F329271

General Info

Members Datasets Scaffolds Average Seq Length
217 132 181 237

Family's Representative Sequence

Representative Sequence 3300049763|Ga0501266_000007|Ga0501266_000007_106565_107401
Length 278
Sequence LQTLRKSLRTLRLNYSQKKNRIDFGKIRNNRIFASQNKKLVMGRAFEFRKGRKMKRWSAMAKTFTRIGKDIVMAVKEGGPNPDANSRLRAVIQNAKAANMPKDNVERAIKNASNKDTANYKEILFEGYAPHGIAILIETASDNNNRTVANIRSYFNKCNGTMGTQGSVEFMFDHTCNFRIAKGNLDPEELELELIDFGAEEVFEDEDGILIYAPFGSFGALQKELENRGLEILSSGFERIPQITKELTEAQIADVEKLIEKIEEDDDVMNVYHTMKEE

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
3 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
4 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
5 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
6 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
7 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
8 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
9 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
10 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
11 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
12 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
13 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
14 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
15 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
16 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
17 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
18 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
19 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
20 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
21 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
22 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
23 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
24 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
25 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
26 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
27 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
28 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
29 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
30 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
31 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
32 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
33 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
34 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
35 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
37 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
38 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
46 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
47 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
48 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
61 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
62 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
63 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
64 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
65 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
66 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
67 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
68 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
69 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
70 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
71 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
72 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
73 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
74 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
75 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
77 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
78 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
79 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
80 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
81 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
82 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
83 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
84 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
85 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
86 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
87 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
88 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
89 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
90 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
91 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
92 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
93 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
94 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
95 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
96 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
97 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
98 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
99 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
100 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
101 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
