F329031

General Info

Members Datasets Scaffolds Average Seq Length
217 169 434 111

Family's Representative Sequence

Representative Sequence 3300041512|Ga0451853_0314811|Ga0451853_0314811_63_398
Length 111
Sequence MAYDEELADRIRELVAGEPGLTEQKMFGGLAFLVHGNMAVAASKEGGLLLRVDPARTEELLGEPDAYAFTMRGDKPMNGWLRVRPEGLEDDADLERWTEVGVSYARSLPPK

Samples

Sample ID Description Type Environment
1 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
131 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
136 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
137 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
138 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
139 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
140 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
155 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
156 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
157 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
158 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
159 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
160 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
161 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
162 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
163 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
168 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.7
Metatranscriptomes 2.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.45
Nodule 0
Rhizoplane 5.99
Rhizosphere 84.79
Stem 0
Stem Tuber 0
Unclassified 4.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451853_0314811 3300041512 Bacteria 512
2 JGI24735J21928_10004871 3300002067 Bacteria 4477
3 JGI24751J29686_10013543 3300002459 Bacteria 1683
4 Ga0065707_11080303 3300005295 Bacteria 520
5 Ga0070658_10082465 3300005327 Bacteria 2642
6 Ga0070658_10090562 3300005327 Bacteria 2520
7 Ga0070676_10468944 3300005328 Bacteria 889
8 Ga0070683_100286095 3300005329 Bacteria 1568
9 Ga0070683_100558686 3300005329 Bacteria 1094
10 Ga0070670_100062794 3300005331 Bacteria 3188
11 Ga0068869_100144420 3300005334 Bacteria 1840
12 Ga0068869_101978670 3300005334 Bacteria 523
13 Ga0070666_10067505 3300005335 Bacteria 2428
14 Ga0070680_100050807 3300005336 Bacteria 3382
15 Ga0070682_100213951 3300005337 Bacteria 1368
16 Ga0070660_100011559 3300005339 Bacteria 6282
17 Ga0070691_10007001 3300005341 Bacteria 5167
18 Ga0070661_100057906 3300005344 Bacteria 2839
19 Ga0070692_10037186 3300005345 Bacteria 2473
20 Ga0070675_100003882 3300005354 Bacteria 11335
21 Ga0070675_102016573 3300005354 Bacteria 532
22 Ga0070671_100002008 3300005355 Bacteria 15636
23 Ga0070671_100465183 3300005355 Bacteria 1086
24 Ga0070673_100033174 3300005364 Bacteria 3895
25 Ga0070688_100045812 3300005365 Bacteria 2705
26 Ga0070659_100093010 3300005366 Bacteria 2419
27 Ga0070667_100117567 3300005367 Bacteria 2310
28 Ga0070701_10399813 3300005438 Bacteria 870
29 Ga0070663_100096949 3300005455 Bacteria 2194
30 Ga0070678_100004502 3300005456 Bacteria 7910
31 Ga0070662_100443137 3300005457 Bacteria 1077
32 Ga0070681_10022173 3300005458 Bacteria 6374
33 Ga0070685_10423697 3300005466 Bacteria 927
34 Ga0070685_10720460 3300005466 Bacteria 729
35 Ga0070679_100013243 3300005530 Bacteria 7894
36 Ga0070684_100115044 3300005535 Bacteria 2415
37 Ga0070684_100942217 3300005535 Unclassified 809
38 Ga0070693_100063010 3300005547 Bacteria 2159
39 Ga0070665_100000859 3300005548 Bacteria 39502
