F328944

General Info

Members Datasets Scaffolds Average Seq Length
217 138 434 134

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100268305|Ga0307416_1002683052
Length 134
Sequence MTRFGIDVLTALRLIEEDVPIADTHQLVAPNVLRSHVLSHLYGSVRRGELSRDAARVRLDRLSSLRVRLLGDRVSRAVAWKIAEDLDWDDTTTAEYVAVAKLQADAFVTLDAELARRVEGVVVPVAPFEALRTP

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
8 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
9 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
10 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
11 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
12 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
14 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
15 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
16 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
17 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
18 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
19 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
20 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
21 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
22 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
25 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
26 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
27 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
35 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
36 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
37 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
38 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
39 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
40 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
41 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
42 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
43 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
44 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
45 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
46 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
47 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
48 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
49 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
50 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
51 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
52 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
53 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
54 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
55 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
56 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
57 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
58 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
59 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
60 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
61 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
62 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
63 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
64 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
65 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
66 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
67 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
68 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
69 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
70 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
71 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
72 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
73 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
74 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
75 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
76 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
77 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
78 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
79 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
80 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
81 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
82 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
83 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
84 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
85 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
86 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
87 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
88 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
89 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
90 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
91 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
92 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
93 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
94 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
95 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
96 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
97 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
98 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
112 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
113 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
114 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
115 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
116 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
117 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
118 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
119 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
120 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
121 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
122 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
123 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
125 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
126 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
127 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
128 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
129 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
130 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
131 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
132 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
133 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
134 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
135 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
136 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
137 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
138 2919443155 Agromyces sp. 3263 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0
Isolates 0.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.92
Nodule 0
Rhizoplane 4.15
Rhizosphere 93.55
Stem 0
Stem Tuber 0
Unclassified 13.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_100268305 3300032002 Bacteria 1674
2 JGI25407J50210_10005835 3300003373 Bacteria 3043
3 JGI25407J50210_10007988 3300003373 Bacteria 2659
4 Ga0070660_100669679 3300005339 Bacteria 869
5 Ga0070713_102138278 3300005436 Bacteria 542
6 Ga0070710_10498969 3300005437 Bacteria 833
7 Ga0070711_100048544 3300005439 Bacteria 2904
8 Ga0070698_100052981 3300005471 Bacteria 4125
9 Ga0070699_100000016 3300005518 Bacteria 206838
10 Ga0070696_101703600 3300005546 Bacteria 543
11 Ga0070702_100460172 3300005615 Unclassified 925
12 Ga0068861_101510747 3300005719 Bacteria 659
13 Ga0081455_10141742 3300005937 Bacteria 1866
14 Ga0081538_10007097 3300005981 Bacteria 9733
15 Ga0081538_10008067 3300005981 Bacteria 8996
16 Ga0081538_10013641 3300005981 Bacteria 6426
17 Ga0081538_10026810 3300005981 Bacteria 4017
18 Ga0081538_10058417 3300005981 Bacteria 2237
19 Ga0070715_10363220 3300006163 Unclassified 794
20 Ga0070712_100092615 3300006175 Bacteria 2216
21 Ga0097621_102070115 3300006237 Unclassified 544
22 Ga0075428_102152156 3300006844 Unclassified 576
23 Ga0075433_10007067 3300006852 Bacteria 8893