102 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
103 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
104 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
105 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
106 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
107 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
108 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
109 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
119 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
120 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
121 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
122 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
125 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
126 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
127 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
128 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
129 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
130 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
131 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
132 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.49
Metatranscriptomes 0.92
Isolates 16.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.3
Nodule 2.3
Rhizoplane 0.92
Rhizosphere 79.26
Stem 0
Stem Tuber 0
Unclassified 15.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214717169 2209111006 Bacteria 1009
2 rootH2_10090078 3300003320 Bacteria 3956
3 Ga0006562J51391_1004994 3300003578 Bacteria 3055
4 Ga0065714_10030957 3300005288 Bacteria 969
5 Ga0065714_10073664 3300005288 Bacteria 3151
6 Ga0065714_10117679 3300005288 Bacteria 1386
7 Ga0065704_10089831 3300005289 Bacteria 2829
8 Ga0065712_10138728 3300005290 Bacteria 1471
9 Ga0065715_10214245 3300005293 Bacteria 1300
10 Ga0070680_100002381 3300005336 Bacteria 13906
11 Ga0070667_100306259 3300005367 Unclassified 1431
12 Ga0070678_100337848 3300005456 Bacteria 1291
13 Ga0070693_100019463 3300005547 Bacteria 3559
14 Ga0097621_100018892 3300006237 Bacteria 5279
15 Ga0068871_100024912 3300006358 Bacteria 4646
16 Ga0099824_1012791 3300006942 Bacteria 8981
17 Ga0099826_10017550 3300006948 Bacteria 5407
18 Ga0105251_10178937 3300009011 Bacteria 955
19 Ga0105244_10000003 3300009036 Bacteria 494610
20 Ga0105237_10319944 3300009545 Unclassified 1555
21 Ga0157373_10000014 3300013100 Bacteria 185079
22 Ga0157373_10324943 3300013100 Bacteria 1095
23 Ga0157371_10013686 3300013102 Bacteria 6154
24 Ga0157371_10019027 3300013102 Bacteria 5069
25 Ga0157371_10107610 3300013102 Bacteria 1979
26 Ga0157371_10255009 3300013102 Bacteria 1264
27 Ga0157370_10000060 3300013104 Bacteria 116178
28 Ga0157370_10201089 3300013104 Bacteria 1848
29 Ga0157370_10212147 3300013104 Bacteria 1794
30 Ga0157369_10000766 3300013105 Bacteria 41505
31 Ga0157369_10189196 3300013105 Unclassified 2163
32 Ga0163162_10026195 3300013306 Bacteria 5763
33 Ga0163162_10897456 3300013306 Bacteria 1000
34 Ga0157376_10016667 3300014969 Bacteria 5585
35 Ga0157376_10030344 3300014969 Bacteria 4317
36 Ga0157376_10066405 3300014969 Bacteria 3049
37 Ga0157376_10536794 3300014969 Bacteria 1155
38 Ga0182006_1042681 3300015261 Bacteria 1775
39 Ga0163161_10000119 3300017792 Bacteria 74760
40 Ga0163161_10001302 3300017792 Bacteria 18594
41 Ga0163161_10034990 3300017792 Bacteria 3594
42 Ga0207655_1000010 3300025728 Bacteria 649325
43 Ga0207683_10376967 3300026121 Bacteria 1304
44 Ga0209281_1000156 3300027111 Bacteria 163207
45 Ga0209489_117946 3300027361 Bacteria 2985
46 Ga0209282_1036995 3300027666 Bacteria 2938
47 Ga0307515_10134757 3300028794 Bacteria 2694
48 Ga0265338_10001499 3300028800 Bacteria 37795
49 Ga0265338_10008013 3300028800 Bacteria 12930
50 Ga0265327_10031531 3300031251 Bacteria 2976
51 Ga0265327_10133076 3300031251 Bacteria 1168
52 Ga0307408_100000223 3300031548 Bacteria 60207
53 Ga0307408_100002987 3300031548 Bacteria 11706
54 Ga0307405_10000007 3300031731 Bacteria 348101
55 Ga0307405_10377609 3300031731 Bacteria 1102
56 Ga0307413_10000843 3300031824 Bacteria 10778
57 Ga0307410_10000072 3300031852 Bacteria 35421
58 Ga0307406_10000041 3300031901 Bacteria 74278
59 Ga0307407_10000225 3300031903 Bacteria 16830
60 Ga0307407_10080298 3300031903 Bacteria 1970
61 Ga0307412_10205918 3300031911 Bacteria 1497
62 Ga0307414_10000001 3300032004 Bacteria 1352954
63 Ga0307414_10010408 3300032004 Bacteria 5394
64 Ga0307411_10000005 3300032005 Bacteria 391311
65 Ga0307411_10109021 3300032005 Bacteria 1976
66 Ga0307411_10397089 3300032005 Bacteria 1139
67 Ga0307411_10622331 3300032005 Bacteria 931
68 Ga0316593_10026485 3300032168 Bacteria 1855
69 Ga0307510_10023070 3300033180 Bacteria 7219
70 Ga0316574_0138769 3300035398 Bacteria 1566
71 Ga0400483_012218 3300039062 Bacteria 61234
72 Ga0439447_002474 3300041407 Bacteria 6722
73 Ga0439453_0051319 3300041408 Bacteria 834
74 Ga0439466_0005812 3300041411 Bacteria 4701
75 Ga0451807_1142152 3300041486 Bacteria 1072
76 Ga0451837_0628369 3300041494 Bacteria 8268
