157369_10002231 | 3300013105 | Bacteria | 23333 |
| 98 | Ga0157369_10732948 | 3300013105 | Bacteria | 1017 |
| 99 | Ga0157369_10797770 | 3300013105 | Bacteria | 970 |
| 100 | Ga0157369_11215149 | 3300013105 | Bacteria | 769 |
| 101 | Ga0157374_10214722 | 3300013296 | Bacteria | 1887 |
| 102 | Ga0157378_10118777 | 3300013297 | Bacteria | 2434 |
| 103 | Ga0157378_10803061 | 3300013297 | Bacteria | 967 |
| 104 | Ga0163162_10000629 | 3300013306 | Bacteria | 32711 |
| 105 | Ga0157372_10000037 | 3300013307 | Bacteria | 172444 |
| 106 | Ga0157372_10001377 | 3300013307 | Bacteria | 26250 |
| 107 | Ga0157372_10047730 | 3300013307 | Bacteria | 4759 |
| 108 | Ga0157372_10072397 | 3300013307 | Bacteria | 3884 |
| 109 | Ga0157375_10919501 | 3300013308 | Unclassified | 1018 |
| 110 | Ga0163163_11216953 | 3300014325 | Bacteria | 816 |
| 111 | Ga0157379_10044690 | 3300014968 | Bacteria | 3954 |
| 112 | Ga0157379_11348862 | 3300014968 | Bacteria | 690 |
| 113 | Ga0157376_10002175 | 3300014969 | Bacteria | 13199 |
| 114 | Ga0157376_10162548 | 3300014969 | Bacteria | 2026 |
| 115 | Ga0157376_10923565 | 3300014969 | Bacteria | 892 |
| 116 | Ga0206356_10603259 | 3300020070 | Unclassified | 859 |
| 117 | Ga0209676_1000495 | 3300025292 | Bacteria | 63184 |
| 118 | Ga0209050_1063216 | 3300025298 | Bacteria | 864 |
| 119 | Ga0209257_1000006 | 3300025304 | Bacteria | 1570111 |
| 120 | Ga0207697_10099868 | 3300025315 | Bacteria | 1236 |
| 121 | Ga0207656_10472275 | 3300025321 | Unclassified | 635 |
| 122 | Ga0207682_10408226 | 3300025893 | Unclassified | 642 |
| 123 | Ga0207680_10045120 | 3300025903 | Bacteria | 2597 |
| 124 | Ga0207647_10367202 | 3300025904 | Bacteria | 814 |
| 125 | Ga0207654_10028722 | 3300025911 | Bacteria | 3035 |
| 126 | Ga0207654_10161129 | 3300025911 | Bacteria | 1449 |
| 127 | Ga0207695_10000698 | 3300025913 | Bacteria | 65751 |
| 128 | Ga0207695_10008052 | 3300025913 | Bacteria | 13269 |
| 129 | Ga0207695_10067154 | 3300025913 | Bacteria | 3680 |
| 130 | Ga0207695_10107237 | 3300025913 | Bacteria | 2779 |
| 131 | Ga0207695_10162629 | 3300025913 | Bacteria | 2163 |
| 132 | Ga0207695_10300084 | 3300025913 | Unclassified | 1498 |
| 133 | Ga0207671_10002048 | 3300025914 | Bacteria | 22134 |
| 134 | Ga0207671_10010324 | 3300025914 | Bacteria | 7716 |
| 135 | Ga0207681_10069425 | 3300025923 | Bacteria | 2451 |
| 136 | Ga0207694_10073674 | 3300025924 | Bacteria | 2672 |
| 137 | Ga0207694_10096807 | 3300025924 | Bacteria | 2334 |
| 138 | Ga0207694_10167063 | 3300025924 | Unclassified | 1780 |
| 139 | Ga0207659_10174966 | 3300025926 | Bacteria | 1696 |
| 140 | Ga0207664_10467862 | 3300025929 | Bacteria | 1127 |
| 141 | Ga0207706_10132670 | 3300025933 | Bacteria | 2191 |
| 142 | Ga0207704_10774515 | 3300025938 | Unclassified | 799 |
| 143 | Ga0207691_10010409 | 3300025940 | Bacteria | 8922 |
| 144 | Ga0207711_10562959 | 3300025941 | Bacteria | 1063 |
| 145 | Ga0207689_10246936 | 3300025942 | Bacteria | 1476 |
| 146 | Ga0207667_10000221 | 3300025949 | Bacteria | 79940 |
| 147 | Ga0207651_10399026 | 3300025960 | Bacteria | 1169 |