24 Ga0075433_11103743 3300006852 Bacteria 690
25 Ga0075434_100030542 3300006871 Bacteria 5306
26 Ga0075429_100626110 3300006880 Bacteria 943
27 Ga0075435_100299557 3300007076 Bacteria 1375
28 Ga0099794_10114335 3300007265 Bacteria 1354
29 Ga0114129_10007807 3300009147 Bacteria 15221
30 Ga0114129_10054835 3300009147 Bacteria 5588
31 Ga0114129_12253595 3300009147 Bacteria 654
32 Ga0105243_10495781 3300009148 Bacteria 1156
33 Ga0105243_11071130 3300009148 Bacteria 813
34 Ga0163163_10724954 3300014325 Unclassified 1058
35 Ga0213876_10090381 3300021384 Unclassified 1621
36 Ga0207693_10009575 3300025915 Bacteria 7889
37 Ga0207646_10584529 3300025922 Bacteria 1003
38 Ga0207700_10128814 3300025928 Bacteria 2063
39 Ga0207709_10039355 3300025935 Bacteria 2823
40 Ga0207665_11178580 3300025939 Bacteria 611
41 Ga0207675_100876323 3300026118 Bacteria 913
42 Ga0209588_1043341 3300027671 Bacteria 1453
43 Ga0307408_100119490 3300031548 Bacteria 2039
44 Ga0307405_10618498 3300031731 Bacteria 886
45 Ga0307413_10071020 3300031824 Bacteria 2192
46 Ga0307413_10557080 3300031824 Unclassified 931
47 Ga0307410_10198164 3300031852 Bacteria 1531
48 Ga0307410_10265807 3300031852 Bacteria 1340
49 Ga0307406_10016364 3300031901 Bacteria 4309
50 Ga0307406_10493405 3300031901 Bacteria 991
51 Ga0307406_10944681 3300031901 Bacteria 737
52 Ga0307407_10054976 3300031903 Bacteria 2298
53 Ga0307407_10116976 3300031903 Bacteria 1683
54 Ga0307407_10844581 3300031903 Bacteria 699
55 Ga0307412_10889876 3300031911 Bacteria 779
56 Ga0307409_100024421 3300031995 Bacteria 4215
57 Ga0307409_100067531 3300031995 Bacteria 2824
58 Ga0307416_100168871 3300032002 Bacteria 2033
59 Ga0307416_100439307 3300032002 Bacteria 1354
60 Ga0307416_101505579 3300032002 Bacteria 778
61 Ga0307414_10120330 3300032004 Bacteria 2017
62 Ga0307411_10664869 3300032005 Bacteria 903
63 Ga0307415_100038779 3300032126 Bacteria 3142
64 Ga0307415_100054898 3300032126 Bacteria 2722
65 Ga0307415_100170818 3300032126 Bacteria 1695
66 Ga0307415_100313248 3300032126 Bacteria 1305
67 Ga0307415_100734828 3300032126 Bacteria 894
68 Ga0307415_101553267 3300032126 Bacteria 634
69 Ga0373940_0124762 3300035088 Bacteria 802
70 Ga0395899_0004621 3300037312 Bacteria 10730
71 Ga0395899_0166663 3300037312 Bacteria 1554
72 Ga0395899_0169728 3300037312 Bacteria 1537
73 Ga0395899_0367140 3300037312 Bacteria 959
74 Ga0395900_0030538 3300037418 Bacteria 5533
75 Ga0395900_0070349 3300037418 Bacteria 3597
76 Ga0395900_0076141 3300037418 Bacteria 3449
77 Ga0395900_0193767 3300037418 Bacteria 2060
78 Ga0395900_0247811 3300037418 Bacteria 1784
79 Ga0395900_1136448 3300037418 Bacteria 698
80 Ga0395898_0014650 3300037466 Bacteria 8052
81 Ga0395898_0029265 3300037466 Bacteria 5518
82 Ga0395898_0111613 3300037466 Bacteria 2620
83 Ga0395898_0149777 3300037466 Bacteria 2233
84 Ga0395905_0008759 3300037471 Bacteria 9949
85 Ga0395905_0014156 3300037471 Bacteria 7622
86 Ga0395905_0025522 3300037471 Bacteria 5573
87 Ga0395905_0065676 3300037471 Bacteria 3397
88 Ga0395905_0155939 3300037471 Bacteria 2148
89 Ga0395905_0313621 3300037471 Bacteria 1457
90 Ga0395901_0003044 3300038443 Bacteria 16896
91 Ga0395901_0018666 3300038443 Bacteria 7083
92 Ga0395901_0046962 3300038443 Bacteria 4485
93 Ga0395901_0093532 3300038443 Bacteria 3148
94 Ga0395901_0112869 3300038443 Bacteria 2854
95 Ga0395901_0215955 3300038443 Bacteria 2006
96 Ga0395901_0288483 3300038443 Bacteria 1704
97 Ga0395901_0291948 3300038443 Bacteria 1692
98 Ga0395901_0300485 3300038443 Bacteria 1664
99 Ga0395901_0302471 3300038443 Bacteria 1658
100 Ga0395901_0441945 3300038443 Bacteria 1331
101 Ga0395901_1734367 3300038443 Unclassified 575
102 Ga0436365_0637700 3300039437 Bacteria 11040
103 Ga0451853_3371136 3300041512 Bacteria 853
104 Ga0439443_000498 3300042003 Unclassified 3523
105 Ga0439448_0023063 3300042005 Unclassified 1938
106 Ga0439450_002350 3300042008 Bacteria 2962