77 Ga0451577_0000216 3300042876 Bacteria 119613
78 Ga0451577_0002766 3300042876 Bacteria 20299
79 Ga0451577_0019317 3300042876 Bacteria 6266
80 Ga0451577_0036664 3300042876 Bacteria 4414
81 Ga0451577_0057554 3300042876 Bacteria 3465
82 Ga0451577_0061587 3300042876 Bacteria 3347
83 Ga0451577_0094399 3300042876 Bacteria 2671
84 Ga0451577_0124435 3300042876 Bacteria 2310
85 Ga0451577_0170491 3300042876 Bacteria 1961
86 Ga0451577_0223569 3300042876 Bacteria 1702
87 Ga0451577_0515009 3300042876 Bacteria 1086
88 Ga0451577_0653679 3300042876 Bacteria 953
89 Ga0451577_0987127 3300042876 Unclassified 756
90 Ga0453683_0000101 3300044673 Bacteria 128396
91 Ga0453683_0001466 3300044673 Bacteria 20299
92 Ga0453683_0017959 3300044673 Bacteria 4543
93 Ga0453683_0039410 3300044673 Bacteria 2969
94 Ga0453683_0053411 3300044673 Bacteria 2528
95 Ga0453683_0165817 3300044673 Unclassified 1398
96 Ga0453683_0285529 3300044673 Bacteria 1054
97 Ga0453683_0311327 3300044673 Bacteria 1008
98 Ga0453683_0313663 3300044673 Bacteria 1004
99 Ga0453684_0000086 3300044712 Bacteria 397278
100 Ga0453684_0000553 3300044712 Bacteria 141396
101 Ga0453684_0001006 3300044712 Bacteria 91343
102 Ga0453684_0002011 3300044712 Bacteria 52058
103 Ga0453684_0003307 3300044712 Bacteria 36750
104 Ga0453684_0006518 3300044712 Bacteria 22114
105 Ga0453684_0007366 3300044712 Bacteria 20299
106 Ga0453684_0007718 3300044712 Bacteria 19651
107 Ga0453684_0011417 3300044712 Bacteria 14902
108 Ga0453684_0013019 3300044712 Archaea 13585
109 Ga0453684_0053388 3300044712 Bacteria 5275
110 Ga0453684_0132653 3300044712 Bacteria 2987
111 Ga0453684_0145700 3300044712 Unclassified 2821
112 Ga0453684_0245813 3300044712 Bacteria 2057
113 Ga0453684_0247219 3300044712 Bacteria 2050
114 Ga0453684_0265966 3300044712 Bacteria 1962
115 Ga0453684_0291361 3300044712 Unclassified 1858
116 Ga0453684_0327605 3300044712 Bacteria 1733
117 Ga0453684_0430945 3300044712 Bacteria 1471
118 Ga0453684_0511325 3300044712 Bacteria 1328
119 Ga0451576_0000083 3300045051 Bacteria 236908
120 Ga0451576_0002630 3300045051 Bacteria 26290
121 Ga0451576_0003112 3300045051 Bacteria 23266
122 Ga0451576_0003810 3300045051 Bacteria 20299
123 Ga0451576_0008125 3300045051 Bacteria 12360
124 Ga0451576_0019484 3300045051 Bacteria 7404
125 Ga0451576_0020740 3300045051 Bacteria 7152
126 Ga0451576_0030435 3300045051 Bacteria 5769
127 Ga0451576_0045554 3300045051 Bacteria 4619
128 Ga0451576_0136119 3300045051 Bacteria 2562
129 Ga0451576_0216996 3300045051 Bacteria 1997
130 Ga0451576_0918426 3300045051 Bacteria 918
131 Ga0451576_1100996 3300045051 Bacteria 831
132 Ga0495627_001652 3300046453 Bacteria 12384
133 Ga0495580_0094252 3300046472 Unclassified 2083
134 Ga0495606_0245285 3300046507 Bacteria 996
135 Ga0495616_0172971 3300046513 Bacteria 964
136 Ga0495632_0134618 3300046519 Bacteria 1149
137 Ga0495643_0001696 3300046522 Bacteria 19158
138 Ga0495652_0238840 3300046529 Unclassified 1354
139 Ga0495640_0080794 3300046533 Bacteria 2162
140 Ga0495587_0289210 3300046536 Unclassified 918
141 Ga0495587_0349935 3300046536 Bacteria 824
142 Ga0495625_0063213 3300046660 Bacteria 2614
143 Ga0495657_0202886 3300046675 Unclassified 1208
144 Ga0495658_0007601 3300046683 Bacteria 5374
145 Ga0495636_0030880 3300047318 Unclassified 2193
146 Ga0495684_0211740 3300047471 Bacteria 1425
147 Ga0496115_0054080 3300048918 Bacteria 3223
148 Ga0496116_0000041 3300048919 Bacteria 343299
149 Ga0496118_0253775 3300048921 Bacteria 997
150 Ga0496121_0078277 3300048924 Bacteria 2629
151 Ga0496124_0010486 3300048927 Bacteria 9377
152 Ga0496124_0108493 3300048927 Bacteria 2239
153 Ga0496124_0342421 3300048927 Bacteria 1061
154 Ga0496125_0000026 3300048928 Bacteria 397380
155 Ga0496125_0000177 3300048928 Bacteria 140730
156 Ga0496126_0005182 3300048929 Bacteria 15066
157 Ga0501031_0006344 3300049568 Bacteria 7712
158 Ga0501032_0019608 3300049569 Bacteria 4727
159 Ga0501032_0043550 3300049569 Bacteria 3039
160 Ga0501033_0000004 3300049570 Bacteria 441310
161 Ga0501034_0000375 3300049571 Bacteria 75945
162 Ga0501034_0071338 3300049571 Bacteria 3483
163 Ga0501036_0069407 3300049572 Bacteria 2981
164 Ga0501036_0406445 3300049572 Bacteria 1135
165 Ga0501037_0006121 3300049573 Bacteria 8790
166 Ga0501038_0027152 3300049574 Bacteria 5095
167 Ga0501039_0010819 3300049575 Bacteria 6952
168 Ga0501043_0025874 3300049579 Bacteria 4603
169 Ga0501223_000695 3300049663 Bacteria 8013
170 Ga0501249_000009 3300049679 Bacteria 173938
171 Ga0501241_001686 3300049758 Unclassified 4413
172 Ga0501266_000007 3300049763 Bacteria 291751
173 Ga0501035_0006105 3300049822 Bacteria 11339
174 Ga0501035_0009600 3300049822 Bacteria 9000
175 Ga0501044_0001402 3300049823 Bacteria 28266
176 Ga0501045_0000430 3300049824 Bacteria 25674
177 Ga0500646_0004325 3300053090 Bacteria 3597
178 Ga0500646_0082257 3300053090 Bacteria 984
179 Ga0500641_0000006 3300053096 Bacteria 223991
180 Ga0500641_0000110 3300053096 Bacteria 31571
181 Ga0500658_0000008 3300053134 Bacteria 273324