| 148 | Ga0207651_11529790 | 3300025960 | Bacteria | 601 |
| 149 | Ga0207712_10084685 | 3300025961 | Bacteria | 2317 |
| 150 | Ga0207640_10010581 | 3300025981 | Bacteria | 5204 |
| 151 | Ga0207658_11428033 | 3300025986 | Unclassified | 633 |
| 152 | Ga0207703_10456942 | 3300026035 | Unclassified | 1194 |
| 153 | Ga0207639_10004269 | 3300026041 | Bacteria | 9636 |
| 154 | Ga0207639_10179344 | 3300026041 | Bacteria | 1800 |
| 155 | Ga0207639_10248941 | 3300026041 | Bacteria | 1549 |
| 156 | Ga0207678_10047465 | 3300026067 | Bacteria | 3714 |
| 157 | Ga0207702_10158053 | 3300026078 | Bacteria | 2068 |
| 158 | Ga0207702_10281688 | 3300026078 | Bacteria | 1572 |
| 159 | Ga0207702_10498153 | 3300026078 | Unclassified | 1187 |
| 160 | Ga0207674_10001679 | 3300026116 | Bacteria | 28464 |
| 161 | Ga0207675_100286236 | 3300026118 | Bacteria | 1602 |
| 162 | Ga0207698_10001412 | 3300026142 | Bacteria | 13929 |
| 163 | Ga0207698_10060651 | 3300026142 | Bacteria | 2943 |
| 164 | Ga0207698_10702113 | 3300026142 | Bacteria | 1007 |
| 165 | Ga0268266_10000024 | 3300028379 | Bacteria | 490820 |
| 166 | Ga0268265_10627597 | 3300028380 | Bacteria | 1030 |
| 167 | Ga0268264_10001493 | 3300028381 | Bacteria | 21826 |
| 168 | Ga0268264_10010098 | 3300028381 | Bacteria | 7812 |
| 169 | Ga0265327_10235632 | 3300031251 | Bacteria | 819 |
| 170 | Ga0307509_10143410 | 3300031507 | Unclassified | 2319 |
| 171 | Ga0307408_101714617 | 3300031548 | Bacteria | 599 |
| 172 | Ga0316576_10425192 | 3300031727 | Bacteria | 983 |
| 173 | Ga0307516_10046814 | 3300031730 | Unclassified | 4266 |
| 174 | Ga0307414_11204686 | 3300032004 | Bacteria | 701 |
| 175 | Ga0307507_10272888 | 3300033179 | Bacteria | 1066 |
| 176 | Ga0373941_0368812 | 3300035115 | Unclassified | 588 |
| 177 | Ga0373935_0032806 | 3300035692 | Bacteria | 3229 |
| 178 | Ga0395899_0000180 | 3300037312 | Bacteria | 92701 |
| 179 | Ga0395901_0001566 | 3300038443 | Bacteria | 23712 |
| 180 | Ga0395901_1210158 | 3300038443 | Bacteria | 721 |
| 181 | Ga0436363_0179576 | 3300039450 | Bacteria | 2868 |
| 182 | Ga0451807_1918947 | 3300041486 | Unclassified | 1171 |
| 183 | Ga0451837_0791586 | 3300041494 | Bacteria | 820 |
| 184 | Ga0451577_0044596 | 3300042876 | Bacteria | 3970 |
| 185 | Ga0451577_0574990 | 3300042876 | Bacteria | 1023 |
| 186 | Ga0466965_0402474 | 3300044683 | Bacteria | 756 |
| 187 | Ga0453684_0017716 | 3300044712 | Bacteria | 11003 |
| 188 | Ga0451576_0808796 | 3300045051 | Bacteria | 984 |
| 189 | Ga0451576_0891102 | 3300045051 | Bacteria | 934 |
| 190 | Ga0451576_2342195 | 3300045051 | Bacteria | 547 |
| 191 | Ga0495603_0044759 | 3300046455 | Bacteria | 2641 |
| 192 | Ga0495638_0074516 | 3300046460 | Bacteria | 2070 |
| 193 | Ga0495638_0110791 | 3300046460 | Bacteria | 1631 |
| 194 | Ga0495618_0371438 | 3300046514 | Unclassified | 879 |
| 195 | Ga0495631_0307278 | 3300046518 | Bacteria | 675 |
| 196 | Ga0495643_0456929 | 3300046522 | Unclassified | 555 |
| 197 | Ga0495648_0011775 | 3300046524 | Bacteria | 6565 |
| 198 | Ga0495633_0182808 | 3300046558 | Bacteria | 965 |
