F329238

General Info

Members Datasets Scaffolds Average Seq Length
217 142 217 121

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0837188|Ga0501033_0837188_70_441
Length 123
Sequence MLIFKEFTFDSAHFLPHVPEGHKCKSMHGHTYRLKVWIKGQPDPKLGWVMDFAVLKQVVQPVVATLDHKCMNQVEGLDNPTCELIAVWIWNKLKPSLPKMQRIELHETPTSGVIYEGDYTPGV

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
46 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
59 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
60 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
61 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
62 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
65 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
66 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
67 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
68 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
69 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
70 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
71 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
72 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
73 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
74 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
75 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
76 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
77 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
78 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
79 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
80 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
81 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
82 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
83 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
89 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
90 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
91 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
92 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
93 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
94 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
95 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
96 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
97 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
98 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
99 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
100 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
101 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
104 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
105 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
106 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
107 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
108 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
109 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
110 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
111 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
112 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
113 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
114 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
115 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
116 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
117 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
118 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
119 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
120 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
121 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
122 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
123 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
124 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
125 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
126 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
127 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
133 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
134 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
135 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
137 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
138 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
140 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
141 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
142 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.38
Nodule 0
Rhizoplane 2.3
Rhizosphere 93.55
Stem 0
Stem Tuber 0
Unclassified 2.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10077651 3300003316 Viruses 5603
2 rootL2_10170583 3300003322 Bacteria 5900
3 rootL2_10211949 3300003322 Bacteria 3626
4 rootH1_10270658 3300003323 Bacteria 1510
5 Ga0070658_10133134 3300005327 Bacteria 2073
6 Ga0070690_100090537 3300005330 Unclassified 2014
7 Ga0068869_101074943 3300005334 Bacteria 703
8 Ga0070689_100190364 3300005340 Bacteria 1670
9 Ga0070689_101744463 3300005340 Bacteria 567
10 Ga0070674_100028067 3300005356 Bacteria 3694
11 Ga0070688_100084560 3300005365 Bacteria 2061
12 Ga0070688_100403086 3300005365 Bacteria 1013
13 Ga0070714_100001104 3300005435 Bacteria 19321
14 Ga0070711_100551500 3300005439 Unclassified 956
15 Ga0070681_10056402 3300005458 Bacteria 3909
16 Ga0070685_10085429 3300005466 Bacteria 1900
17 Ga0070679_101046963 3300005530 Bacteria 760
18 Ga0070684_100094782 3300005535 Unclassified 2659
19 Ga0070686_100226708 3300005544 Bacteria 1353
20 Ga0068856_100034315 3300005614 Bacteria 4969
21 Ga0068856_100139960 3300005614 Bacteria 2427
22 Ga0068856_100346806 3300005614 Bacteria 1503
23 Ga0070702_100109042 3300005615 Bacteria 1713
24 Ga0068852_101657492 3300005616 Bacteria 662
25 Ga0068859_101712227 3300005617 Unclassified 694
26 Ga0068864_101743614 3300005618 Bacteria 628
27 Ga0068858_100408906 3300005842 Unclassified 1304
28 Ga0070717_10520184 3300006028 Unclassified 1076
29 Ga0070712_100339970 3300006175 Bacteria 1225
30 Ga0075430_100231824 3300006846 Unclassified 1531
31 Ga0075429_100137809 3300006880 Bacteria 2136
32 Ga0097620_101712382 3300006931 Unclassified 694
33 Ga0097620_102082500 3300006931 Bacteria 626
34 Ga0099795_10374468 3300007788 Unclassified 641
35 Ga0099795_10440514 3300007788 Unclassified 598
36 Ga0105240_10018853 3300009093 Bacteria 9239
37 Ga0105240_10062012 3300009093 Bacteria 4656
38 Ga0105240_10144475 3300009093 Bacteria 2840
39 Ga0105240_10287859 3300009093 Unclassified 1885
40 Ga0105240_11428022 3300009093 Unclassified 727
41 Ga0111539_10320461 3300009094 Bacteria 1804
42 Ga0111539_10363923 3300009094 Bacteria 1683
43 Ga0105245_11496694 3300009098 Bacteria 726
44 Ga0105241_10191372 3300009174 Bacteria 1703
45 Ga0105248_10878567 3300009177 Unclassified 1012
46 Ga0105238_10077623 3300009551 Unclassified 3312
47 Ga0105238_10374708 3300009551 Bacteria 1414
48 Ga0099796_10134539 3300010159 Unclassified 961
49 Ga0105246_12592152 3300011119 Bacteria 501
50 Ga0157370_11603887 3300013104 Bacteria 585
51 Ga0157369_11595120 3300013105 Unclassified 664
52 Ga0157374_10665392 3300013296 Unclassified 1053
53 Ga0157378_10438468 3300013297 Bacteria 1294
54 Ga0157372_10404388 3300013307 Bacteria 1591
55 Ga0157372_10773595 3300013307 Bacteria 1116
56 Ga0157372_12159204 3300013307 Unclassified 640
57 Ga0157375_10000023 3300013308 Bacteria 235137
58 Ga0157375_10220050 3300013308 Bacteria 2057
59 Ga0163163_10000097 3300014325 Bacteria 92228
60 Ga0163163_10226968 3300014325 Bacteria 1916
61 Ga0157380_10035972 3300014326 Bacteria 3829
62 Ga0157380_10816084 3300014326 Bacteria 951