40 Ga0068855_100018366 3300005563 Bacteria 8401
41 Ga0068855_100658730 3300005563 Bacteria 1124
42 Ga0070664_100989063 3300005564 Bacteria 790
43 Ga0068857_101335229 3300005577 Bacteria 696
44 Ga0068854_100057758 3300005578 Bacteria 2799
45 Ga0068856_100449962 3300005614 Bacteria 1309
46 Ga0070702_100000559 3300005615 Bacteria 13578
47 Ga0068852_100036266 3300005616 Bacteria 4124
48 Ga0068859_100412190 3300005617 Bacteria 1447
49 Ga0068864_100072104 3300005618 Bacteria 3009
50 Ga0068861_100919484 3300005719 Bacteria 830
51 Ga0068870_10107768 3300005840 Bacteria 1585
52 Ga0068863_100008175 3300005841 Bacteria 10218
53 Ga0068863_100010275 3300005841 Bacteria 9097
54 Ga0068858_100015434 3300005842 Bacteria 7184
55 Ga0068860_100000017 3300005843 Bacteria 307083
56 Ga0068860_100103825 3300005843 Bacteria 2713
57 Ga0068862_100446964 3300005844 Bacteria 1218
58 Ga0068862_101776515 3300005844 Bacteria 626
59 Ga0081455_10001878 3300005937 Bacteria 25279
60 Ga0081455_10026204 3300005937 Bacteria 5370
61 Ga0081539_10004044 3300005985 Bacteria 16805
62 Ga0081539_10004279 3300005985 Bacteria 16013
63 Ga0081539_10154542 3300005985 Bacteria 1100
64 Ga0070717_10044645 3300006028 Bacteria 3621
65 Ga0070717_11521384 3300006028 Bacteria 607
66 Ga0075365_10011515 3300006038 Bacteria 5202
67 Ga0075365_10167820 3300006038 Bacteria 1531
68 Ga0075364_10005752 3300006051 Bacteria 7231
69 Ga0075432_10035398 3300006058 Bacteria 1735
70 Ga0070712_100030854 3300006175 Bacteria 3606
71 Ga0075362_10036433 3300006177 Bacteria 2152
72 Ga0075362_10184387 3300006177 Bacteria 1012
73 Ga0075367_10163043 3300006178 Bacteria 1386
74 Ga0097621_100021804 3300006237 Bacteria 4963
75 Ga0068871_100103179 3300006358 Bacteria 2391
76 Ga0075433_10020355 3300006852 Bacteria 5545
77 Ga0075434_100025229 3300006871 Bacteria 5816
78 Ga0075434_100676274 3300006871 Bacteria 1050
79 Ga0097620_100412183 3300006931 Bacteria 1447
80 Ga0075435_100070126 3300007076 Bacteria 2860
81 Ga0105251_10030963 3300009011 Bacteria 2681
82 Ga0105240_10105505 3300009093 Bacteria 3421
83 Ga0105240_11118258 3300009093 Bacteria 837
84 Ga0111539_10027765 3300009094 Bacteria 6912
85 Ga0105245_10080907 3300009098 Bacteria 2968
86 Ga0105245_10235104 3300009098 Bacteria 1774
87 Ga0105245_10552044 3300009098 Bacteria 1174
88 Ga0105247_10849331 3300009101 Bacteria 701
89 Ga0105247_10899062 3300009101 Bacteria 684
90 Ga0114129_10326176 3300009147 Bacteria 2040
91 Ga0105237_10365942 3300009545 Bacteria 1446
92 Ga0105237_11394288 3300009545 Bacteria 707
93 Ga0105238_10230176 3300009551 Bacteria 1830
94 Ga0105238_10889905 3300009551 Bacteria 908
95 Ga0105249_10390078 3300009553 Bacteria 1420
96 Ga0105239_10543575 3300010375 Bacteria 1323
97 Ga0105246_11314750 3300011119 Bacteria 671
98 Ga0157373_10175340 3300013100 Bacteria 1509
99 Ga0157371_10043474 3300013102 Bacteria 3200
100 Ga0157370_10055340 3300013104 Bacteria 3780
101 Ga0157369_10191412 3300013105 Bacteria 2149
102 Ga0157372_10583258 3300013307 Bacteria 1303
103 Ga0157372_10933395 3300013307 Bacteria 1006
104 Ga0157375_11239319 3300013308 Bacteria 876
105 Ga0157375_11953685 3300013308 Bacteria 697
106 Ga0163163_11376559 3300014325 Unclassified 767
107 Ga0157377_10001657 3300014745 Bacteria 9718
108 Ga0157379_10605798 3300014968 Bacteria 1023
109 Ga0157376_11193692 3300014969 Bacteria 789
110 Ga0157376_12284321 3300014969 Bacteria 580
111 Ga0206354_10405441 3300020081 Bacteria 785