| 199 | Ga0495670_0378299 | 3300046691 | Unclassified | 764 |
| 200 | Ga0495660_0194926 | 3300046810 | Bacteria | 971 |
| 201 | Ga0495687_000014 | 3300047443 | Bacteria | 366896 |
| 202 | Ga0496104_0683466 | 3300048907 | Bacteria | 934 |
| 203 | Ga0496124_0124389 | 3300048927 | Bacteria | 2056 |
| 204 | nmdc:mga0k408_671400_c1 | 3300050493 | Bacteria | 608 |
| 205 | nmdc:mga09592_32958_c1 | 3300050508 | Bacteria | 4321 |
| 206 | nmdc:mga0qj67_903642_c1 | 3300050509 | Bacteria | 696 |
| 207 | nmdc:mga06r32_121458_c1 | 3300050510 | Bacteria | 2577 |
| 208 | Ga0500583_0032790 | 3300053092 | Bacteria | 2294 |
| 209 | Ga0500650_0410761 | 3300053098 | Unclassified | 585 |
| 210 | Ga0500562_038083 | 3300053108 | Bacteria | 1277 |
| 211 | Ga0500642_0005225 | 3300053130 | Bacteria | 4171 |
| 212 | Ga0500616_0062110 | 3300053153 | Unclassified | 1931 |
| 213 | Ga0500622_0001634 | 3300053156 | Bacteria | 17538 |
| 214 | Ga0587128_098417 | 3300059630 | Bacteria | 610 |
| 215 | Ga0587061_05714 | 3300060244 | Bacteria | 596 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005434 | Ga0070709_10150311 | Ga0070709_101503112 | 128 |
| 2 | 3300009177 | Ga0105248_10015606 | Ga0105248_100156064 | 128 |
| 3 | 3300009177 | Ga0105248_10516983 | Ga0105248_105169831 | 128 |
| 4 | 3300013308 | Ga0157375_10919501 | Ga0157375_109195012 | 128 |
| 5 | 3300014968 | Ga0157379_10044690 | Ga0157379_100446903 | 128 |
| 6 | 3300014969 | Ga0157376_10162548 | Ga0157376_101625483 | 128 |
| 7 | 3300046455 | Ga0495603_0044759 | Ga0495603_0044759_140_526 | 128 |
| 8 | 3300046558 | Ga0495633_0182808 | Ga0495633_0182808_312_698 | 128 |
| 9 | 3300046691 | Ga0495670_0378299 | Ga0495670_0378299_335_721 | 128 |
| 10 | iso_pu_bacteria | 2739367866 | 2740031267 | 131 |
| 11 | iso_pu_bacteria | 2958512119 | 2958514474 | 132 |
| 12 | 3300025321 | Ga0207656_10472275 | Ga0207656_104722752 | 133 |
| 13 | 3300006028 | Ga0070717_10250724 | Ga0070717_102507242 | 134 |
| 14 | 3300039450 | Ga0436363_0179576 | Ga0436363_0179576_1234_1707 | 134 |
| 15 | 3300041486 | Ga0451807_1918947 | Ga0451807_1918947_14_418 | 134 |
| 16 | iso_pu_bacteria | 2884933994 | 2884936855 | 134 |
| 17 | 3300003322 | rootL2_10080012 | rootL2_100800123 | 135 |
| 18 | 3300003323 | rootH1_10131799 | rootH1_101317993 | 135 |
| 19 | 3300005331 | Ga0070670_100999159 | Ga0070670_1009991592 | 135 |
| 20 | 3300005334 | Ga0068869_100221033 | Ga0068869_1002210332 | 135 |
| 21 | 3300005335 | Ga0070666_10053422 | Ga0070666_100534223 | 135 |
| 22 | 3300005344 | Ga0070661_100168979 | Ga0070661_1001689793 | 135 |
| 23 | 3300005366 | Ga0070659_101196185 | Ga0070659_1011961851 | 135 |
| 24 | 3300005455 | Ga0070663_100019282 | Ga0070663_1000192821 | 135 |
| 25 | 3300005466 | Ga0070685_10524065 | Ga0070685_105240652 | 135 |
| 26 | 3300005539 | Ga0068853_100032104 | Ga0068853_1000321044 | 135 |
| 27 | 3300005539 | Ga0068853_100193166 | Ga0068853_1001931663 | 135 |
| 28 | 3300005539 | Ga0068853_100809985 | Ga0068853_1008099852 | 135 |
| 29 | 3300005543 | Ga0070672_100119770 | Ga0070672_1001197703 | 135 |
| 30 | 3300005548 | Ga0070665_100000013 | Ga0070665_100000013368 | 135 |