63 Ga0209758_1000161 3300025297 Bacteria 154278
64 Ga0207707_10027564 3300025912 Bacteria 4967
65 Ga0207695_10010957 3300025913 Bacteria 11026
66 Ga0207695_10409365 3300025913 Unclassified 1240
67 Ga0207695_10448792 3300025913 Bacteria 1173
68 Ga0207694_10047468 3300025924 Unclassified 3322
69 Ga0207694_10050041 3300025924 Bacteria 3235
70 Ga0207664_10006696 3300025929 Bacteria 7949
71 Ga0207670_10005274 3300025936 Bacteria 7077
72 Ga0207669_10008424 3300025937 Bacteria 4842
73 Ga0207667_10038034 3300025949 Bacteria 5142
74 Ga0207667_10065724 3300025949 Bacteria 3782
75 Ga0207667_10292993 3300025949 Bacteria 1663
76 Ga0207703_10141423 3300026035 Unclassified 2089
77 Ga0207639_10517794 3300026041 Bacteria 1092
78 Ga0207702_10096496 3300026078 Unclassified 2600
79 Ga0207702_10199045 3300026078 Bacteria 1856
80 Ga0207702_10368741 3300026078 Bacteria 1378
81 Ga0207641_11989146 3300026088 Unclassified 582
82 Ga0207674_10128375 3300026116 Bacteria 2500
83 Ga0265337_1010534 3300028556 Bacteria 3235
84 Ga0265337_1095102 3300028556 Bacteria 811
85 Ga0265337_1139689 3300028556 Unclassified 656
86 Ga0265319_1032065 3300028563 Unclassified 1825
87 Ga0265319_1039466 3300028563 Unclassified 1600
88 Ga0265319_1058531 3300028563 Bacteria 1255
89 Ga0265334_10019703 3300028573 Unclassified 2772
90 Ga0265334_10100027 3300028573 Bacteria 1050
91 Ga0265334_10226720 3300028573 Bacteria 646
92 Ga0265323_10000058 3300028653 Bacteria 61416
93 Ga0265323_10019848 3300028653 Bacteria 2591
94 Ga0265323_10053634 3300028653 Unclassified 1423
95 Ga0265322_10008629 3300028654 Bacteria 2968
96 Ga0265338_10000843 3300028800 Bacteria 51673
97 Ga0265338_10011803 3300028800 Bacteria 10041
98 Ga0265338_10016259 3300028800 Bacteria 8108
99 Ga0265338_10033786 3300028800 Bacteria 4957
100 Ga0265338_10052219 3300028800 Bacteria 3671
101 Ga0265338_11171874 3300028800 Bacteria 516
102 Ga0265324_10039772 3300029957 Bacteria 1630
103 Ga0265330_10494870 3300031235 Unclassified 520
104 Ga0265320_10005791 3300031240 Bacteria 7875
105 Ga0265320_10063639 3300031240 Unclassified 1754
106 Ga0265320_10228368 3300031240 Bacteria 828
107 Ga0265320_10570540 3300031240 Unclassified 500
108 Ga0265325_10055685 3300031241 Bacteria 2021
109 Ga0265340_10021571 3300031247 Bacteria 3303
110 Ga0265340_10169289 3300031247 Bacteria 990
111 Ga0265339_10011687 3300031249 Bacteria 5393
112 Ga0265327_10107511 3300031251 Bacteria 1337
113 Ga0265316_10029147 3300031344 Bacteria 4543
114 Ga0265316_10828222 3300031344 Unclassified 648
115 Ga0265316_11143673 3300031344 Bacteria 539
116 Ga0265313_10056424 3300031595 Bacteria 1857
117 Ga0265313_10219291 3300031595 Bacteria 785
118 Ga0265314_10024461 3300031711 Bacteria 4578
119 Ga0265342_10067413 3300031712 Bacteria 2094
120 Ga0307411_10251097 3300032005 Bacteria 1391
121 Ga0373934_0062832 3300035086 Bacteria 1481
122 Ga0373934_0191844 3300035086 Unclassified 841
123 Ga0373945_0166620 3300035116 Unclassified 901
124 Ga0373943_0172508 3300035170 Unclassified 1184
125 Ga0373931_1254491 3300035691 Bacteria 509
126 Ga0373935_0028007 3300035692 Bacteria 3482
127 Ga0373927_0004180 3300035695 Bacteria 10146
128 Ga0373927_0013889 3300035695 Bacteria 5343
129 Ga0373947_0001185 3300035725 Bacteria 16047
130 Ga0373925_0010130 3300037068 Bacteria 6844
131 Ga0373925_0442700 3300037068 Bacteria 1063
132 Ga0395900_0126101 3300037418 Bacteria 2626
133 Ga0395900_1471994 3300037418 Bacteria 593
134 Ga0395898_0111398 3300037466 Bacteria 2623
135 Ga0395905_0002722 3300037471 Bacteria 19365
136 Ga0395901_0145439 3300038443 Bacteria 2492
137 Ga0451793_1712588 3300041452 Bacteria 1333
138 Ga0451797_0824033 3300041453 Bacteria 3520
139 Ga0451802_0241767 3300041460 Bacteria 4499