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_0918426 Ga0451576_0918426_161_871 212
2 3300031903 Ga0307407_10000225 Ga0307407_100002257 217
3 3300041408 Ga0439453_0051319 Ga0439453_0051319_15_671 217
4 3300044673 Ga0453683_0285529 Ga0453683_0285529_372_1028 217
5 3300049758 Ga0501241_001686 Ga0501241_001686_3707_4363 217
6 3300013104 Ga0157370_10212147 Ga0157370_102121473 219
7 3300042876 Ga0451577_0223569 Ga0451577_0223569_424_1146 219
8 3300031251 Ga0265327_10031531 Ga0265327_100315313 223
9 3300049572 Ga0501036_0069407 Ga0501036_0069407_16_690 224
10 3300049822 Ga0501035_0009600 Ga0501035_0009600_5333_6007 224
11 3300031548 Ga0307408_100002987 Ga0307408_1000029874 225
12 3300031731 Ga0307405_10377609 Ga0307405_103776091 225
13 3300031852 Ga0307410_10000072 Ga0307410_100000728 225
14 3300031901 Ga0307406_10000041 Ga0307406_1000004119 225
15 3300031903 Ga0307407_10080298 Ga0307407_100802982 225
16 3300032005 Ga0307411_10109021 Ga0307411_101090213 225
17 3300049679 Ga0501249_000009 Ga0501249_000009_45961_46638 225
18 3300042876 Ga0451577_0061587 Ga0451577_0061587_117_833 226
19 3300045051 Ga0451576_0030435 Ga0451576_0030435_2334_3050 226
20 3300032168 Ga0316593_10026485 Ga0316593_100264852 229
21 iso_pu_bacteria 2839989709 2839992061 231
22 iso_pu_bacteria 2890804823 2890806138 231
23 iso_pu_bacteria 8036736890 8036738831 231
24 iso_pu_bacteria 2881247448 2881249690 232
25 iso_pu_bacteria 2919509842 2919512024 232
26 iso_pu_bacteria 2958512119 2958515311 232
27 iso_pu_bacteria 2513020052 2513236386 233
28 iso_pu_bacteria 2519899754 2520878575 233
29 iso_pu_bacteria 2643221600 2644011660 233
30 iso_pu_bacteria 2643221667 2644370042 233
31 iso_pu_bacteria 2643221716 2644642109 233
32 iso_pu_bacteria 2643221725 2644685461 233
33 iso_pu_bacteria 2738541279 2738736444 233
34 iso_pu_bacteria 2738541285 2738768887 233
35 iso_pu_bacteria 2738543007 2739218026 233
36 iso_pu_bacteria 2739367857 2740003569 233
37 iso_pu_bacteria 2739367858 2740008386 233
38 iso_pu_bacteria 2802428842 2802653507 233
39 iso_pu_bacteria 2816332280 2817415606 233
40 iso_pu_bacteria 2833640130 2833643703 233
41 iso_pu_bacteria 2857613821 2857614379 233
42 iso_pu_bacteria 2857618242 2857619263 233
43 iso_pu_bacteria 2881359912 2881362436 233
44 iso_pu_bacteria 2903895155 2903898418 233
45 iso_pu_bacteria 2904419702 2904423223 233
46 iso_pu_bacteria 2904555929 2904556449 233
47 iso_pu_bacteria 2919191525 2919193165 233
48 iso_pu_bacteria 2919683626 2919687651 233
49 iso_pu_bacteria 2929150217 2929152876 233
50 iso_pu_bacteria 2958458903 2958463455 233
51 iso_pu_bacteria 2965320100 2965321038 233
52 iso_pu_bacteria 2977268062 2977269541 233
53 iso_pu_bacteria 8054307821 8054308622 233
54 iso_pu_bacteria 8055419101 8055421296 233
55 iso_pu_bacteria 8055592153 8055594323 233
56 iso_pu_bacteria 8056440228 8056441879 233
57 3300003320 rootH2_10090078 rootH2_100900782 235
58 3300005289 Ga0065704_10089831 Ga0065704_100898311 235
59 3300005290 Ga0065712_10138728 Ga0065712_101387282 235
60 3300005336 Ga0070680_100002381 Ga0070680_1000023818 235
61 3300005367 Ga0070667_100306259 Ga0070667_1003062592 235
62 3300005456 Ga0070678_100337848 Ga0070678_1003378481 235