112 Ga0206354_11453434 3300020081 Bacteria 1853
113 Ga0206353_10033293 3300020082 Bacteria 1346
114 Ga0206353_10189183 3300020082 Bacteria 1894
115 Ga0206353_10448702 3300020082 Bacteria 2032
116 Ga0207642_10668257 3300025899 Bacteria 652
117 Ga0207688_10031149 3300025901 Bacteria 2943
118 Ga0207688_10171620 3300025901 Bacteria 1290
119 Ga0207680_10561050 3300025903 Bacteria 815
120 Ga0207645_10170949 3300025907 Bacteria 1424
121 Ga0207643_10000143 3300025908 Bacteria 48474
122 Ga0207695_10474877 3300025913 Bacteria 1133
123 Ga0207671_10344601 3300025914 Bacteria 1181
124 Ga0207663_10327873 3300025916 Bacteria 1152
125 Ga0207660_10116836 3300025917 Bacteria 2015
126 Ga0207662_10125153 3300025918 Bacteria 1616
127 Ga0207657_10023765 3300025919 Bacteria 5699
128 Ga0207657_10281282 3300025919 Bacteria 1321
129 Ga0207652_10642731 3300025921 Bacteria 949
130 Ga0207652_11286716 3300025921 Bacteria 634
131 Ga0207681_10759265 3300025923 Bacteria 809
132 Ga0207694_10299216 3300025924 Bacteria 1324
133 Ga0207650_10311179 3300025925 Bacteria 1288
134 Ga0207659_11347906 3300025926 Bacteria 612
135 Ga0207687_10149934 3300025927 Bacteria 1778
136 Ga0207687_10520743 3300025927 Bacteria 995
137 Ga0207644_10190222 3300025931 Bacteria 1613
138 Ga0207644_10360470 3300025931 Bacteria 1182
139 Ga0207706_10293991 3300025933 Bacteria 1416
140 Ga0207704_11482852 3300025938 Bacteria 582
141 Ga0207711_10238935 3300025941 Bacteria 1665
142 Ga0207689_10000302 3300025942 Bacteria 45130
143 Ga0207661_10260483 3300025944 Unclassified 1544
144 Ga0207679_10005725 3300025945 Bacteria 7795
145 Ga0207679_10905245 3300025945 Bacteria 807
146 Ga0207679_10926744 3300025945 Unclassified 797
147 Ga0207667_10145639 3300025949 Unclassified 2438
148 Ga0207651_10010786 3300025960 Bacteria 5081
149 Ga0207640_10021326 3300025981 Bacteria 3861
150 Ga0207658_10109312 3300025986 Bacteria 2182
151 Ga0207677_10661319 3300026023 Bacteria 923
152 Ga0207703_10010951 3300026035 Bacteria 7067
153 Ga0207678_10000295 3300026067 Bacteria 45080
154 Ga0207708_10139438 3300026075 Bacteria 1901
155 Ga0207641_10003261 3300026088 Bacteria 14451
156 Ga0207641_10008508 3300026088 Bacteria 8479
157 Ga0207676_10001775 3300026095 Bacteria 15818
158 Ga0207674_10039275 3300026116 Bacteria 4908
159 Ga0207674_11010261 3300026116 Bacteria 801
160 Ga0207675_100183553 3300026118 Bacteria 2004
161 Ga0207683_10000316 3300026121 Bacteria 43919
162 Ga0207683_11097275 3300026121 Bacteria 738
163 Ga0207698_10010826 3300026142 Bacteria 5886
164 Ga0268266_10007462 3300028379 Bacteria 9862
165 Ga0268264_10000033 3300028381 Bacteria 404123
166 Ga0307513_10010665 3300031456 Bacteria 11497
167 Ga0307513_11096986 3300031456 Unclassified 508
168 Ga0307409_100618993 3300031995 Bacteria 1072
169 Ga0307416_100367032 3300032002 Bacteria 1464
170 Ga0307415_100935007 3300032126 Bacteria 801
171 Ga0307507_10139715 3300033179 Unclassified 1862
172 Ga0373930_0160379 3300034816 Bacteria 568
173 Ga0373931_0626039 3300035691 Bacteria 705
174 Ga0373931_0686784 3300035691 Bacteria 675
175 Ga0395901_0326268 3300038443 Bacteria 1588
176 Ga0436365_0733005 3300039437 Unclassified 1631
177 Ga0451791_0367698 3300041451 Bacteria 845
178 Ga0451802_0534782 3300041460 Bacteria 898
179 Ga0451853_1083858 3300041512 Bacteria 1045
180 Ga0439448_0055360 3300042005 Bacteria 1304
181 Ga0439463_020429 3300042016 Bacteria 1652
182 Ga0439464_0083555 3300042439 Bacteria 956