| 31 | 3300005563 | Ga0068855_100097958 | Ga0068855_1000979583 | 135 |
| 32 | 3300005563 | Ga0068855_101001038 | Ga0068855_1010010382 | 135 |
| 33 | 3300005577 | Ga0068857_100008489 | Ga0068857_10000848911 | 135 |
| 34 | 3300005578 | Ga0068854_100020712 | Ga0068854_1000207126 | 135 |
| 35 | 3300005614 | Ga0068856_100199380 | Ga0068856_1001993802 | 135 |
| 36 | 3300005614 | Ga0068856_101285497 | Ga0068856_1012854972 | 135 |
| 37 | 3300005616 | Ga0068852_100002206 | Ga0068852_1000022067 | 135 |
| 38 | 3300005616 | Ga0068852_100542125 | Ga0068852_1005421252 | 135 |
| 39 | 3300005616 | Ga0068852_102028703 | Ga0068852_1020287032 | 135 |
| 40 | 3300005616 | Ga0068852_102061945 | Ga0068852_1020619452 | 135 |
| 41 | 3300005618 | Ga0068864_100193014 | Ga0068864_1001930143 | 135 |
| 42 | 3300005842 | Ga0068858_100568619 | Ga0068858_1005686192 | 135 |
| 43 | 3300005843 | Ga0068860_100000596 | Ga0068860_1000005967 | 135 |
| 44 | 3300005843 | Ga0068860_100086641 | Ga0068860_1000866415 | 135 |
| 45 | 3300005844 | Ga0068862_100527334 | Ga0068862_1005273343 | 135 |
| 46 | 3300006237 | Ga0097621_100154339 | Ga0097621_1001543393 | 135 |
| 47 | 3300006358 | Ga0068871_100122232 | Ga0068871_1001222322 | 135 |
| 48 | 3300006358 | Ga0068871_100282062 | Ga0068871_1002820623 | 135 |
| 49 | 3300006844 | Ga0075428_100007490 | Ga0075428_1000074906 | 135 |
| 50 | 3300006846 | Ga0075430_101062053 | Ga0075430_1010620531 | 135 |
| 51 | 3300006847 | Ga0075431_100099081 | Ga0075431_1000990813 | 135 |
| 52 | 3300006880 | Ga0075429_100016828 | Ga0075429_1000168284 | 135 |
| 53 | 3300009093 | Ga0105240_10002998 | Ga0105240_1000299826 | 135 |
| 54 | 3300009093 | Ga0105240_10044300 | Ga0105240_100443003 | 135 |
| 55 | 3300009093 | Ga0105240_10342207 | Ga0105240_103422072 | 135 |
| 56 | 3300009174 | Ga0105241_10000863 | Ga0105241_1000086325 | 135 |
| 57 | 3300009174 | Ga0105241_10981330 | Ga0105241_109813302 | 135 |
| 58 | 3300009545 | Ga0105237_10006921 | Ga0105237_100069214 | 135 |
| 59 | 3300009545 | Ga0105237_10012741 | Ga0105237_100127416 | 135 |
| 60 | 3300009545 | Ga0105237_10033058 | Ga0105237_100330585 | 135 |
| 61 | 3300009545 | Ga0105237_12270279 | Ga0105237_122702791 | 135 |
| 62 | 3300009551 | Ga0105238_10083431 | Ga0105238_100834313 | 135 |
| 63 | 3300009551 | Ga0105238_10098021 | Ga0105238_100980214 | 135 |
| 64 | 3300009553 | Ga0105249_10288109 | Ga0105249_102881093 | 135 |
| 65 | 3300009553 | Ga0105249_10325503 | Ga0105249_103255032 | 135 |
| 66 | 3300010375 | Ga0105239_10065178 | Ga0105239_100651782 | 135 |
| 67 | 3300010375 | Ga0105239_10701574 | Ga0105239_107015741 | 135 |
| 68 | 3300013100 | Ga0157373_10450547 | Ga0157373_104505472 | 135 |
| 69 | 3300013102 | Ga0157371_10001805 | Ga0157371_100018056 | 135 |
| 70 | 3300013104 | Ga0157370_10005721 | Ga0157370_100057217 | 135 |
| 71 | 3300013104 | Ga0157370_10789267 | Ga0157370_107892672 | 135 |
| 72 | 3300013105 | Ga0157369_10002231 | Ga0157369_100022316 | 135 |
| 73 | 3300013105 | Ga0157369_10732948 | Ga0157369_107329482 | 135 |
| 74 | 3300013105 | Ga0157369_11215149 | Ga0157369_112151492 | 135 |