63 3300006237 Ga0097621_100018892 Ga0097621_1000188924 235
64 3300006358 Ga0068871_100024912 Ga0068871_1000249122 235
65 3300009545 Ga0105237_10319944 Ga0105237_103199442 235
66 3300013100 Ga0157373_10324943 Ga0157373_103249432 235
67 3300013102 Ga0157371_10019027 Ga0157371_100190273 235
68 3300013102 Ga0157371_10107610 Ga0157371_101076103 235
69 3300013102 Ga0157371_10255009 Ga0157371_102550092 235
70 3300013105 Ga0157369_10189196 Ga0157369_101891961 235
71 3300013306 Ga0163162_10026195 Ga0163162_100261952 235
72 3300014969 Ga0157376_10016667 Ga0157376_100166675 235
73 3300014969 Ga0157376_10030344 Ga0157376_100303442 235
74 3300014969 Ga0157376_10066405 Ga0157376_100664052 235
75 3300014969 Ga0157376_10536794 Ga0157376_105367942 235
76 3300026121 Ga0207683_10376967 Ga0207683_103769672 235
77 3300028800 Ga0265338_10001499 Ga0265338_100014993 235
78 3300031548 Ga0307408_100000223 Ga0307408_10000022314 235
79 3300032005 Ga0307411_10622331 Ga0307411_106223311 235
80 3300035398 Ga0316574_0138769 Ga0316574_0138769_157_867 235
81 3300039062 Ga0400483_012218 Ga0400483_012218_14635_15381 235
82 3300042876 Ga0451577_0000216 Ga0451577_0000216_36812_37522 235
83 3300042876 Ga0451577_0002766 Ga0451577_0002766_1113_1823 235
84 3300042876 Ga0451577_0019317 Ga0451577_0019317_664_1374 235
85 3300042876 Ga0451577_0057554 Ga0451577_0057554_869_1579 235
86 3300042876 Ga0451577_0094399 Ga0451577_0094399_439_1149 235
87 3300042876 Ga0451577_0124435 Ga0451577_0124435_703_1413 235
88 3300042876 Ga0451577_0170491 Ga0451577_0170491_282_992 235
89 3300042876 Ga0451577_0515009 Ga0451577_0515009_266_976 235
90 3300042876 Ga0451577_0653679 Ga0451577_0653679_202_912 235
91 3300042876 Ga0451577_0987127 Ga0451577_0987127_29_739 235
92 3300044673 Ga0453683_0000101 Ga0453683_0000101_125223_125933 235
93 3300044673 Ga0453683_0001466 Ga0453683_0001466_18477_19187 235
94 3300044673 Ga0453683_0017959 Ga0453683_0017959_424_1134 235
95 3300044673 Ga0453683_0039410 Ga0453683_0039410_889_1599 235
96 3300044673 Ga0453683_0165817 Ga0453683_0165817_25_735 235
97 3300044673 Ga0453683_0311327 Ga0453683_0311327_183_977 235
98 3300044712 Ga0453684_0000086 Ga0453684_0000086_205817_206527 235
99 3300044712 Ga0453684_0000553 Ga0453684_0000553_920_1630 235
100 3300044712 Ga0453684_0001006 Ga0453684_0001006_62716_63426 235
101 3300044712 Ga0453684_0002011 Ga0453684_0002011_28994_29704 235
102 3300044712 Ga0453684_0006518 Ga0453684_0006518_1758_2468 235
103 3300044712 Ga0453684_0007366 Ga0453684_0007366_1113_1823 235
104 3300044712 Ga0453684_0007718 Ga0453684_0007718_3739_4449 235
105 3300044712 Ga0453684_0011417 Ga0453684_0011417_6099_6809 235
106 3300044712 Ga0453684_0013019 Ga0453684_0013019_12267_12977 235
107 3300044712 Ga0453684_0053388 Ga0453684_0053388_2417_3127 235
108 3300044712 Ga0453684_0132653 Ga0453684_0132653_1027_1737 235
109 3300044712 Ga0453684_0145700 Ga0453684_0145700_50_760 235
110 3300044712 Ga0453684_0245813 Ga0453684_0245813_1047_1757 235
111 3300044712 Ga0453684_0247219 Ga0453684_0247219_846_1556 235
112 3300044712 Ga0453684_0265966 Ga0453684_0265966_1066_1776 235
113 3300044712 Ga0453684_0291361 Ga0453684_0291361_312_1022 235
114 3300044712 Ga0453684_0430945 Ga0453684_0430945_176_886 235