183 Ga0466971_0600147 3300044719 Bacteria 549
184 Ga0466957_1123641 3300044842 Bacteria 567
185 Ga0466959_0145642 3300045049 Bacteria 1672
186 Ga0466967_0152995 3300045976 Bacteria 2158
187 Ga0496101_0690352 3300048904 Bacteria 806
188 Ga0496102_0618083 3300048905 Bacteria 1007
189 Ga0496105_0012789 3300048908 Bacteria 6650
190 Ga0496106_0033743 3300048909 Bacteria 3820
191 Ga0496106_0615813 3300048909 Bacteria 869
192 Ga0496109_1878960 3300048912 Bacteria 531
193 Ga0496110_0650994 3300048913 Bacteria 953
194 Ga0496110_1517524 3300048913 Bacteria 580
195 Ga0496112_0264164 3300048915 Bacteria 1670
196 Ga0496113_0142929 3300048916 Bacteria 1884
197 Ga0496115_1136786 3300048918 Bacteria 590
198 Ga0501070_0365309 3300049586 Bacteria 1170
199 Ga0501209_026692 3300049656 Bacteria 1428
200 Ga0501228_067583 3300049666 Unclassified 517
201 Ga0501221_167207 3300049704 Bacteria 593
202 Ga0501245_115270 3300049708 Bacteria 560
203 Ga0501212_038180 3300049851 Bacteria 789
204 nmdc:mga03n38_271878_c1 3300050490 Bacteria 902
205 nmdc:mga00v17_60534_c1 3300050491 Bacteria 2326
206 nmdc:mga00v17_754634_c1 3300050491 Bacteria 622
207 nmdc:mga0yw44_147898_c1 3300050492 Bacteria 1531
208 nmdc:mga0yw44_412128_c1 3300050492 Bacteria 914
209 nmdc:mga0yw44_802292_c1 3300050492 Unclassified 639
210 nmdc:mga06z11_165542_c1 3300050494 Bacteria 1266
211 nmdc:mga04h51_403786_c1 3300050495 Bacteria 572
212 nmdc:mga05p37_280732_c1 3300050507 Bacteria 1986
213 nmdc:mga09592_531027_c1 3300050508 Bacteria 1011
214 nmdc:mga06r32_1686888_c1 3300050510 Bacteria 571
215 nmdc:mga0rr50_573110_c1 3300050513 Bacteria 962
216 nmdc:mga08x19_9536_c1 3300050514 Bacteria 5813
217 nmdc:mga0a205_33877_c1 3300050515 Bacteria 4898
218 Ga0451853_0314811
219 JGI24735J21928_10004871
220 JGI24751J29686_10013543
221 Ga0065707_11080303
222 Ga0070658_10082465
223 Ga0070658_10090562
224 Ga0070676_10468944
225 Ga0070683_100286095
226 Ga0070683_100558686
227 Ga0070670_100062794
228 Ga0068869_100144420
229 Ga0068869_101978670
230 Ga0070666_10067505
231 Ga0070680_100050807
232 Ga0070682_100213951
233 Ga0070660_100011559
234 Ga0070691_10007001
235 Ga0070661_100057906
236 Ga0070692_10037186
237 Ga0070675_100003882
238 Ga0070675_102016573
239 Ga0070671_100002008
240 Ga0070671_100465183
241 Ga0070673_100033174
242 Ga0070688_100045812
243 Ga0070659_100093010
244 Ga0070667_100117567
245 Ga0070701_10399813
246 Ga0070663_100096949
247 Ga0070678_100004502
248 Ga0070662_100443137
249 Ga0070681_10022173
250 Ga0070685_10423697
251 Ga0070685_10720460
252 Ga0070679_100013243
253 Ga0070684_100115044
254 Ga0070684_100942217
255 Ga0070693_100063010
256 Ga0070665_100000859
257 Ga0068855_100018366
258 Ga0068855_100658730
259 Ga0070664_100989063
260 Ga0068857_101335229
261 Ga0068854_100057758
262 Ga0068856_100449962
263 Ga0070702_100000559
264 Ga0068852_100036266
265 Ga0068859_100412190
266 Ga0068864_100072104
267 Ga0068861_100919484
268 Ga0068870_10107768
269 Ga0068863_100008175
270 Ga0068863_100010275
271 Ga0068858_100015434
272 Ga0068860_100000017
273 Ga0068860_100103825
274 Ga0068862_100446964
275 Ga0068862_101776515
276 Ga0081455_10001878
277 Ga0081455_10026204
278 Ga0081539_10004044
279 Ga0081539_10004279
280 Ga0081539_10154542
281 Ga0070717_10044645
282 Ga0070717_11521384
283 Ga0075365_10011515
284 Ga0075365_10167820
285 Ga0075364_10005752
286 Ga0075432_10035398
287 Ga0070712_100030854
288 Ga0075362_10036433
289 Ga0075362_10184387