| 75 | 3300013297 | Ga0157378_10803061 | Ga0157378_108030612 | 135 |
| 76 | 3300013306 | Ga0163162_10000629 | Ga0163162_100006297 | 135 |
| 77 | 3300013307 | Ga0157372_10000037 | Ga0157372_1000003783 | 135 |
| 78 | 3300013307 | Ga0157372_10001377 | Ga0157372_100013776 | 135 |
| 79 | 3300013307 | Ga0157372_10047730 | Ga0157372_100477303 | 135 |
| 80 | 3300013307 | Ga0157372_10072397 | Ga0157372_100723973 | 135 |
| 81 | 3300014325 | Ga0163163_11216953 | Ga0163163_112169531 | 135 |
| 82 | 3300014968 | Ga0157379_11348862 | Ga0157379_113488621 | 135 |
| 83 | 3300014969 | Ga0157376_10002175 | Ga0157376_100021759 | 135 |
| 84 | 3300014969 | Ga0157376_10923565 | Ga0157376_109235652 | 135 |
| 85 | 3300020070 | Ga0206356_10603259 | Ga0206356_106032591 | 135 |
| 86 | 3300025903 | Ga0207680_10045120 | Ga0207680_100451203 | 135 |
| 87 | 3300025911 | Ga0207654_10028722 | Ga0207654_100287224 | 135 |
| 88 | 3300025913 | Ga0207695_10008052 | Ga0207695_100080523 | 135 |
| 89 | 3300025913 | Ga0207695_10107237 | Ga0207695_101072372 | 135 |
| 90 | 3300025913 | Ga0207695_10162629 | Ga0207695_101626293 | 135 |
| 91 | 3300025913 | Ga0207695_10300084 | Ga0207695_103000841 | 135 |
| 92 | 3300025914 | Ga0207671_10002048 | Ga0207671_1000204817 | 135 |
| 93 | 3300025914 | Ga0207671_10010324 | Ga0207671_100103247 | 135 |
| 94 | 3300025924 | Ga0207694_10073674 | Ga0207694_100736742 | 135 |
| 95 | 3300025924 | Ga0207694_10096807 | Ga0207694_100968073 | 135 |
| 96 | 3300025924 | Ga0207694_10167063 | Ga0207694_101670634 | 135 |
| 97 | 3300025929 | Ga0207664_10467862 | Ga0207664_104678622 | 135 |
| 98 | 3300025942 | Ga0207689_10246936 | Ga0207689_102469362 | 135 |
| 99 | 3300025949 | Ga0207667_10000221 | Ga0207667_1000022137 | 135 |
| 100 | 3300025960 | Ga0207651_11529790 | Ga0207651_115297901 | 135 |
| 101 | 3300025961 | Ga0207712_10084685 | Ga0207712_100846852 | 135 |
| 102 | 3300025981 | Ga0207640_10010581 | Ga0207640_100105813 | 135 |
| 103 | 3300025986 | Ga0207658_11428033 | Ga0207658_114280331 | 135 |
| 104 | 3300026035 | Ga0207703_10456942 | Ga0207703_104569422 | 135 |
| 105 | 3300026041 | Ga0207639_10179344 | Ga0207639_101793442 | 135 |
| 106 | 3300026041 | Ga0207639_10248941 | Ga0207639_102489412 | 135 |
| 107 | 3300026067 | Ga0207678_10047465 | Ga0207678_100474651 | 135 |
| 108 | 3300026078 | Ga0207702_10158053 | Ga0207702_101580532 | 135 |
| 109 | 3300026078 | Ga0207702_10281688 | Ga0207702_102816883 | 135 |
| 110 | 3300026078 | Ga0207702_10498153 | Ga0207702_104981532 | 135 |
| 111 | 3300026116 | Ga0207674_10001679 | Ga0207674_1000167910 | 135 |
| 112 | 3300026142 | Ga0207698_10001412 | Ga0207698_100014127 | 135 |
| 113 | 3300026142 | Ga0207698_10702113 | Ga0207698_107021131 | 135 |
| 114 | 3300028379 | Ga0268266_10000024 | Ga0268266_1000002436 | 135 |
| 115 | 3300028381 | Ga0268264_10001493 | Ga0268264_1000149313 | 135 |
| 116 | 3300028381 | Ga0268264_10010098 | Ga0268264_100100987 | 135 |
| 117 | 3300031251 | Ga0265327_10235632 | Ga0265327_102356322 | 135 |
| 118 | 3300031727 | Ga0316576_10425192 | Ga0316576_104251922 | 135 |