140 Ga0451807_0139571 3300041486 Bacteria 2565
141 Ga0451833_0435062 3300041491 Bacteria 1505
142 Ga0451853_3362457 3300041512 Bacteria 1058
143 Ga0439431_0046088 3300041997 Bacteria 1121
144 Ga0451577_0000896 3300042876 Bacteria 44127
145 Ga0451577_1128360 3300042876 Bacteria 701
146 Ga0451577_1523836 3300042876 Unclassified 591
147 Ga0451577_1658383 3300042876 Bacteria 563
148 Ga0466965_0661875 3300044683 Bacteria 597
149 Ga0466964_0098606 3300044706 Bacteria 1284
150 Ga0466964_0215609 3300044706 Bacteria 929
151 Ga0453684_0002956 3300044712 Bacteria 39829
152 Ga0453684_0141191 3300044712 Bacteria 2876
153 Ga0453684_0141547 3300044712 Unclassified 2871
154 Ga0466970_0723139 3300044765 Bacteria 581
155 Ga0466960_0397373 3300044901 Bacteria 793
156 Ga0451576_0085114 3300045051 Bacteria 3289
157 Ga0451576_0097298 3300045051 Bacteria 3061
158 Ga0451576_0316618 3300045051 Bacteria 1633
159 Ga0451576_1775024 3300045051 Unclassified 638
160 Ga0466967_0548854 3300045976 Bacteria 1137
161 Ga0495592_0000015 3300046454 Bacteria 145683
162 Ga0495629_0385012 3300046459 Bacteria 954
163 Ga0495580_1104870 3300046472 Unclassified 501
164 Ga0495662_0063365 3300046476 Bacteria 1786
165 Ga0495664_0023825 3300046477 Bacteria 3554
166 Ga0495618_0001313 3300046514 Bacteria 16719
167 Ga0495628_0000140 3300046516 Bacteria 62202
168 Ga0495628_0134675 3300046516 Bacteria 1889
169 Ga0495630_0000045 3300046517 Bacteria 102985
170 Ga0495630_0001457 3300046517 Bacteria 16387
171 Ga0495630_0001914 3300046517 Bacteria 14509
172 Ga0495630_1356180 3300046517 Bacteria 535
173 Ga0495666_0013197 3300046526 Bacteria 4119
174 Ga0495666_0077309 3300046526 Bacteria 1577
175 Ga0495652_0048827 3300046529 Bacteria 3625
176 Ga0495652_0609875 3300046529 Unclassified 743
177 Ga0495640_0015274 3300046533 Bacteria 5780
178 Ga0495640_0757511 3300046533 Unclassified 580
179 Ga0495586_0000005 3300046535 Bacteria 171839
180 Ga0495586_0000284 3300046535 Bacteria 32299
181 Ga0495645_0001437 3300046543 Bacteria 16062
182 Ga0495645_0039453 3300046543 Bacteria 3444
183 Ga0495645_0589366 3300046543 Unclassified 685
184 Ga0495668_0006247 3300046616 Bacteria 7861
185 Ga0495634_0135303 3300046642 Bacteria 1568
186 Ga0495658_0032333 3300046683 Bacteria 2855
187 Ga0495613_0477944 3300046689 Bacteria 841
188 Ga0495624_0695037 3300046690 Unclassified 604
189 Ga0495581_0190517 3300047315 Bacteria 1199
190 Ga0495581_0487610 3300047315 Unclassified 717
191 Ga0495604_0891662 3300047317 Bacteria 556
192 Ga0495674_0001441 3300047319 Bacteria 23322
193 Ga0495674_0010849 3300047319 Bacteria 8615
194 Ga0495674_0722415 3300047319 Bacteria 780
195 Ga0495672_0156058 3300047320 Bacteria 1179
196 Ga0495676_0005209 3300047321 Bacteria 11895
197 Ga0495676_0041584 3300047321 Unclassified 3781
198 Ga0496115_0001002 3300048918 Bacteria 20492
199 Ga0501032_0070612 3300049569 Bacteria 2329
200 Ga0501033_0051403 3300049570 Bacteria 3055
201 Ga0501033_0837188 3300049570 Bacteria 621
202 Ga0501037_0374053 3300049573 Bacteria 980
203 Ga0501038_0675201 3300049574 Unclassified 776
204 Ga0501047_0356082 3300049581 Bacteria 1300
205 Ga0501219_000578 3300049703 Bacteria 5360
206 Ga0501225_0013332 3300049705 Bacteria 2302
207 Ga0501241_019798 3300049758 Bacteria 1237
208 Ga0501035_1398361 3300049822 Bacteria 536
209 Ga0501044_0074323 3300049823 Bacteria 3453
210 Ga0501044_0602537 3300049823 Bacteria 992
211 Ga0501284_00059 3300050005 Bacteria 39196
212 nmdc:mga09592_190337_c1 3300050508 Bacteria 1776
213 nmdc:mga08y16_238183_c1 3300050511 Unclassified 1881
214 nmdc:mga08y16_781770_c1 3300050511 Bacteria 949
215 nmdc:mga08x19_72120_c1 3300050514 Bacteria 2252
216 Ga0500588_0036919 3300053146 Bacteria 1448
217 Ga0500645_014409 3300053730 Bacteria 2520