107 Ga0439450_067926 3300042008 Bacteria 871
108 Ga0439451_011484 3300042009 Unclassified 1788
109 Ga0439451_017174 3300042009 Bacteria 1458
110 Ga0439454_018839 3300042011 Unclassified 998
111 Ga0439455_0002346 3300042012 Bacteria 3417
112 Ga0439456_135015 3300042013 Bacteria 570
113 Ga0439463_042318 3300042016 Bacteria 1158
114 Ga0450900_001848 3300042136 Bacteria 2150
115 Ga0450904_015349 3300042139 Unclassified 765
116 Ga0450905_001646 3300042142 Bacteria 2853
117 Ga0450910_014539 3300042147 Unclassified 1153
118 Ga0439444_0010214 3300042437 Unclassified 1496
119 Ga0439459_0016049 3300042438 Unclassified 1380
120 Ga0439464_0027623 3300042439 Unclassified 1578
121 Ga0439460_0072744 3300042461 Bacteria 1068
122 Ga0450916_018552 3300042530 Unclassified 938
123 Ga0439440_0000307 3300042993 Bacteria 7982
124 Ga0439440_0157063 3300042993 Bacteria 654
125 Ga0466967_1800170 3300045976 Bacteria 610
126 Ga0495590_0300313 3300046457 Bacteria 604
127 Ga0495653_0128713 3300046463 Bacteria 1795
128 Ga0495662_0638229 3300046476 Bacteria 520
129 Ga0495584_0162602 3300046491 Bacteria 1135
130 Ga0495608_0434344 3300046511 Unclassified 800
131 Ga0495618_0161145 3300046514 Unclassified 1430
132 Ga0495628_0163576 3300046516 Bacteria 1690
133 Ga0495630_0311534 3300046517 Bacteria 1203
134 Ga0495652_0109552 3300046529 Unclassified 2223
135 Ga0495652_0247206 3300046529 Bacteria 1324
136 Ga0495645_0326723 3300046543 Bacteria 994
137 Ga0495667_0233717 3300046559 Bacteria 1172
138 Ga0495635_0246580 3300046663 Bacteria 1205
139 Ga0495613_0624399 3300046689 Bacteria 715
140 Ga0495624_0424033 3300046690 Unclassified 798
141 Ga0495600_0131197 3300046809 Bacteria 1629
142 Ga0495680_0063986 3300047322 Bacteria 2822
143 Ga0495684_0041850 3300047471 Bacteria 3510
144 Ga0496101_1094444 3300048904 Bacteria 626
145 Ga0496104_0188936 3300048907 Bacteria 1971
146 Ga0496108_0324853 3300048911 Bacteria 1341
147 Ga0496109_0000818 3300048912 Bacteria 25933
148 Ga0496110_0015875 3300048913 Bacteria 6279
149 Ga0496111_0114682 3300048914 Bacteria 1986
150 Ga0496112_0176793 3300048915 Bacteria 2099
151 Ga0496113_0157261 3300048916 Bacteria 1796
152 Ga0496114_0295950 3300048917 Bacteria 1429
153 Ga0501031_0068336 3300049568 Bacteria 2314
154 Ga0501032_0175678 3300049569 Bacteria 1403
155 Ga0501033_0093030 3300049570 Bacteria 2205
156 Ga0501036_0392847 3300049572 Bacteria 1157
157 Ga0501037_0203873 3300049573 Bacteria 1397
158 Ga0501038_0353290 3300049574 Bacteria 1144
159 Ga0501038_0609248 3300049574 Unclassified 825
160 Ga0501039_0021484 3300049575 Bacteria 4950
161 Ga0501039_0186342 3300049575 Bacteria 1632
162 Ga0501040_0011210 3300049576 Bacteria 5864
163 Ga0501040_0011695 3300049576 Bacteria 5743
164 Ga0501041_0009760 3300049577 Bacteria 5655
165 Ga0501042_0023064 3300049578 Bacteria 4351
166 Ga0501042_0048569 3300049578 Bacteria 3026
167 Ga0501043_0091924 3300049579 Bacteria 2386
168 Ga0501046_0014916 3300049580 Bacteria 6538
169 Ga0501048_0036368 3300049582 Bacteria 3539
170 Ga0501048_0128329 3300049582 Bacteria 1793
171 Ga0501048_0394281 3300049582 Unclassified 989
172 Ga0501068_0032571 3300049584 Bacteria 3100
173 Ga0501069_0293683 3300049585 Bacteria 952
174 Ga0501071_0013415 3300049587 Bacteria 5583
175 Ga0501071_0070691 3300049587 Bacteria 2543
176 Ga0501071_0480353 3300049587 Bacteria 952
177 Ga0501072_0007777 3300049588 Bacteria 8142
178 Ga0501072_0470004 3300049588 Bacteria 995
179 Ga0501072_0853268 3300049588 Bacteria 712
180 Ga0501073_0348871 3300049589 Unclassified 1022
181 Ga0501074_0025319 3300049590 Bacteria 4311
182 Ga0501075_0005339 3300049591 Bacteria 8789
183 Ga0501075_0048569 3300049591 Bacteria 3188
184 Ga0501076_0001406 3300049592 Bacteria 16124
185 Ga0501076_0006624 3300049592 Bacteria 8401
186 Ga0501077_0032218 3300049593 Bacteria 3337
187 Ga0501079_0038772 3300049741 Bacteria 3674
188 Ga0501079_0044454 3300049741 Bacteria 3427
189 Ga0501079_1363960 3300049741 Bacteria 558