| 119 | 3300031730 | Ga0307516_10046814 | Ga0307516_100468144 | 135 |
| 120 | 3300033179 | Ga0307507_10272888 | Ga0307507_102728882 | 135 |
| 121 | 3300035115 | Ga0373941_0368812 | Ga0373941_0368812_125_547 | 135 |
| 122 | 3300035692 | Ga0373935_0032806 | Ga0373935_0032806_1987_2412 | 135 |
| 123 | 3300037312 | Ga0395899_0000180 | Ga0395899_0000180_29779_30186 | 135 |
| 124 | 3300038443 | Ga0395901_0001566 | Ga0395901_0001566_316_729 | 135 |
| 125 | 3300038443 | Ga0395901_1210158 | Ga0395901_1210158_124_531 | 135 |
| 126 | 3300046460 | Ga0495638_0074516 | Ga0495638_0074516_133_543 | 135 |
| 127 | 3300046460 | Ga0495638_0110791 | Ga0495638_0110791_849_1259 | 135 |
| 128 | 3300046514 | Ga0495618_0371438 | Ga0495618_0371438_393_803 | 135 |
| 129 | 3300046522 | Ga0495643_0456929 | Ga0495643_0456929_39_449 | 135 |
| 130 | 3300046524 | Ga0495648_0011775 | Ga0495648_0011775_3731_4141 | 135 |
| 131 | 3300047443 | Ga0495687_000014 | Ga0495687_000014_336716_337126 | 135 |
| 132 | 3300048907 | Ga0496104_0683466 | Ga0496104_0683466_76_489 | 135 |
| 133 | 3300048927 | Ga0496124_0124389 | Ga0496124_0124389_437_853 | 135 |
| 134 | 3300050508 | nmdc:mga09592_32958_c1 | nmdc:mga09592_32958_c1_2395_2808 | 135 |
| 135 | 3300050509 | nmdc:mga0qj67_903642_c1 | nmdc:mga0qj67_903642_c1_263_676 | 135 |
| 136 | 3300050510 | nmdc:mga06r32_121458_c1 | nmdc:mga06r32_121458_c1_837_1250 | 135 |
| 137 | 3300053092 | Ga0500583_0032790 | Ga0500583_0032790_1377_1787 | 135 |
| 138 | 3300053098 | Ga0500650_0410761 | Ga0500650_0410761_112_540 | 135 |
| 139 | 3300053108 | Ga0500562_038083 | Ga0500562_038083_535_948 | 135 |
| 140 | 3300053130 | Ga0500642_0005225 | Ga0500642_0005225_2152_2562 | 135 |
| 141 | 3300053156 | Ga0500622_0001634 | Ga0500622_0001634_16714_17124 | 135 |
| 142 | iso_pu_bacteria | 2911138879 | 2911141165 | 135 |
| 143 | 3300003316 | rootH1_10061358 | rootH1_100613582 | 136 |
| 144 | 3300003316 | rootH1_10080978 | rootH1_1008097812 | 136 |
| 145 | 3300003320 | rootH2_10039028 | rootH2_100390282 | 136 |
| 146 | 3300003322 | rootL2_10039178 | rootL2_100391784 | 136 |
| 147 | 3300003323 | rootH1_10017748 | rootH1_1001774820 | 136 |
| 148 | 3300003323 | rootH1_10032442 | rootH1_100324423 | 136 |
| 149 | 3300003323 | rootH1_10165299 | rootH1_101652992 | 136 |
| 150 | 3300003781 | Ga0055536_1024319 | Ga0055536_10243192 | 136 |
| 151 | 3300003794 | Ga0055531_10000087 | Ga0055531_1000008747 | 136 |
| 152 | 3300005262 | Ga0065165_1000266 | Ga0065165_100026626 | 136 |
| 153 | 3300005347 | Ga0070668_100003612 | Ga0070668_1000036129 | 136 |
| 154 | 3300005354 | Ga0070675_100270345 | Ga0070675_1002703452 | 136 |
| 155 | 3300005356 | Ga0070674_100026112 | Ga0070674_1000261123 | 136 |
| 156 | 3300005364 | Ga0070673_100878738 | Ga0070673_1008787381 | 136 |
| 157 | 3300005445 | Ga0070708_100795902 | Ga0070708_1007959022 | 136 |
| 158 | 3300005518 | Ga0070699_100341480 | Ga0070699_1003414801 | 136 |
| 159 | 3300005530 | Ga0070679_102014294 | Ga0070679_1020142941 | 136 |
| 160 | 3300005536 | Ga0070697_100026466 | Ga0070697_1000264664 | 136 |