290 Ga0075367_10163043
291 Ga0097621_100021804
292 Ga0068871_100103179
293 Ga0075433_10020355
294 Ga0075434_100025229
295 Ga0075434_100676274
296 Ga0097620_100412183
297 Ga0075435_100070126
298 Ga0105251_10030963
299 Ga0105240_10105505
300 Ga0105240_11118258
301 Ga0111539_10027765
302 Ga0105245_10080907
303 Ga0105245_10235104
304 Ga0105245_10552044
305 Ga0105247_10849331
306 Ga0105247_10899062
307 Ga0114129_10326176
308 Ga0105237_10365942
309 Ga0105237_11394288
310 Ga0105238_10230176
311 Ga0105238_10889905
312 Ga0105249_10390078
313 Ga0105239_10543575
314 Ga0105246_11314750
315 Ga0157373_10175340
316 Ga0157371_10043474
317 Ga0157370_10055340
318 Ga0157369_10191412
319 Ga0157372_10583258
320 Ga0157372_10933395
321 Ga0157375_11239319
322 Ga0157375_11953685
323 Ga0163163_11376559
324 Ga0157377_10001657
325 Ga0157379_10605798
326 Ga0157376_11193692
327 Ga0157376_12284321
328 Ga0206354_10405441
329 Ga0206354_11453434
330 Ga0206353_10033293
331 Ga0206353_10189183
332 Ga0206353_10448702
333 Ga0207642_10668257
334 Ga0207688_10031149
335 Ga0207688_10171620
336 Ga0207680_10561050
337 Ga0207645_10170949
338 Ga0207643_10000143
339 Ga0207695_10474877
340 Ga0207671_10344601
341 Ga0207663_10327873
342 Ga0207660_10116836
343 Ga0207662_10125153
344 Ga0207657_10023765
345 Ga0207657_10281282
346 Ga0207652_10642731
347 Ga0207652_11286716
348 Ga0207681_10759265
349 Ga0207694_10299216
350 Ga0207650_10311179
351 Ga0207659_11347906
352 Ga0207687_10149934
353 Ga0207687_10520743
354 Ga0207644_10190222
355 Ga0207644_10360470
356 Ga0207706_10293991
357 Ga0207704_11482852
358 Ga0207711_10238935
359 Ga0207689_10000302
360 Ga0207661_10260483
361 Ga0207679_10005725
362 Ga0207679_10905245
363 Ga0207679_10926744
364 Ga0207667_10145639
365 Ga0207651_10010786
366 Ga0207640_10021326
367 Ga0207658_10109312
368 Ga0207677_10661319
369 Ga0207703_10010951
370 Ga0207678_10000295
371 Ga0207708_10139438
372 Ga0207641_10003261
373 Ga0207641_10008508
374 Ga0207676_10001775
375 Ga0207674_10039275
376 Ga0207674_11010261
377 Ga0207675_100183553
378 Ga0207683_10000316
379 Ga0207683_11097275
380 Ga0207698_10010826
381 Ga0268266_10007462
382 Ga0268264_10000033
383 Ga0307513_10010665
384 Ga0307513_11096986
385 Ga0307409_100618993
386 Ga0307416_100367032
387 Ga0307415_100935007
388 Ga0307507_10139715
389 Ga0373930_0160379
390 Ga0373931_0626039
391 Ga0373931_0686784
392 Ga0395901_0326268
393 Ga0436365_0733005
394 Ga0451791_0367698
395 Ga0451802_0534782
396 Ga0451853_1083858
397 Ga0439448_0055360
398 Ga0439463_020429
399 Ga0439464_0083555
400 Ga0466971_0600147
401 Ga0466957_1123641
402 Ga0466959_0145642
403 Ga0466967_0152995
404 Ga0496101_0690352
405 Ga0496102_0618083
406 Ga0496105_0012789
407 Ga0496106_0033743
408 Ga0496106_0615813
409 Ga0496109_1878960
410 Ga0496110_0650994
411 Ga0496110_1517524
412 Ga0496112_0264164
413 Ga0496113_0142929
414 Ga0496115_1136786
415 Ga0501070_0365309
416 Ga0501209_026692
417 Ga0501228_067583
418 Ga0501221_167207
419 Ga0501245_115270
420 Ga0501212_038180
421 nmdc:mga03n38_271878_c1
422 nmdc:mga00v17_60534_c1
423 nmdc:mga00v17_754634_c1
424 nmdc:mga0yw44_147898_c1
425 nmdc:mga0yw44_412128_c1
426 nmdc:mga0yw44_802292_c1
427 nmdc:mga06z11_165542_c1
428 nmdc:mga04h51_403786_c1
429 nmdc:mga05p37_280732_c1
430 nmdc:mga09592_531027_c1
431 nmdc:mga06r32_1686888_c1
432 nmdc:mga0rr50_573110_c1
433 nmdc:mga08x19_9536_c1
434 nmdc:mga0a205_33877_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04993

