F329941

General Info

Members Datasets Scaffolds Average Seq Length
218 149 215 138

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10450547|Ga0157373_104505472
Length 155
Sequence LTFPQAPAYFLQALSPEQSMPRCRVTRRVHFNAAHRLHNPEATEGWNQATYGVCNNPNYHGHNYELIVQVTGTPDPATGYVMDMKVLSKITAEEVIERFDHKNLNLDTEFFQKLNPTAENIVIVIYNLLRTRIDAKLELKVRLHETERNFVEYPA

Samples

Sample ID Description Type Environment
1 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
2 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
3 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
4 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
109 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
112 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
115 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
116 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
117 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
120 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
121 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
122 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
123 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
124 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
127 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
128 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
129 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
130 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
131 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
132 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
133 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
134 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
135 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
138 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
139 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
140 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
141 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
142 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
143 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
144 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
145 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
146 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
147 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
148 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300060244 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 2R_CW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.79
Metatranscriptomes 1.38
Isolates 1.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.42
Nodule 0
Rhizoplane 0.92
Rhizosphere 85.32
Stem 0
Stem Tuber 0
Unclassified 7.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10061358 3300003316 Bacteria 4965
2 rootH1_10080978 3300003316 Bacteria 12372
3 rootH2_10039028 3300003320 Bacteria 3118
4 rootL2_10039178 3300003322 Bacteria 4477
5 rootL2_10080012 3300003322 Bacteria 3106
6 rootH1_10017748 3300003316 Bacteria 1169
7 rootH1_10017748 3300003323 Bacteria 20274
8 rootH1_10032442 3300003323 Bacteria 6027
9 rootH1_10131799 3300003323 Unclassified 4097
10 rootH1_10165299 3300003323 Bacteria 2173
11 Ga0055536_1024319 3300003781 Bacteria 1756
12 Ga0055531_10000087 3300003794 Bacteria 101553
13 Ga0065165_1000266 3300005262 Bacteria 90228
14 Ga0070670_100999159 3300005331 Bacteria 761
15 Ga0068869_100221033 3300005334 Bacteria 1501
16 Ga0070666_10053422 3300005335 Bacteria 2725
17 Ga0070661_100168979 3300005344 Bacteria 1660