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005340 Ga0070689_100190364 Ga0070689_1001903641 116
2 3300005340 Ga0070689_101744463 Ga0070689_1017444631 116
3 3300005365 Ga0070688_100084560 Ga0070688_1000845602 116
4 3300005466 Ga0070685_10085429 Ga0070685_100854293 116
5 3300005615 Ga0070702_100109042 Ga0070702_1001090422 116
6 3300013105 Ga0157369_11595120 Ga0157369_115951201 116
7 3300028800 Ga0265338_10052219 Ga0265338_100522196 116
8 3300042876 Ga0451577_1128360 Ga0451577_1128360_179_532 116
9 3300044712 Ga0453684_0141191 Ga0453684_0141191_655_1008 116
10 3300045051 Ga0451576_0097298 Ga0451576_0097298_761_1114 116
11 3300003322 rootL2_10211949 rootL2_102119495 117
12 3300005327 Ga0070658_10133134 Ga0070658_101331342 117
13 3300005330 Ga0070690_100090537 Ga0070690_1000905372 117
14 3300005334 Ga0068869_101074943 Ga0068869_1010749431 117
15 3300005356 Ga0070674_100028067 Ga0070674_1000280672 117
16 3300005458 Ga0070681_10056402 Ga0070681_100564023 117
17 3300005535 Ga0070684_100094782 Ga0070684_1000947822 117
18 3300005544 Ga0070686_100226708 Ga0070686_1002267082 117
19 3300005614 Ga0068856_100139960 Ga0068856_1001399602 117
20 3300005614 Ga0068856_100346806 Ga0068856_1003468062 117
21 3300005616 Ga0068852_101657492 Ga0068852_1016574922 117
22 3300005842 Ga0068858_100408906 Ga0068858_1004089062 117
23 3300007788 Ga0099795_10374468 Ga0099795_103744682 117
24 3300009093 Ga0105240_10144475 Ga0105240_101444752 117
25 3300009093 Ga0105240_11428022 Ga0105240_114280222 117
26 3300009094 Ga0111539_10320461 Ga0111539_103204612 117
27 3300009094 Ga0111539_10363923 Ga0111539_103639233 117
28 3300009098 Ga0105245_11496694 Ga0105245_114966942 117
29 3300009174 Ga0105241_10191372 Ga0105241_101913722 117
30 3300009177 Ga0105248_10878567 Ga0105248_108785672 117
31 3300009551 Ga0105238_10374708 Ga0105238_103747082 117
32 3300010159 Ga0099796_10134539 Ga0099796_101345392 117
33 3300011119 Ga0105246_12592152 Ga0105246_125921521 117
34 3300013296 Ga0157374_10665392 Ga0157374_106653922 117
35 3300013307 Ga0157372_10404388 Ga0157372_104043882 117
36 3300013307 Ga0157372_10773595 Ga0157372_107735952 117
37 3300013307 Ga0157372_12159204 Ga0157372_121592041 117
38 3300013308 Ga0157375_10000023 Ga0157375_10000023182 117
39 3300013308 Ga0157375_10220050 Ga0157375_102200503 117
40 3300014325 Ga0163163_10000097 Ga0163163_1000009779 117
41 3300014326 Ga0157380_10035972 Ga0157380_100359721 117
42 3300014326 Ga0157380_10816084 Ga0157380_108160841 117
43 3300025297 Ga0209758_1000161 Ga0209758_1000161137 117
44 3300025912 Ga0207707_10027564 Ga0207707_100275642 117
45 3300025924 Ga0207694_10050041 Ga0207694_100500412 117
46 3300025937 Ga0207669_10008424 Ga0207669_100084242 117
47 3300025949 Ga0207667_10038034 Ga0207667_100380346 117
48 3300025949 Ga0207667_10292993 Ga0207667_102929932 117
49 3300026035 Ga0207703_10141423 Ga0207703_101414232 117
50 3300026041 Ga0207639_10517794 Ga0207639_105177942 117
51 3300026078 Ga0207702_10199045 Ga0207702_101990452 117
52 3300026078 Ga0207702_10368741 Ga0207702_103687412 117
53 3300028556 Ga0265337_1010534 Ga0265337_10105342 117
54 3300028556 Ga0265337_1139689 Ga0265337_11396892 117
55 3300028573 Ga0265334_10100027 Ga0265334_101000272 117
56 3300028654 Ga0265322_10008629 Ga0265322_100086292 117
57 3300031235 Ga0265330_10494870 Ga0265330_104948701 117
58 3300031247 Ga0265340_10169289 Ga0265340_101692892 117
59 3300031595 Ga0265313_10219291 Ga0265313_102192911 117
60 3300031712 Ga0265342_10067413 Ga0265342_100674132 117
61 3300032005 Ga0307411_10251097 Ga0307411_102510972 117
62 3300037068 Ga0373925_0442700 Ga0373925_0442700_180_536 117
63 3300037418 Ga0395900_0126101 Ga0395900_0126101_844_1200 117
64 3300037418 Ga0395900_1471994 Ga0395900_1471994_99_455 117