190 Ga0501080_0029699 3300049742 Bacteria 5088
191 Ga0501080_0405463 3300049742 Bacteria 1226
192 Ga0501081_0002467 3300049743 Bacteria 11664
193 Ga0501081_0028697 3300049743 Bacteria 3756
194 Ga0501081_1070867 3300049743 Bacteria 610
195 Ga0501035_0209104 3300049822 Bacteria 1670
196 Ga0501045_0003546 3300049824 Bacteria 10711
197 Ga0501045_0014991 3300049824 Bacteria 5500
198 Ga0501045_0207861 3300049824 Bacteria 1458
199 nmdc:mga05p37_268026_c1 3300050507 Bacteria 2041
200 nmdc:mga05p37_74139_c1 3300050507 Bacteria 4189
201 nmdc:mga0n895_64127_c1 3300050512 Bacteria 3634
202 nmdc:mga0rr50_875507_c1 3300050513 Unclassified 766
203 nmdc:mga0a205_16179_c1 3300050515 Bacteria 6985
204 nmdc:mga0a205_875723_c1 3300050515 Bacteria 745
205 Ga0495595_0037202 3300053084 Bacteria 2212
206 Ga0500562_032225 3300053108 Unclassified 1383
207 Ga0500622_0022748 3300053156 Bacteria 3320
208 Ga0501084_0003392 3300054114 Bacteria 12916
209 Ga0501084_0048335 3300054114 Bacteria 3561
210 Ga0590074_025821 3300059423 Unclassified 1025
211 Ga0590075_032419 3300059424 Bacteria 1326
212 Ga0590077_135232 3300059426 Unclassified 586
213 Ga0501082_0005385 3300060353 Bacteria 11104
214 Ga0501082_0252231 3300060353 Bacteria 1535
215 Ga0530510_0147712 3300061734 Bacteria 1734
216 Ga0530510_0231476 3300061734 Bacteria 1374
217 2919446583 2919443155 Bacteria 4072969
218 Ga0307416_100268305
219 JGI25407J50210_10005835
220 JGI25407J50210_10007988
221 Ga0070660_100669679
222 Ga0070713_102138278
223 Ga0070710_10498969
224 Ga0070711_100048544
225 Ga0070698_100052981
226 Ga0070699_100000016
227 Ga0070696_101703600
228 Ga0070702_100460172
229 Ga0068861_101510747
230 Ga0081455_10141742
231 Ga0081538_10007097
232 Ga0081538_10008067
233 Ga0081538_10013641
234 Ga0081538_10026810
235 Ga0081538_10058417
236 Ga0070715_10363220
237 Ga0070712_100092615
238 Ga0097621_102070115
239 Ga0075428_102152156
240 Ga0075433_10007067
241 Ga0075433_11103743
242 Ga0075434_100030542
243 Ga0075429_100626110
244 Ga0075435_100299557
245 Ga0099794_10114335
246 Ga0114129_10007807
247 Ga0114129_10054835
248 Ga0114129_12253595
249 Ga0105243_10495781
250 Ga0105243_11071130
251 Ga0163163_10724954
252 Ga0213876_10090381
253 Ga0207693_10009575
254 Ga0207646_10584529
255 Ga0207700_10128814
256 Ga0207709_10039355
257 Ga0207665_11178580
258 Ga0207675_100876323
259 Ga0209588_1043341
260 Ga0307408_100119490
261 Ga0307405_10618498
262 Ga0307413_10071020
263 Ga0307413_10557080
264 Ga0307410_10198164
265 Ga0307410_10265807
266 Ga0307406_10016364
267 Ga0307406_10493405
268 Ga0307406_10944681
269 Ga0307407_10054976
270 Ga0307407_10116976
271 Ga0307407_10844581
272 Ga0307412_10889876
273 Ga0307409_100024421
274 Ga0307409_100067531
275 Ga0307416_100168871
276 Ga0307416_100439307
277 Ga0307416_101505579
278 Ga0307414_10120330
279 Ga0307411_10664869
280 Ga0307415_100038779
281 Ga0307415_100054898
282 Ga0307415_100170818
283 Ga0307415_100313248
284 Ga0307415_100734828
285 Ga0307415_101553267
286 Ga0373940_0124762
287 Ga0395899_0004621
288 Ga0395899_0166663
289 Ga0395899_0169728
290 Ga0395899_0367140
291 Ga0395900_0030538
292 Ga0395900_0070349
293 Ga0395900_0076141
294 Ga0395900_0193767
295 Ga0395900_0247811
296 Ga0395900_1136448
297 Ga0395898_0014650
298 Ga0395898_0029265
299 Ga0395898_0111613
300 Ga0395898_0149777
301 Ga0395905_0008759
302 Ga0395905_0014156
303 Ga0395905_0025522
304 Ga0395905_0065676
305 Ga0395905_0155939
306 Ga0395905_0313621
307 Ga0395901_0003044
308 Ga0395901_0018666
309 Ga0395901_0046962
310 Ga0395901_0093532
311 Ga0395901_0112869
312 Ga0395901_0215955
313 Ga0395901_0288483
314 Ga0395901_0291948
315 Ga0395901_0300485
316 Ga0395901_0302471
317 Ga0395901_0441945
318 Ga0395901_1734367
319 Ga0436365_0637700
320 Ga0451853_3371136
321 Ga0439443_000498
322 Ga0439448_0023063
323 Ga0439450_002350
324 Ga0439450_067926
325 Ga0439451_011484
326 Ga0439451_017174
327 Ga0439454_018839
328 Ga0439455_0002346
329 Ga0439456_135015