TfoX_N

TfoX N-terminal domain

13

105

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kfp-assembly1.cif.gz_A solution nmr structure of pspto_3016 from pseudomonas syringae. northeast structural genomics consortium target psr293. 0.7687 48 105
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.7164 8 108
2fki-assembly1.cif.gz_A nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226 0.705 7 110
3h9x-assembly1.cif.gz_A crystal structure of the pspto_3016 protein from pseudomonas syringae, northeast structural genomics consortium target psr293 0.6994 9 105
2fki-assembly1.cif.gz_A nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226 0.6683 7 110
ID Description Score Start End Superfamily
2a1vA00 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7165 8 108 3.90.1150.30
3h9xA00 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7021 9 105 3.90.1150.30
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6927 1 110 3.90.1150.30
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6821 1 110 3.90.1150.30
6jfwA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.681 5 32 3.30.1330.60
ID Description Score Start End GO Terms
AF-A0A7J9YWT8-F1-model_v4 RNA methyltransferase 0.9793 1 110 GO:0008168
GO:0032259
AF-A0A7I7Q373-F1-model_v4 TfoX N-terminal domain-containing protein 0.9791 38 110
AF-A0A4R8J6C8-F1-model_v4 deleted 0.9776 5 110
AF-A0A7I7WJ16-F1-model_v4 TfoX N-terminal domain-containing protein 0.9774 2 110
AF-A0A358ZX78-F1-model_v4 deleted 0.9758 1 110

Map