65 3300037466 Ga0395898_0111398 Ga0395898_0111398_406_762 117
66 3300037471 Ga0395905_0002722 Ga0395905_0002722_2316_2672 117
67 3300038443 Ga0395901_0145439 Ga0395901_0145439_299_655 117
68 3300041997 Ga0439431_0046088 Ga0439431_0046088_438_794 117
69 3300042876 Ga0451577_0000896 Ga0451577_0000896_20572_20928 117
70 3300044683 Ga0466965_0661875 Ga0466965_0661875_200_556 117
71 3300044706 Ga0466964_0098606 Ga0466964_0098606_205_561 117
72 3300044706 Ga0466964_0215609 Ga0466964_0215609_438_794 117
73 3300044712 Ga0453684_0002956 Ga0453684_0002956_23098_23454 117
74 3300044765 Ga0466970_0723139 Ga0466970_0723139_42_398 117
75 3300044901 Ga0466960_0397373 Ga0466960_0397373_252_608 117
76 3300045051 Ga0451576_1775024 Ga0451576_1775024_169_525 117
77 3300045976 Ga0466967_0548854 Ga0466967_0548854_222_578 117
78 3300046459 Ga0495629_0385012 Ga0495629_0385012_208_564 117
79 3300046517 Ga0495630_0000045 Ga0495630_0000045_9210_9566 117
80 3300046517 Ga0495630_1356180 Ga0495630_1356180_40_396 117
81 3300046526 Ga0495666_0013197 Ga0495666_0013197_606_962 117
82 3300046533 Ga0495640_0757511 Ga0495640_0757511_135_491 117
83 3300046535 Ga0495586_0000005 Ga0495586_0000005_81401_81757 117
84 3300046543 Ga0495645_0039453 Ga0495645_0039453_2159_2515 117
85 3300046616 Ga0495668_0006247 Ga0495668_0006247_3433_3789 117
86 3300046683 Ga0495658_0032333 Ga0495658_0032333_1142_1498 117
87 3300046689 Ga0495613_0477944 Ga0495613_0477944_55_411 117
88 3300046690 Ga0495624_0695037 Ga0495624_0695037_68_424 117
89 3300047315 Ga0495581_0190517 Ga0495581_0190517_362_718 117
90 3300047319 Ga0495674_0001441 Ga0495674_0001441_9412_9768 117
91 3300047319 Ga0495674_0722415 Ga0495674_0722415_379_738 117
92 3300047320 Ga0495672_0156058 Ga0495672_0156058_294_650 117
93 3300047321 Ga0495676_0005209 Ga0495676_0005209_3803_4159 117
94 3300048918 Ga0496115_0001002 Ga0496115_0001002_10874_11230 117
95 3300049703 Ga0501219_000578 Ga0501219_000578_374_730 117
96 3300049705 Ga0501225_0013332 Ga0501225_0013332_227_583 117
97 3300049758 Ga0501241_019798 Ga0501241_019798_263_619 117
98 3300050005 Ga0501284_00059 Ga0501284_00059_19715_20071 117
99 3300050511 nmdc:mga08y16_781770_c1 nmdc:mga08y16_781770_c1_530_886 117
100 3300050514 nmdc:mga08x19_72120_c1 nmdc:mga08x19_72120_c1_1766_2122 117
101 3300053146 Ga0500588_0036919 Ga0500588_0036919_727_1083 117
102 3300053730 Ga0500645_014409 Ga0500645_014409_2025_2381 117
103 3300003323 rootH1_10270658 rootH1_102706582 118
104 3300005439 Ga0070711_100551500 Ga0070711_1005515001 118
105 3300005530 Ga0070679_101046963 Ga0070679_1010469631 118
106 3300005617 Ga0068859_101712227 Ga0068859_1017122271 118
107 3300006175 Ga0070712_100339970 Ga0070712_1003399702 118
108 3300006880 Ga0075429_100137809 Ga0075429_1001378092 118
109 3300006931 Ga0097620_101712382 Ga0097620_1017123821 118
110 3300009093 Ga0105240_10018853 Ga0105240_100188536 118
111 3300013297 Ga0157378_10438468 Ga0157378_104384682 118
112 3300025913 Ga0207695_10010957 Ga0207695_100109579 118
113 3300026088 Ga0207641_11989146 Ga0207641_119891461 118
114 3300026116 Ga0207674_10128375 Ga0207674_101283754 118
115 3300028563 Ga0265319_1058531 Ga0265319_10585313 118
116 3300028800 Ga0265338_10016259 Ga0265338_100162596 118
117 3300031240 Ga0265320_10005791 Ga0265320_100057915 118
118 3300031249 Ga0265339_10011687 Ga0265339_100116875 118
119 3300035086 Ga0373934_0191844 Ga0373934_0191844_122_490 118
120 3300035116 Ga0373945_0166620 Ga0373945_0166620_373_741 118
121 3300035170 Ga0373943_0172508 Ga0373943_0172508_718_1086 118
122 3300035691 Ga0373931_1254491 Ga0373931_1254491_71_430 118
123 3300035692 Ga0373935_0028007 Ga0373935_0028007_1403_1771 118