330 Ga0439463_042318
331 Ga0450900_001848
332 Ga0450904_015349
333 Ga0450905_001646
334 Ga0450910_014539
335 Ga0439444_0010214
336 Ga0439459_0016049
337 Ga0439464_0027623
338 Ga0439460_0072744
339 Ga0450916_018552
340 Ga0439440_0000307
341 Ga0439440_0157063
342 Ga0466967_1800170
343 Ga0495590_0300313
344 Ga0495653_0128713
345 Ga0495662_0638229
346 Ga0495584_0162602
347 Ga0495608_0434344
348 Ga0495618_0161145
349 Ga0495628_0163576
350 Ga0495630_0311534
351 Ga0495652_0109552
352 Ga0495652_0247206
353 Ga0495645_0326723
354 Ga0495667_0233717
355 Ga0495635_0246580
356 Ga0495613_0624399
357 Ga0495624_0424033
358 Ga0495600_0131197
359 Ga0495680_0063986
360 Ga0495684_0041850
361 Ga0496101_1094444
362 Ga0496104_0188936
363 Ga0496108_0324853
364 Ga0496109_0000818
365 Ga0496110_0015875
366 Ga0496111_0114682
367 Ga0496112_0176793
368 Ga0496113_0157261
369 Ga0496114_0295950
370 Ga0501031_0068336
371 Ga0501032_0175678
372 Ga0501033_0093030
373 Ga0501036_0392847
374 Ga0501037_0203873
375 Ga0501038_0353290
376 Ga0501038_0609248
377 Ga0501039_0021484
378 Ga0501039_0186342
379 Ga0501040_0011210
380 Ga0501040_0011695
381 Ga0501041_0009760
382 Ga0501042_0023064
383 Ga0501042_0048569
384 Ga0501043_0091924
385 Ga0501046_0014916
386 Ga0501048_0036368
387 Ga0501048_0128329
388 Ga0501048_0394281
389 Ga0501068_0032571
390 Ga0501069_0293683
391 Ga0501071_0013415
392 Ga0501071_0070691
393 Ga0501071_0480353
394 Ga0501072_0007777
395 Ga0501072_0470004
396 Ga0501072_0853268
397 Ga0501073_0348871
398 Ga0501074_0025319
399 Ga0501075_0005339
400 Ga0501075_0048569
401 Ga0501076_0001406
402 Ga0501076_0006624
403 Ga0501077_0032218
404 Ga0501079_0038772
405 Ga0501079_0044454
406 Ga0501079_1363960
407 Ga0501080_0029699
408 Ga0501080_0405463
409 Ga0501081_0002467
410 Ga0501081_0028697
411 Ga0501081_1070867
412 Ga0501035_0209104
413 Ga0501045_0003546
414 Ga0501045_0014991
415 Ga0501045_0207861
416 nmdc:mga05p37_268026_c1
417 nmdc:mga05p37_74139_c1
418 nmdc:mga0n895_64127_c1
419 nmdc:mga0rr50_875507_c1
420 nmdc:mga0a205_16179_c1
421 nmdc:mga0a205_875723_c1
422 Ga0495595_0037202
423 Ga0500562_032225
424 Ga0500622_0022748
425 Ga0501084_0003392
426 Ga0501084_0048335
427 Ga0590074_025821
428 Ga0590075_032419
429 Ga0590077_135232
430 Ga0501082_0005385
431 Ga0501082_0252231
432 Ga0530510_0147712
433 Ga0530510_0231476
434 2919446583

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fe1-assembly1.cif.gz_A-2 crystal structure of pae0151 from pyrobaculum aerophilum 0.8612 20 139
1v8o-assembly2.cif.gz_H crystal structure of pae2754 from pyrobaculum aerophilum 0.8011 18 146
2fe1-assembly1.cif.gz_A-2 crystal structure of pae0151 from pyrobaculum aerophilum 0.7933 20 139
1v8p-assembly1.cif.gz_D crystal structure of pae2754 from pyrobaculum aerophilum 0.7686 19 146
1v8p-assembly2.cif.gz_F crystal structure of pae2754 from pyrobaculum aerophilum 0.7623 17 146
ID Description Score Start End Superfamily
2wwwD03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Signal transduction histidine kinase, dimerisation/phosphotransfer (DHp) domain 0.8864 51 82 1.10.287.130
2wwwB03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Signal transduction histidine kinase, dimerisation/phosphotransfer (DHp) domain 0.8834 52 82 1.10.287.130
2fe1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8612 20 139 3.40.50.1010
af_P9WFB7_11_132_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8533 21 134 3.40.50.1010
af_P9WFA3_1_120_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8458 21 133 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A7W0PLI4-F1-model_v4 Type II toxin-antitoxin system VapC family toxin 1.002 19 134
AF-A0A3D5ART5-F1-model_v4 Nucleic acid-binding protein 0.9922 19 148
AF-A0A512DCR5-F1-model_v4 PIN domain-containing protein 0.9921 19 148
AF-A0A1H1ZQR6-F1-model_v4 PIN domain-containing protein 0.9905 19 147
AF-A0A0A0BLD5-F1-model_v4 PIN domain-containing protein 0.9802 19 150

Map