| 161 | 3300005539 | Ga0068853_100000874 | Ga0068853_1000008744 | 136 |
| 162 | 3300005543 | Ga0070672_100033813 | Ga0070672_1000338133 | 136 |
| 163 | 3300005545 | Ga0070695_100331086 | Ga0070695_1003310861 | 136 |
| 164 | 3300005616 | Ga0068852_100019930 | Ga0068852_1000199301 | 136 |
| 165 | 3300005719 | Ga0068861_100967103 | Ga0068861_1009671031 | 136 |
| 166 | 3300005834 | Ga0068851_10300758 | Ga0068851_103007582 | 136 |
| 167 | 3300005840 | Ga0068870_10326762 | Ga0068870_103267621 | 136 |
| 168 | 3300005844 | Ga0068862_100595671 | Ga0068862_1005956712 | 136 |
| 169 | 3300006195 | Ga0075366_10719836 | Ga0075366_107198362 | 136 |
| 170 | 3300006844 | Ga0075428_100558010 | Ga0075428_1005580102 | 136 |
| 171 | 3300006880 | Ga0075429_101532533 | Ga0075429_1015325332 | 136 |
| 172 | 3300006881 | Ga0068865_100851536 | Ga0068865_1008515362 | 136 |
| 173 | 3300009093 | Ga0105240_10022461 | Ga0105240_100224616 | 136 |
| 174 | 3300009174 | Ga0105241_10185156 | Ga0105241_101851562 | 136 |
| 175 | 3300010375 | Ga0105239_10008565 | Ga0105239_100085657 | 136 |
| 176 | 3300013102 | Ga0157371_10116766 | Ga0157371_101167663 | 136 |
| 177 | 3300013102 | Ga0157371_10122345 | Ga0157371_101223452 | 136 |
| 178 | 3300013102 | Ga0157371_10214082 | Ga0157371_102140822 | 136 |
| 179 | 3300013105 | Ga0157369_10797770 | Ga0157369_107977702 | 136 |
| 180 | 3300013296 | Ga0157374_10214722 | Ga0157374_102147222 | 136 |
| 181 | 3300013297 | Ga0157378_10118777 | Ga0157378_101187773 | 136 |
| 182 | 3300025292 | Ga0209676_1000495 | Ga0209676_100049550 | 136 |
| 183 | 3300025298 | Ga0209050_1063216 | Ga0209050_10632162 | 136 |
| 184 | 3300025304 | Ga0209257_1000006 | Ga0209257_1000006372 | 136 |
| 185 | 3300025315 | Ga0207697_10099868 | Ga0207697_100998682 | 136 |
| 186 | 3300025893 | Ga0207682_10408226 | Ga0207682_104082261 | 136 |
| 187 | 3300025904 | Ga0207647_10367202 | Ga0207647_103672021 | 136 |
| 188 | 3300025911 | Ga0207654_10161129 | Ga0207654_101611292 | 136 |
| 189 | 3300025913 | Ga0207695_10000698 | Ga0207695_1000069810 | 136 |
| 190 | 3300025913 | Ga0207695_10067154 | Ga0207695_100671544 | 136 |
| 191 | 3300025923 | Ga0207681_10069425 | Ga0207681_100694255 | 136 |
| 192 | 3300025926 | Ga0207659_10174966 | Ga0207659_101749661 | 136 |
| 193 | 3300025933 | Ga0207706_10132670 | Ga0207706_101326704 | 136 |
| 194 | 3300025938 | Ga0207704_10774515 | Ga0207704_107745151 | 136 |
| 195 | 3300025940 | Ga0207691_10010409 | Ga0207691_100104093 | 136 |
| 196 | 3300025941 | Ga0207711_10562959 | Ga0207711_105629592 | 136 |
| 197 | 3300025960 | Ga0207651_10399026 | Ga0207651_103990261 | 136 |
| 198 | 3300026041 | Ga0207639_10004269 | Ga0207639_100042697 | 136 |
| 199 | 3300026118 | Ga0207675_100286236 | Ga0207675_1002862362 | 136 |
| 200 | 3300026142 | Ga0207698_10060651 | Ga0207698_100606514 | 136 |
| 201 | 3300028380 | Ga0268265_10627597 | Ga0268265_106275972 | 136 |
| 202 | 3300031507 | Ga0307509_10143410 | Ga0307509_101434102 | 136 |
| 203 | 3300031548 | Ga0307408_101714617 | Ga0307408_1017146171 | 136 |
| 204 | 3300032004 | Ga0307414_11204686 | Ga0307414_112046862 | 136 |