124 3300035695 Ga0373927_0004180 Ga0373927_0004180_6993_7361 118
125 3300035725 Ga0373947_0001185 Ga0373947_0001185_8510_8878 118
126 3300041452 Ga0451793_1712588 Ga0451793_1712588_560_919 118
127 3300041453 Ga0451797_0824033 Ga0451797_0824033_903_1262 118
128 3300041460 Ga0451802_0241767 Ga0451802_0241767_2040_2399 118
129 3300041486 Ga0451807_0139571 Ga0451807_0139571_978_1337 118
130 3300041491 Ga0451833_0435062 Ga0451833_0435062_797_1156 118
131 3300041512 Ga0451853_3362457 Ga0451853_3362457_348_707 118
132 3300042876 Ga0451577_1523836 Ga0451577_1523836_44_406 118
133 3300046516 Ga0495628_0000140 Ga0495628_0000140_32042_32404 118
134 3300046516 Ga0495628_0134675 Ga0495628_0134675_754_1113 118
135 3300046517 Ga0495630_0001914 Ga0495630_0001914_5630_5998 118
136 3300046543 Ga0495645_0001437 Ga0495645_0001437_5762_6124 118
137 3300047315 Ga0495581_0487610 Ga0495581_0487610_172_540 118
138 3300047321 Ga0495676_0041584 Ga0495676_0041584_2392_2760 118
139 3300049570 Ga0501033_0837188 Ga0501033_0837188_70_441 118
140 3300049574 Ga0501038_0675201 Ga0501038_0675201_254_625 118
141 3300049823 Ga0501044_0602537 Ga0501044_0602537_377_748 118
142 3300005614 Ga0068856_100034315 Ga0068856_1000343152 119
143 3300005618 Ga0068864_101743614 Ga0068864_1017436142 119
144 3300006028 Ga0070717_10520184 Ga0070717_105201842 119
145 3300006846 Ga0075430_100231824 Ga0075430_1002318242 119
146 3300006931 Ga0097620_102082500 Ga0097620_1020825002 119
147 3300007788 Ga0099795_10440514 Ga0099795_104405141 119
148 3300009093 Ga0105240_10062012 Ga0105240_100620122 119
149 3300009093 Ga0105240_10287859 Ga0105240_102878592 119
150 3300009551 Ga0105238_10077623 Ga0105238_100776232 119
151 3300013104 Ga0157370_11603887 Ga0157370_116038872 119
152 3300014325 Ga0163163_10226968 Ga0163163_102269682 119
153 3300025913 Ga0207695_10409365 Ga0207695_104093652 119
154 3300025913 Ga0207695_10448792 Ga0207695_104487922 119
155 3300025924 Ga0207694_10047468 Ga0207694_100474683 119
156 3300025949 Ga0207667_10065724 Ga0207667_100657242 119
157 3300026078 Ga0207702_10096496 Ga0207702_100964962 119
158 3300028556 Ga0265337_1095102 Ga0265337_10951022 119
159 3300028563 Ga0265319_1032065 Ga0265319_10320652 119
160 3300028563 Ga0265319_1039466 Ga0265319_10394662 119
161 3300028573 Ga0265334_10226720 Ga0265334_102267201 119
162 3300028653 Ga0265323_10000058 Ga0265323_1000005829 119
163 3300028653 Ga0265323_10019848 Ga0265323_100198482 119
164 3300028653 Ga0265323_10053634 Ga0265323_100536341 119
165 3300028800 Ga0265338_10000843 Ga0265338_100008434 119
166 3300028800 Ga0265338_10011803 Ga0265338_100118037 119
167 3300028800 Ga0265338_10033786 Ga0265338_100337861 119
168 3300028800 Ga0265338_11171874 Ga0265338_111718741 119
169 3300029957 Ga0265324_10039772 Ga0265324_100397722 119
170 3300031240 Ga0265320_10063639 Ga0265320_100636393 119
171 3300031240 Ga0265320_10570540 Ga0265320_105705401 119
172 3300031241 Ga0265325_10055685 Ga0265325_100556852 119
173 3300031251 Ga0265327_10107511 Ga0265327_101075112 119
174 3300031344 Ga0265316_10029147 Ga0265316_100291473 119
175 3300031344 Ga0265316_10828222 Ga0265316_108282222 119
176 3300031344 Ga0265316_11143673 Ga0265316_111436731 119
177 3300031595 Ga0265313_10056424 Ga0265313_100564242 119
178 3300031711 Ga0265314_10024461 Ga0265314_100244614 119
179 3300035086 Ga0373934_0062832 Ga0373934_0062832_824_1198 119
180 3300035695 Ga0373927_0013889 Ga0373927_0013889_1459_1821 119
181 3300037068 Ga0373925_0010130 Ga0373925_0010130_5363_5725 119
182 3300042876 Ga0451577_1658383 Ga0451577_1658383_179_541 119
183 3300045051 Ga0451576_0316618 Ga0451576_0316618_654_1016 119
184 3300046472 Ga0495580_1104870 Ga0495580_1104870_23_415 119
185 3300046529 Ga0495652_0609875 Ga0495652_0609875_54_446 119