18 Ga0070668_100003612 3300005347 Bacteria 11413
19 Ga0070675_100270345 3300005354 Bacteria 1491
20 Ga0070674_100026112 3300005356 Bacteria 3811
21 Ga0070673_100878738 3300005364 Bacteria 830
22 Ga0070659_101196185 3300005366 Bacteria 672
23 Ga0070709_10150311 3300005434 Bacteria 1609
24 Ga0070708_100795902 3300005445 Unclassified 889
25 Ga0070663_100019282 3300005455 Bacteria 4492
26 Ga0070685_10524065 3300005466 Bacteria 842
27 Ga0070699_100341480 3300005518 Bacteria 1348
28 Ga0070679_102014294 3300005530 Bacteria 526
29 Ga0070697_100026466 3300005536 Bacteria 4635
30 Ga0068853_100000874 3300005539 Bacteria 21037
31 Ga0068853_100032104 3300005539 Bacteria 4447
32 Ga0068853_100193166 3300005539 Bacteria 1850
33 Ga0068853_100809985 3300005539 Bacteria 897
34 Ga0070672_100033813 3300005543 Bacteria 3875
35 Ga0070672_100119770 3300005543 Bacteria 2154
36 Ga0070695_100331086 3300005545 Bacteria 1135
37 Ga0070665_100000013 3300005548 Bacteria 484927
38 Ga0068855_100097958 3300005563 Bacteria 3378
39 Ga0068855_101001038 3300005563 Bacteria 878
40 Ga0068857_100008489 3300005577 Bacteria 8880
41 Ga0068854_100020712 3300005578 Bacteria 4456
42 Ga0068856_100199380 3300005614 Bacteria 2016
43 Ga0068856_101285497 3300005614 Unclassified 747
44 Ga0068852_100002206 3300005616 Bacteria 13369
45 Ga0068852_100019930 3300005616 Bacteria 5323
46 Ga0068852_100542125 3300005616 Bacteria 1163
47 Ga0068852_102028703 3300005616 Bacteria 597
48 Ga0068852_102061945 3300005616 Bacteria 592
49 Ga0068864_100193014 3300005618 Bacteria 1868
50 Ga0068861_100967103 3300005719 Bacteria 811
51 Ga0068851_10300758 3300005834 Bacteria 922
52 Ga0068870_10326762 3300005840 Unclassified 976
53 Ga0068858_100568619 3300005842 Bacteria 1098
54 Ga0068860_100000596 3300005843 Bacteria 43134
55 Ga0068860_100086641 3300005843 Bacteria 2981
56 Ga0068862_100527334 3300005844 Unclassified 1125
57 Ga0068862_100595671 3300005844 Bacteria 1061
58 Ga0070717_10250724 3300006028 Bacteria 1564
59 Ga0075366_10719836 3300006195 Bacteria 620
60 Ga0097621_100154339 3300006237 Bacteria 1970
61 Ga0068871_100122232 3300006358 Bacteria 2200
62 Ga0068871_100282062 3300006358 Bacteria 1453
63 Ga0075428_100007490 3300006844 Bacteria 12094
64 Ga0075428_100558010 3300006844 Bacteria 1224
65 Ga0075430_101062053 3300006846 Bacteria 667
66 Ga0075431_100099081 3300006847 Bacteria 3008
67 Ga0075429_100016828 3300006880 Bacteria 6329
68 Ga0075429_101532533 3300006880 Bacteria 580
69 Ga0068865_100851536 3300006881 Bacteria 790
70 Ga0105240_10002998 3300009093 Bacteria 26564
71 Ga0105240_10022461 3300009093 Bacteria 8362
72 Ga0105240_10044300 3300009093 Bacteria 5655
73 Ga0105240_10342207 3300009093 Bacteria 1699
74 Ga0105241_10000863 3300009174 Bacteria 23000
75 Ga0105241_10185156 3300009174 Bacteria 1730
76 Ga0105241_10981330 3300009174 Unclassified 789
77 Ga0105248_10015606 3300009177 Bacteria 8373
78 Ga0105248_10516983 3300009177 Bacteria 1346
79 Ga0105237_10006921 3300009545 Bacteria 12505
80 Ga0105237_10012741 3300009545 Bacteria 8845
81 Ga0105237_10033058 3300009545 Bacteria 5239
82 Ga0105237_12270279 3300009545 Bacteria 552
83 Ga0105238_10083431 3300009551 Bacteria 3185
84 Ga0105238_10098021 3300009551 Bacteria 2916
85 Ga0105249_10288109 3300009553 Unclassified 1643
86 Ga0105249_10325503 3300009553 Bacteria 1549
87 Ga0105239_10008565 3300010375 Bacteria 11608
88 Ga0105239_10065178 3300010375 Bacteria 4000
89 Ga0105239_10701574 3300010375 Unclassified 1157
90 Ga0157373_10450547 3300013100 Bacteria 926
91 Ga0157371_10001805 3300013102 Bacteria 21630
92 Ga0157371_10116766 3300013102 Bacteria 1896
93 Ga0157371_10122345 3300013102 Bacteria 1850
94 Ga0157371_10214082 3300013102 Bacteria 1383
95 Ga0157370_10005721 3300013104 Bacteria 13898
96 Ga0157370_10789267 3300013104 Bacteria 864
97 Ga0157369_10002231 3300013105 Bacteria 23333
98 Ga0157369_10732948 3300013105 Bacteria 1017
99 Ga0157369_10797770 3300013105 Bacteria 970
100 Ga0157369_11215149 3300013105 Bacteria 769
101 Ga0157374_10214722 3300013296 Bacteria 1887
102 Ga0157378_10118777 3300013297 Bacteria 2434
103 Ga0157378_10803061 3300013297 Bacteria 967
104 Ga0163162_10000629 3300013306 Bacteria 32711
105 Ga0157372_10000037 3300013307 Bacteria 172444
106 Ga0157372_10001377 3300013307 Bacteria 26250
107 Ga0157372_10047730 3300013307 Bacteria 4759
108 Ga0157372_10072397 3300013307 Bacteria 3884
109 Ga0157375_10919501 3300013308 Unclassified 1018
110 Ga0163163_11216953 3300014325 Bacteria 816
111 Ga0157379_10044690 3300014968 Bacteria 3954
112 Ga0157379_11348862 3300014968 Bacteria 690
113 Ga0157376_10002175 3300014969 Bacteria 13199
114 Ga0157376_10162548 3300014969 Bacteria 2026
115 Ga0157376_10923565 3300014969 Bacteria 892
116 Ga0206356_10603259 3300020070 Unclassified 859
117 Ga0209676_1000495 3300025292 Bacteria 63184
118 Ga0209050_1063216 3300025298 Bacteria 864
119 Ga0209257_1000006 3300025304 Bacteria 1570111
120 Ga0207697_10099868 3300025315 Bacteria 1236
121 Ga0207656_10472275 3300025321 Unclassified 635
122 Ga0207682_10408226 3300025893 Unclassified 642
123 Ga0207680_10045120 3300025903 Bacteria 2597
124 Ga0207647_10367202 3300025904 Bacteria 814
125 Ga0207654_10028722 3300025911 Bacteria 3035
126 Ga0207654_10161129 3300025911 Bacteria 1449
127 Ga0207695_10000698 3300025913 Bacteria 65751
128 Ga0207695_10008052 3300025913 Bacteria 13269
129 Ga0207695_10067154 3300025913 Bacteria 3680
130 Ga0207695_10107237 3300025913 Bacteria 2779
131 Ga0207695_10162629 3300025913 Bacteria 2163
132 Ga0207695_10300084 3300025913 Unclassified 1498
133 Ga0207671_10002048 3300025914 Bacteria 22134
134 Ga0207671_10010324 3300025914 Bacteria 7716
135 Ga0207681_10069425 3300025923 Bacteria 2451
136 Ga0207694_10073674 3300025924 Bacteria 2672
137 Ga0207694_10096807 3300025924 Bacteria 2334
138 Ga0207694_10167063 3300025924 Unclassified 1780
139 Ga0207659_10174966 3300025926 Bacteria 1696
140 Ga0207664_10467862 3300025929 Bacteria 1127
141 Ga0207706_10132670 3300025933 Bacteria 2191
142 Ga0207704_10774515 3300025938 Unclassified 799
143 Ga0207691_10010409 3300025940 Bacteria 8922
144 Ga0207711_10562959 3300025941 Bacteria 1063
145 Ga0207689_10246936 3300025942 Bacteria 1476
146 Ga0207667_10000221 3300025949 Bacteria 79940
147 Ga0207651_10399026 3300025960 Bacteria 1169
148 Ga0207651_11529790 3300025960 Bacteria 601
149 Ga0207712_10084685 3300025961 Bacteria 2317
150 Ga0207640_10010581 3300025981 Bacteria 5204
151 Ga0207658_11428033 3300025986 Unclassified 633
152 Ga0207703_10456942 3300026035 Unclassified 1194
153 Ga0207639_10004269 3300026041 Bacteria 9636
154 Ga0207639_10179344 3300026041 Bacteria 1800
155 Ga0207639_10248941 3300026041 Bacteria 1549
156 Ga0207678_10047465 3300026067 Bacteria 3714
157 Ga0207702_10158053 3300026078 Bacteria 2068
158 Ga0207702_10281688 3300026078 Bacteria 1572
159 Ga0207702_10498153 3300026078 Unclassified 1187
160 Ga0207674_10001679 3300026116 Bacteria 28464
161 Ga0207675_100286236 3300026118 Bacteria 1602
162 Ga0207698_10001412 3300026142 Bacteria 13929
163 Ga0207698_10060651 3300026142 Bacteria 2943
164 Ga0207698_10702113 3300026142 Bacteria 1007
165 Ga0268266_10000024 3300028379 Bacteria 490820
166 Ga0268265_10627597 3300028380 Bacteria 1030
167 Ga0268264_10001493 3300028381 Bacteria 21826
168 Ga0268264_10010098 3300028381 Bacteria 7812
169 Ga0265327_10235632 3300031251 Bacteria 819
170 Ga0307509_10143410 3300031507 Unclassified 2319
171 Ga0307408_101714617 3300031548 Bacteria 599
172 Ga0316576_10425192 3300031727 Bacteria 983
173 Ga0307516_10046814 3300031730 Unclassified 4266
174 Ga0307414_11204686 3300032004 Bacteria 701
175 Ga0307507_10272888 3300033179 Bacteria 1066
176 Ga0373941_0368812 3300035115 Unclassified 588
177 Ga0373935_0032806 3300035692 Bacteria 3229
178 Ga0395899_0000180 3300037312 Bacteria 92701
179 Ga0395901_0001566 3300038443 Bacteria 23712
180 Ga0395901_1210158 3300038443 Bacteria 721
181 Ga0436363_0179576 3300039450 Bacteria 2868
182 Ga0451807_1918947 3300041486 Unclassified 1171
183 Ga0451837_0791586 3300041494 Bacteria 820
184 Ga0451577_0044596 3300042876 Bacteria 3970
185 Ga0451577_0574990 3300042876 Bacteria 1023
186 Ga0466965_0402474 3300044683 Bacteria 756
187 Ga0453684_0017716 3300044712 Bacteria 11003
188 Ga0451576_0808796 3300045051 Bacteria 984
189 Ga0451576_0891102 3300045051 Bacteria 934
190 Ga0451576_2342195 3300045051 Bacteria 547
191 Ga0495603_0044759 3300046455 Bacteria 2641
192 Ga0495638_0074516 3300046460 Bacteria 2070
193 Ga0495638_0110791 3300046460 Bacteria 1631
194 Ga0495618_0371438 3300046514 Unclassified 879
195 Ga0495631_0307278 3300046518 Bacteria 675
196 Ga0495643_0456929 3300046522 Unclassified 555
197 Ga0495648_0011775 3300046524 Bacteria 6565
198 Ga0495633_0182808 3300046558 Bacteria 965
199 Ga0495670_0378299 3300046691 Unclassified 764
200 Ga0495660_0194926 3300046810 Bacteria 971
201 Ga0495687_000014 3300047443 Bacteria 366896
202 Ga0496104_0683466 3300048907 Bacteria 934
203 Ga0496124_0124389 3300048927 Bacteria 2056
204 nmdc:mga0k408_671400_c1 3300050493 Bacteria 608
205 nmdc:mga09592_32958_c1 3300050508 Bacteria 4321
206 nmdc:mga0qj67_903642_c1 3300050509 Bacteria 696
207 nmdc:mga06r32_121458_c1 3300050510 Bacteria 2577
208 Ga0500583_0032790 3300053092 Bacteria 2294
209 Ga0500650_0410761 3300053098 Unclassified 585
210 Ga0500562_038083 3300053108 Bacteria 1277
211 Ga0500642_0005225 3300053130 Bacteria 4171
212 Ga0500616_0062110 3300053153 Unclassified 1931
213 Ga0500622_0001634 3300053156 Bacteria 17538
214 Ga0587128_098417 3300059630 Bacteria 610
215 Ga0587061_05714 3300060244 Bacteria 596

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005434 Ga0070709_10150311 Ga0070709_101503112 128
2 3300009177 Ga0105248_10015606 Ga0105248_100156064 128
3 3300009177 Ga0105248_10516983 Ga0105248_105169831 128
4 3300013308 Ga0157375_10919501 Ga0157375_109195012 128
5 3300014968 Ga0157379_10044690 Ga0157379_100446903 128
6 3300014969 Ga0157376_10162548 Ga0157376_101625483 128
7 3300046455 Ga0495603_0044759 Ga0495603_0044759_140_526 128
8 3300046558 Ga0495633_0182808 Ga0495633_0182808_312_698 128
9 3300046691 Ga0495670_0378299 Ga0495670_0378299_335_721 128
10 iso_pu_bacteria 2739367866 2740031267 131
11 iso_pu_bacteria 2958512119 2958514474 132
12 3300025321 Ga0207656_10472275 Ga0207656_104722752 133
13 3300006028 Ga0070717_10250724 Ga0070717_102507242 134
14 3300039450 Ga0436363_0179576 Ga0436363_0179576_1234_1707 134
15 3300041486 Ga0451807_1918947 Ga0451807_1918947_14_418 134
16 iso_pu_bacteria 2884933994 2884936855 134
17 3300003322 rootL2_10080012 rootL2_100800123 135
18 3300003323 rootH1_10131799 rootH1_101317993 135
19 3300005331 Ga0070670_100999159 Ga0070670_1009991592 135
20 3300005334 Ga0068869_100221033 Ga0068869_1002210332 135
21 3300005335 Ga0070666_10053422 Ga0070666_100534223 135
22 3300005344 Ga0070661_100168979 Ga0070661_1001689793 135
23 3300005366 Ga0070659_101196185 Ga0070659_1011961851 135
24 3300005455 Ga0070663_100019282 Ga0070663_1000192821 135
25 3300005466 Ga0070685_10524065 Ga0070685_105240652 135
26 3300005539 Ga0068853_100032104 Ga0068853_1000321044 135
27 3300005539 Ga0068853_100193166 Ga0068853_1001931663 135
28 3300005539 Ga0068853_100809985 Ga0068853_1008099852 135
29 3300005543 Ga0070672_100119770 Ga0070672_1001197703 135
30 3300005548 Ga0070665_100000013 Ga0070665_100000013368 135
31 3300005563 Ga0068855_100097958 Ga0068855_1000979583 135
32 3300005563 Ga0068855_101001038 Ga0068855_1010010382 135
33 3300005577 Ga0068857_100008489 Ga0068857_10000848911 135
34 3300005578 Ga0068854_100020712 Ga0068854_1000207126 135
35 3300005614 Ga0068856_100199380 Ga0068856_1001993802 135
36 3300005614 Ga0068856_101285497 Ga0068856_1012854972 135
37 3300005616 Ga0068852_100002206 Ga0068852_1000022067 135
38 3300005616 Ga0068852_100542125 Ga0068852_1005421252 135
39 3300005616 Ga0068852_102028703 Ga0068852_1020287032 135
40 3300005616 Ga0068852_102061945 Ga0068852_1020619452 135
41 3300005618 Ga0068864_100193014 Ga0068864_1001930143 135
42 3300005842 Ga0068858_100568619 Ga0068858_1005686192 135
43 3300005843 Ga0068860_100000596 Ga0068860_1000005967 135
44 3300005843 Ga0068860_100086641 Ga0068860_1000866415 135
45 3300005844 Ga0068862_100527334 Ga0068862_1005273343 135
46 3300006237 Ga0097621_100154339 Ga0097621_1001543393 135
47 3300006358 Ga0068871_100122232 Ga0068871_1001222322 135
48 3300006358 Ga0068871_100282062 Ga0068871_1002820623 135
49 3300006844 Ga0075428_100007490 Ga0075428_1000074906 135
50 3300006846 Ga0075430_101062053 Ga0075430_1010620531 135
51 3300006847 Ga0075431_100099081 Ga0075431_1000990813 135
52 3300006880 Ga0075429_100016828 Ga0075429_1000168284 135
53 3300009093 Ga0105240_10002998 Ga0105240_1000299826 135
54 3300009093 Ga0105240_10044300 Ga0105240_100443003 135
55 3300009093 Ga0105240_10342207 Ga0105240_103422072 135
56 3300009174 Ga0105241_10000863 Ga0105241_1000086325 135
57 3300009174 Ga0105241_10981330 Ga0105241_109813302 135
58 3300009545 Ga0105237_10006921 Ga0105237_100069214 135
59 3300009545 Ga0105237_10012741 Ga0105237_100127416 135
60 3300009545 Ga0105237_10033058 Ga0105237_100330585 135
61 3300009545 Ga0105237_12270279 Ga0105237_122702791 135
62 3300009551 Ga0105238_10083431 Ga0105238_100834313 135
63 3300009551 Ga0105238_10098021 Ga0105238_100980214 135
64 3300009553 Ga0105249_10288109 Ga0105249_102881093 135
65 3300009553 Ga0105249_10325503 Ga0105249_103255032 135
66 3300010375 Ga0105239_10065178 Ga0105239_100651782 135
67 3300010375 Ga0105239_10701574 Ga0105239_107015741 135
68 3300013100 Ga0157373_10450547 Ga0157373_104505472 135
69 3300013102 Ga0157371_10001805 Ga0157371_100018056 135
70 3300013104 Ga0157370_10005721 Ga0157370_100057217 135
71 3300013104 Ga0157370_10789267 Ga0157370_107892672 135
72 3300013105 Ga0157369_10002231 Ga0157369_100022316 135
73 3300013105 Ga0157369_10732948 Ga0157369_107329482 135
74 3300013105 Ga0157369_11215149 Ga0157369_112151492 135
75 3300013297 Ga0157378_10803061 Ga0157378_108030612 135
76 3300013306 Ga0163162_10000629 Ga0163162_100006297 135
77 3300013307 Ga0157372_10000037 Ga0157372_1000003783 135
78 3300013307 Ga0157372_10001377 Ga0157372_100013776 135
79 3300013307 Ga0157372_10047730 Ga0157372_100477303 135
80 3300013307 Ga0157372_10072397 Ga0157372_100723973 135
81 3300014325 Ga0163163_11216953 Ga0163163_112169531 135
82 3300014968 Ga0157379_11348862 Ga0157379_113488621 135
83 3300014969 Ga0157376_10002175 Ga0157376_100021759 135
84 3300014969 Ga0157376_10923565 Ga0157376_109235652 135
85 3300020070 Ga0206356_10603259 Ga0206356_106032591 135
86 3300025903 Ga0207680_10045120 Ga0207680_100451203 135
87 3300025911 Ga0207654_10028722 Ga0207654_100287224 135
88 3300025913 Ga0207695_10008052 Ga0207695_100080523 135
89 3300025913 Ga0207695_10107237 Ga0207695_101072372 135
90 3300025913 Ga0207695_10162629 Ga0207695_101626293 135
91 3300025913 Ga0207695_10300084 Ga0207695_103000841 135
92 3300025914 Ga0207671_10002048 Ga0207671_1000204817 135
93 3300025914 Ga0207671_10010324 Ga0207671_100103247 135
94 3300025924 Ga0207694_10073674 Ga0207694_100736742 135
95 3300025924 Ga0207694_10096807 Ga0207694_100968073 135
96 3300025924 Ga0207694_10167063 Ga0207694_101670634 135
97 3300025929 Ga0207664_10467862 Ga0207664_104678622 135
98 3300025942 Ga0207689_10246936 Ga0207689_102469362 135
99 3300025949 Ga0207667_10000221 Ga0207667_1000022137 135
100 3300025960 Ga0207651_11529790 Ga0207651_115297901 135
101 3300025961 Ga0207712_10084685 Ga0207712_100846852 135
102 3300025981 Ga0207640_10010581 Ga0207640_100105813 135
103 3300025986 Ga0207658_11428033 Ga0207658_114280331 135
104 3300026035 Ga0207703_10456942 Ga0207703_104569422 135
105 3300026041 Ga0207639_10179344 Ga0207639_101793442 135
106 3300026041 Ga0207639_10248941 Ga0207639_102489412 135
107 3300026067 Ga0207678_10047465 Ga0207678_100474651 135
108 3300026078 Ga0207702_10158053 Ga0207702_101580532 135
109 3300026078 Ga0207702_10281688 Ga0207702_102816883 135
110 3300026078 Ga0207702_10498153 Ga0207702_104981532 135
111 3300026116 Ga0207674_10001679 Ga0207674_1000167910 135
112 3300026142 Ga0207698_10001412 Ga0207698_100014127 135
113 3300026142 Ga0207698_10702113 Ga0207698_107021131 135
114 3300028379 Ga0268266_10000024 Ga0268266_1000002436 135
115 3300028381 Ga0268264_10001493 Ga0268264_1000149313 135
116 3300028381 Ga0268264_10010098 Ga0268264_100100987 135
117 3300031251 Ga0265327_10235632 Ga0265327_102356322 135
118 3300031727 Ga0316576_10425192 Ga0316576_104251922 135
119 3300031730 Ga0307516_10046814 Ga0307516_100468144 135
120 3300033179 Ga0307507_10272888 Ga0307507_102728882 135
121 3300035115 Ga0373941_0368812 Ga0373941_0368812_125_547 135
122 3300035692 Ga0373935_0032806 Ga0373935_0032806_1987_2412 135
123 3300037312 Ga0395899_0000180 Ga0395899_0000180_29779_30186 135
124 3300038443 Ga0395901_0001566 Ga0395901_0001566_316_729 135
125 3300038443 Ga0395901_1210158 Ga0395901_1210158_124_531 135
126 3300046460 Ga0495638_0074516 Ga0495638_0074516_133_543 135
127 3300046460 Ga0495638_0110791 Ga0495638_0110791_849_1259 135
128 3300046514 Ga0495618_0371438 Ga0495618_0371438_393_803 135
129 3300046522 Ga0495643_0456929 Ga0495643_0456929_39_449 135
130 3300046524 Ga0495648_0011775 Ga0495648_0011775_3731_4141 135
131 3300047443 Ga0495687_000014 Ga0495687_000014_336716_337126 135
132 3300048907 Ga0496104_0683466 Ga0496104_0683466_76_489 135
133 3300048927 Ga0496124_0124389 Ga0496124_0124389_437_853 135