115 3300044712 Ga0453684_0511325 Ga0453684_0511325_139_849 235
116 3300045051 Ga0451576_0000083 Ga0451576_0000083_62702_63412 235
117 3300045051 Ga0451576_0002630 Ga0451576_0002630_20442_21152 235
118 3300045051 Ga0451576_0003112 Ga0451576_0003112_14252_14965 235
119 3300045051 Ga0451576_0003810 Ga0451576_0003810_18477_19187 235
120 3300045051 Ga0451576_0008125 Ga0451576_0008125_9616_10326 235
121 3300045051 Ga0451576_0020740 Ga0451576_0020740_2060_2770 235
122 3300045051 Ga0451576_0045554 Ga0451576_0045554_300_1010 235
123 3300045051 Ga0451576_0216996 Ga0451576_0216996_1197_1907 235
124 3300045051 Ga0451576_1100996 Ga0451576_1100996_35_745 235
125 3300046472 Ga0495580_0094252 Ga0495580_0094252_366_1088 235
126 3300046519 Ga0495632_0134618 Ga0495632_0134618_264_1121 235
127 3300046529 Ga0495652_0238840 Ga0495652_0238840_594_1316 235
128 3300046533 Ga0495640_0080794 Ga0495640_0080794_708_1430 235
129 3300046536 Ga0495587_0289210 Ga0495587_0289210_171_893 235
130 3300046536 Ga0495587_0349935 Ga0495587_0349935_46_768 235
131 3300046675 Ga0495657_0202886 Ga0495657_0202886_457_1179 235
132 3300046683 Ga0495658_0007601 Ga0495658_0007601_1008_1730 235
133 3300047471 Ga0495684_0211740 Ga0495684_0211740_588_1310 235
134 3300049663 Ga0501223_000695 Ga0501223_000695_7282_7992 235
135 3300005293 Ga0065715_10214245 Ga0065715_102142452 236
136 3300005547 Ga0070693_100019463 Ga0070693_1000194631 236
137 3300013104 Ga0157370_10201089 Ga0157370_102010892 236
138 3300013306 Ga0163162_10897456 Ga0163162_108974561 236
139 3300017792 Ga0163161_10001302 Ga0163161_1000130214 236
140 3300017792 Ga0163161_10034990 Ga0163161_100349902 236
141 3300044673 Ga0453683_0053411 Ga0453683_0053411_1796_2512 236
142 3300044712 Ga0453684_0327605 Ga0453684_0327605_190_903 236
143 3300046453 Ga0495627_001652 Ga0495627_001652_10640_11350 236
144 3300046507 Ga0495606_0245285 Ga0495606_0245285_163_876 236
145 3300046513 Ga0495616_0172971 Ga0495616_0172971_189_899 236
146 3300046522 Ga0495643_0001696 Ga0495643_0001696_17306_18016 236
147 3300046660 Ga0495625_0063213 Ga0495625_0063213_1699_2409 236
148 3300048918 Ga0496115_0054080 Ga0496115_0054080_1721_2431 236
149 3300048928 Ga0496125_0000177 Ga0496125_0000177_18172_18882 236
150 3300053090 Ga0500646_0082257 Ga0500646_0082257_165_875 236
151 2209111006 2214717169 2213727906 237
152 3300003578 Ga0006562J51391_1004994 Ga0006562J51391_10049942 237
153 3300005288 Ga0065714_10030957 Ga0065714_100309572 237
154 3300005288 Ga0065714_10073664 Ga0065714_100736642 237
155 3300005288 Ga0065714_10117679 Ga0065714_101176792 237
156 3300006942 Ga0099824_1012791 Ga0099824_101279112 237
157 3300006948 Ga0099826_10017550 Ga0099826_100175503 237
158 3300009011 Ga0105251_10178937 Ga0105251_101789371 237
159 3300009036 Ga0105244_10000003 Ga0105244_1000000338 237
160 3300013100 Ga0157373_10000014 Ga0157373_10000014105 237
161 3300013102 Ga0157371_10013686 Ga0157371_100136863 237
162 3300013104 Ga0157370_10000060 Ga0157370_1000006082 237
163 3300013105 Ga0157369_10000766 Ga0157369_1000076633 237
164 3300015261 Ga0182006_1042681 Ga0182006_10426812 237
165 3300017792 Ga0163161_10000119 Ga0163161_1000011978 237
166 3300025728 Ga0207655_1000010 Ga0207655_1000010511 237
167 3300027111 Ga0209281_1000156 Ga0209281_100015657 237
168 3300027361 Ga0209489_117946 Ga0209489_1179461 237
169 3300027666 Ga0209282_1036995 Ga0209282_10369952 237
170 3300028794 Ga0307515_10134757 Ga0307515_101347572 237
171 3300028800 Ga0265338_10008013 Ga0265338_100080133 237
172 3300031251 Ga0265327_10133076 Ga0265327_101330762 237
173 3300031731 Ga0307405_10000007 Ga0307405_1000000797 237
174 3300031824 Ga0307413_10000843 Ga0307413_100008436 237
175 3300031911 Ga0307412_10205918 Ga0307412_102059183 237
176 3300032004 Ga0307414_10000001 Ga0307414_10000001515 237
177 3300032004 Ga0307414_10010408 Ga0307414_100104083 237
178 3300032005 Ga0307411_10000005 Ga0307411_10000005120 237
179 3300032005 Ga0307411_10397089 Ga0307411_103970892 237
180 3300033180 Ga0307510_10023070 Ga0307510_100230706 237
181 3300041407 Ga0439447_002474 Ga0439447_002474_2570_3283 237
182 3300041411 Ga0439466_0005812 Ga0439466_0005812_301_1014 237
183 3300041486 Ga0451807_1142152 Ga0451807_1142152_45_758 237
184 3300041494 Ga0451837_0628369 Ga0451837_0628369_7086_7808 237
185 3300042876 Ga0451577_0036664 Ga0451577_0036664_3562_4284 237
186 3300044673 Ga0453683_0313663 Ga0453683_0313663_117_833 237
187 3300044712 Ga0453684_0003307 Ga0453684_0003307_19664_20386 237
188 3300045051 Ga0451576_0019484 Ga0451576_0019484_2442_3161 237
189 3300045051 Ga0451576_0136119 Ga0451576_0136119_83_805 237
190 3300047318 Ga0495636_0030880 Ga0495636_0030880_104_844 237
191 3300048919 Ga0496116_0000041 Ga0496116_0000041_142899_143612 237
192 3300048921 Ga0496118_0253775 Ga0496118_0253775_167_880 237
193 3300048924 Ga0496121_0078277 Ga0496121_0078277_1430_2143 237
194 3300048927 Ga0496124_0010486 Ga0496124_0010486_7394_8107 237
195 3300048927 Ga0496124_0108493 Ga0496124_0108493_1015_1728 237
196 3300048927 Ga0496124_0342421 Ga0496124_0342421_296_1009 237
197 3300048928 Ga0496125_0000026 Ga0496125_0000026_299980_300693 237
198 3300048929 Ga0496126_0005182 Ga0496126_0005182_250_963 237
199 3300049568 Ga0501031_0006344 Ga0501031_0006344_4762_5514 237
200 3300049569 Ga0501032_0019608 Ga0501032_0019608_2913_3665 237
201 3300049569 Ga0501032_0043550 Ga0501032_0043550_49_861 237
202 3300049570 Ga0501033_0000004 Ga0501033_0000004_403435_404187 237
203 3300049571 Ga0501034_0000375 Ga0501034_0000375_34827_35579 237
204 3300049571 Ga0501034_0071338 Ga0501034_0071338_1536_2249 237
205 3300049572 Ga0501036_0406445 Ga0501036_0406445_272_1024 237
206 3300049573 Ga0501037_0006121 Ga0501037_0006121_1278_2030 237
207 3300049574 Ga0501038_0027152 Ga0501038_0027152_1222_1974 237
208 3300049575 Ga0501039_0010819 Ga0501039_0010819_2225_2977 237
209 3300049579 Ga0501043_0025874 Ga0501043_0025874_594_1346 237
210 3300049763 Ga0501266_000007 Ga0501266_000007_106565_107401 237
211 3300049822 Ga0501035_0006105 Ga0501035_0006105_13_765 237
212 3300049823 Ga0501044_0001402 Ga0501044_0001402_9131_9883 237
213 3300049824 Ga0501045_0000430 Ga0501045_0000430_9725_10477 237
214 3300053090 Ga0500646_0004325 Ga0500646_0004325_1224_1937 237
215 3300053096 Ga0500641_0000006 Ga0500641_0000006_74380_75093 237
216 3300053096 Ga0500641_0000110 Ga0500641_0000110_14902_15615 237
217 3300053134 Ga0500658_0000008 Ga0500658_0000008_11050_11763 237

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01709

Transcrip_reg

TACO1/YebC second and third domain

120

275

0.97

PF20772

TACO1_YebC_N

TACO1/YebC protein N-terminal domain

44

115

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mw7-assembly1.cif.gz_A x-ray structure of y162_helpy northeast structural genomics consortium target pr6 0.9303 21 234
1mw7-assembly1.cif.gz_A x-ray structure of y162_helpy northeast structural genomics consortium target pr6 0.9021 21 234
1lfp-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein aq1575 from aquifex aeolicus 0.816 21 234
1kon-assembly1.cif.gz_A crystal structure of e.coli yebc 0.7811 21 235
1lfp-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein aq1575 from aquifex aeolicus 0.7417 21 234
ID Description Score Start End Superfamily
1lfpA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.9727 21 71 1.10.10.200
1lfpA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9658 80 234 3.30.70.980
af_P9WGA5_1_79_1.10.10.200 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.963 19 72 1.10.10.200
af_Q6F2Z2_64_139_1.10.10.200 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.955 21 79 1.10.10.200
1mw7A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9546 80 234 3.30.70.980
ID Description Score Start End GO Terms
AF-A0A519NL36-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9768 99 236 GO:0003677
GO:0005829
AF-A0A3D2R6I8-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9746 130 237 GO:0003677
GO:0005829
AF-A0A519NL36-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9699 99 236 GO:0003677
GO:0005829
AF-A0A7R9V5A2-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9692 19 120 GO:0009507
AF-I5C779-F1-model_v4 Probable transcriptional regulatory protein A3SI_05809 0.9623 20 234 GO:0003677
GO:0005829
GO:0006355

Feature Viewer

pLDDT pTM Quality
89.48 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map