186 3300046543 Ga0495645_0589366 Ga0495645_0589366_51_443 119
187 3300049569 Ga0501032_0070612 Ga0501032_0070612_140_502 119
188 3300049570 Ga0501033_0051403 Ga0501033_0051403_1544_1906 119
189 3300049573 Ga0501037_0374053 Ga0501037_0374053_454_816 119
190 3300049581 Ga0501047_0356082 Ga0501047_0356082_245_607 119
191 3300049822 Ga0501035_1398361 Ga0501035_1398361_25_387 119
192 3300049823 Ga0501044_0074323 Ga0501044_0074323_624_986 119
193 3300050511 nmdc:mga08y16_238183_c1 nmdc:mga08y16_238183_c1_1498_1860 119
194 3300005365 Ga0070688_100403086 Ga0070688_1004030862 120
195 3300025936 Ga0207670_10005274 Ga0207670_100052741 120
196 3300031240 Ga0265320_10228368 Ga0265320_102283682 120
197 3300044712 Ga0453684_0141547 Ga0453684_0141547_1890_2291 120
198 3300045051 Ga0451576_0085114 Ga0451576_0085114_1294_1659 120
199 3300046454 Ga0495592_0000015 Ga0495592_0000015_55764_56132 120
200 3300046476 Ga0495662_0063365 Ga0495662_0063365_40_408 120
201 3300046477 Ga0495664_0023825 Ga0495664_0023825_2032_2400 120
202 3300046514 Ga0495618_0001313 Ga0495618_0001313_6212_6580 120
203 3300046517 Ga0495630_0001457 Ga0495630_0001457_2365_2733 120
204 3300046526 Ga0495666_0077309 Ga0495666_0077309_1172_1540 120
205 3300046529 Ga0495652_0048827 Ga0495652_0048827_2280_2648 120
206 3300046533 Ga0495640_0015274 Ga0495640_0015274_5225_5593 120
207 3300046535 Ga0495586_0000284 Ga0495586_0000284_9746_10114 120
208 3300046642 Ga0495634_0135303 Ga0495634_0135303_1097_1465 120
209 3300047317 Ga0495604_0891662 Ga0495604_0891662_178_546 120
210 3300047319 Ga0495674_0010849 Ga0495674_0010849_2939_3307 120
211 3300050508 nmdc:mga09592_190337_c1 nmdc:mga09592_190337_c1_58_465 120
212 3300005435 Ga0070714_100001104 Ga0070714_10000110419 121
213 3300025929 Ga0207664_10006696 Ga0207664_100066967 121
214 3300028573 Ga0265334_10019703 Ga0265334_100197033 121
215 3300031247 Ga0265340_10021571 Ga0265340_100215714 123
216 3300003316 rootH1_10077651 rootH1_100776518 141
217 3300003322 rootL2_10170583 rootL2_101705839 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01242

PTPS

6-pyruvoyl tetrahydropterin synthase

2

118

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ntk-assembly1.cif.gz_D qued from e. coli 0.8879 7 140
4ntm-assembly1.cif.gz_C qued soaked with sepiapterin (selenomethionine substituted protein) 0.8842 7 137
4ntm-assembly1.cif.gz_A qued soaked with sepiapterin (selenomethionine substituted protein) 0.8763 5 138
4ntk-assembly1.cif.gz_D qued from e. coli 0.874 7 140
4ntm-assembly1.cif.gz_C qued soaked with sepiapterin (selenomethionine substituted protein) 0.8625 7 137
ID Description Score Start End Superfamily
4ntmA00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8647 7 138 3.30.479.10
4ntmA00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8439 7 138 3.30.479.10
2dttD00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.7997 5 138 3.30.479.10
2dttD00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.7855 5 138 3.30.479.10
3d7jC00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.7762 7 137 3.30.479.10
ID Description Score Start End GO Terms
AF-A0A0F9KZB9-F1-model_v4 6-pyruvoyl tetrahydrobiopterin synthase 0.9076 5 138 GO:0046872
GO:0070497
AF-A0A3M1QXN9-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9044 5 82 GO:0046872
GO:0070497
AF-A0A6J4NWU4-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9042 1 105 GO:0046872
GO:0070497
AF-T0ZZD7-F1-model_v4 Queuosine biosynthesis protein QueD 0.9037 4 93 GO:0046872
GO:0070497
AF-A0A0E3YV12-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.-.-.-) 0.9036 5 138 GO:0008616
GO:0046872
GO:0070497

Feature Viewer

pLDDT pTM Quality
89.82 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map