134 3300050508 nmdc:mga09592_32958_c1 nmdc:mga09592_32958_c1_2395_2808 135
135 3300050509 nmdc:mga0qj67_903642_c1 nmdc:mga0qj67_903642_c1_263_676 135
136 3300050510 nmdc:mga06r32_121458_c1 nmdc:mga06r32_121458_c1_837_1250 135
137 3300053092 Ga0500583_0032790 Ga0500583_0032790_1377_1787 135
138 3300053098 Ga0500650_0410761 Ga0500650_0410761_112_540 135
139 3300053108 Ga0500562_038083 Ga0500562_038083_535_948 135
140 3300053130 Ga0500642_0005225 Ga0500642_0005225_2152_2562 135
141 3300053156 Ga0500622_0001634 Ga0500622_0001634_16714_17124 135
142 iso_pu_bacteria 2911138879 2911141165 135
143 3300003316 rootH1_10061358 rootH1_100613582 136
144 3300003316 rootH1_10080978 rootH1_1008097812 136
145 3300003320 rootH2_10039028 rootH2_100390282 136
146 3300003322 rootL2_10039178 rootL2_100391784 136
147 3300003323 rootH1_10017748 rootH1_1001774820 136
148 3300003323 rootH1_10032442 rootH1_100324423 136
149 3300003323 rootH1_10165299 rootH1_101652992 136
150 3300003781 Ga0055536_1024319 Ga0055536_10243192 136
151 3300003794 Ga0055531_10000087 Ga0055531_1000008747 136
152 3300005262 Ga0065165_1000266 Ga0065165_100026626 136
153 3300005347 Ga0070668_100003612 Ga0070668_1000036129 136
154 3300005354 Ga0070675_100270345 Ga0070675_1002703452 136
155 3300005356 Ga0070674_100026112 Ga0070674_1000261123 136
156 3300005364 Ga0070673_100878738 Ga0070673_1008787381 136
157 3300005445 Ga0070708_100795902 Ga0070708_1007959022 136
158 3300005518 Ga0070699_100341480 Ga0070699_1003414801 136
159 3300005530 Ga0070679_102014294 Ga0070679_1020142941 136
160 3300005536 Ga0070697_100026466 Ga0070697_1000264664 136
161 3300005539 Ga0068853_100000874 Ga0068853_1000008744 136
162 3300005543 Ga0070672_100033813 Ga0070672_1000338133 136
163 3300005545 Ga0070695_100331086 Ga0070695_1003310861 136
164 3300005616 Ga0068852_100019930 Ga0068852_1000199301 136
165 3300005719 Ga0068861_100967103 Ga0068861_1009671031 136
166 3300005834 Ga0068851_10300758 Ga0068851_103007582 136
167 3300005840 Ga0068870_10326762 Ga0068870_103267621 136
168 3300005844 Ga0068862_100595671 Ga0068862_1005956712 136
169 3300006195 Ga0075366_10719836 Ga0075366_107198362 136
170 3300006844 Ga0075428_100558010 Ga0075428_1005580102 136
171 3300006880 Ga0075429_101532533 Ga0075429_1015325332 136
172 3300006881 Ga0068865_100851536 Ga0068865_1008515362 136
173 3300009093 Ga0105240_10022461 Ga0105240_100224616 136
174 3300009174 Ga0105241_10185156 Ga0105241_101851562 136
175 3300010375 Ga0105239_10008565 Ga0105239_100085657 136
176 3300013102 Ga0157371_10116766 Ga0157371_101167663 136
177 3300013102 Ga0157371_10122345 Ga0157371_101223452 136
178 3300013102 Ga0157371_10214082 Ga0157371_102140822 136
179 3300013105 Ga0157369_10797770 Ga0157369_107977702 136
180 3300013296 Ga0157374_10214722 Ga0157374_102147222 136
181 3300013297 Ga0157378_10118777 Ga0157378_101187773 136
182 3300025292 Ga0209676_1000495 Ga0209676_100049550 136
183 3300025298 Ga0209050_1063216 Ga0209050_10632162 136
184 3300025304 Ga0209257_1000006 Ga0209257_1000006372 136
185 3300025315 Ga0207697_10099868 Ga0207697_100998682 136
186 3300025893 Ga0207682_10408226 Ga0207682_104082261 136
187 3300025904 Ga0207647_10367202 Ga0207647_103672021 136
188 3300025911 Ga0207654_10161129 Ga0207654_101611292 136
189 3300025913 Ga0207695_10000698 Ga0207695_1000069810 136
190 3300025913 Ga0207695_10067154 Ga0207695_100671544 136
191 3300025923 Ga0207681_10069425 Ga0207681_100694255 136
192 3300025926 Ga0207659_10174966 Ga0207659_101749661 136
193 3300025933 Ga0207706_10132670 Ga0207706_101326704 136
194 3300025938 Ga0207704_10774515 Ga0207704_107745151 136
195 3300025940 Ga0207691_10010409 Ga0207691_100104093 136
196 3300025941 Ga0207711_10562959 Ga0207711_105629592 136
197 3300025960 Ga0207651_10399026 Ga0207651_103990261 136
198 3300026041 Ga0207639_10004269 Ga0207639_100042697 136
199 3300026118 Ga0207675_100286236 Ga0207675_1002862362 136
200 3300026142 Ga0207698_10060651 Ga0207698_100606514 136
201 3300028380 Ga0268265_10627597 Ga0268265_106275972 136
202 3300031507 Ga0307509_10143410 Ga0307509_101434102 136
203 3300031548 Ga0307408_101714617 Ga0307408_1017146171 136
204 3300032004 Ga0307414_11204686 Ga0307414_112046862 136
205 3300041494 Ga0451837_0791586 Ga0451837_0791586_49_465 136
206 3300042876 Ga0451577_0044596 Ga0451577_0044596_1958_2368 136
207 3300042876 Ga0451577_0574990 Ga0451577_0574990_199_609 136
208 3300044683 Ga0466965_0402474 Ga0466965_0402474_62_487 136
209 3300044712 Ga0453684_0017716 Ga0453684_0017716_6348_6758 136
210 3300045051 Ga0451576_0808796 Ga0451576_0808796_61_471 136
211 3300045051 Ga0451576_0891102 Ga0451576_0891102_384_794 136
212 3300045051 Ga0451576_2342195 Ga0451576_2342195_64_474 136
213 3300046518 Ga0495631_0307278 Ga0495631_0307278_143_553 136
214 3300046810 Ga0495660_0194926 Ga0495660_0194926_13_423 136
215 3300050493 nmdc:mga0k408_671400_c1 nmdc:mga0k408_671400_c1_86_496 136
216 3300053153 Ga0500616_0062110 Ga0500616_0062110_1049_1459 136
217 3300059630 Ga0587128_098417 Ga0587128_098417_69_485 136
218 3300060244 Ga0587061_05714 Ga0587061_05714_98_514 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01242

PTPS

6-pyruvoyl tetrahydropterin synthase

24

155

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i2b-assembly3.cif.gz_I the crystal structure of human 6 pyruvoyl tetrahydrobiopterin synthase 0.9357 1 136
1b66-assembly1.cif.gz_A 6-pyruvoyl tetrahydropterin synthase 0.9334 1 136
3i2b-assembly3.cif.gz_I the crystal structure of human 6 pyruvoyl tetrahydrobiopterin synthase 0.9291 1 136
2dtt-assembly1.cif.gz_A crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from pyrococcus horikoshii ot3 complexed with (1'r,2's)-biopterin 0.9269 1 132
1b66-assembly1.cif.gz_A 6-pyruvoyl tetrahydropterin synthase 0.9269 1 136
ID Description Score Start End Superfamily
af_Q1ZXI0_1_135_3.30.479.10 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9349 1 136 3.30.479.10
2dttD00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9211 1 132 3.30.479.10
af_Q1ZXI0_1_135_3.30.479.10 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9152 1 136 3.30.479.10
4ntmA00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9151 3 135 3.30.479.10
2g64A00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9038 1 136 3.30.479.10
ID Description Score Start End GO Terms
AF-A0A090X5N0-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9822 62 133 GO:0046872
GO:0070497
AF-A0A512BBS9-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9814 1 135 GO:0046872
GO:0070497
AF-A0A4Q3BHY6-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.-.-.-) 0.9804 2 136 GO:0008616
GO:0046872
GO:0070497
AF-A0A0M9DSK3-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.-.-.-) 0.9803 1 135 GO:0008616
GO:0046872
GO:0070497
AF-A0A2E1AVZ2-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.-.-.-) 0.9794 1 133 GO:0008616
GO:0046872
GO:0070497

Feature Viewer

pLDDT pTM Quality
96.41 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map