| 205 | 3300041494 | Ga0451837_0791586 | Ga0451837_0791586_49_465 | 136 |
| 206 | 3300042876 | Ga0451577_0044596 | Ga0451577_0044596_1958_2368 | 136 |
| 207 | 3300042876 | Ga0451577_0574990 | Ga0451577_0574990_199_609 | 136 |
| 208 | 3300044683 | Ga0466965_0402474 | Ga0466965_0402474_62_487 | 136 |
| 209 | 3300044712 | Ga0453684_0017716 | Ga0453684_0017716_6348_6758 | 136 |
| 210 | 3300045051 | Ga0451576_0808796 | Ga0451576_0808796_61_471 | 136 |
| 211 | 3300045051 | Ga0451576_0891102 | Ga0451576_0891102_384_794 | 136 |
| 212 | 3300045051 | Ga0451576_2342195 | Ga0451576_2342195_64_474 | 136 |
| 213 | 3300046518 | Ga0495631_0307278 | Ga0495631_0307278_143_553 | 136 |
| 214 | 3300046810 | Ga0495660_0194926 | Ga0495660_0194926_13_423 | 136 |
| 215 | 3300050493 | nmdc:mga0k408_671400_c1 | nmdc:mga0k408_671400_c1_86_496 | 136 |
| 216 | 3300053153 | Ga0500616_0062110 | Ga0500616_0062110_1049_1459 | 136 |
| 217 | 3300059630 | Ga0587128_098417 | Ga0587128_098417_69_485 | 136 |
| 218 | 3300060244 | Ga0587061_05714 | Ga0587061_05714_98_514 | 136 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3i2b-assembly3.cif.gz_I | the crystal structure of human 6 pyruvoyl tetrahydrobiopterin synthase | 0.9357 | 1 | 136 |
| 1b66-assembly1.cif.gz_A | 6-pyruvoyl tetrahydropterin synthase | 0.9334 | 1 | 136 |
| 3i2b-assembly3.cif.gz_I | the crystal structure of human 6 pyruvoyl tetrahydrobiopterin synthase | 0.9291 | 1 | 136 |
| 2dtt-assembly1.cif.gz_A | crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from pyrococcus horikoshii ot3 complexed with (1'r,2's)-biopterin | 0.9269 | 1 | 132 |
| 1b66-assembly1.cif.gz_A | 6-pyruvoyl tetrahydropterin synthase | 0.9269 | 1 | 136 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q1ZXI0_1_135_3.30.479.10 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD | 0.9349 | 1 | 136 | 3.30.479.10 |
| 2dttD00 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD | 0.9211 | 1 | 132 | 3.30.479.10 |
| af_Q1ZXI0_1_135_3.30.479.10 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD | 0.9152 | 1 | 136 | 3.30.479.10 |
| 4ntmA00 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD | 0.9151 | 3 | 135 | 3.30.479.10 |
| 2g64A00 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD | 0.9038 | 1 | 136 | 3.30.479.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A090X5N0-F1-model_v4 | 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) | 0.9822 | 62 | 133 |
GO:0046872
GO:0070497 |
| AF-A0A512BBS9-F1-model_v4 | 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) | 0.9814 | 1 | 135 |
GO:0046872
GO:0070497 |
| AF-A0A4Q3BHY6-F1-model_v4 | 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.-.-.-) | 0.9804 | 2 | 136 |
GO:0008616
GO:0046872 GO:0070497 |
| AF-A0A0M9DSK3-F1-model_v4 | 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.-.-.-) | 0.9803 | 1 | 135 |
GO:0008616
GO:0046872 GO:0070497 |
| AF-A0A2E1AVZ2-F1-model_v4 | 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.-.-.-) | 0.9794 | 1 | 133 |
GO:0008616
GO:0046872 GO:0070497 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar