F328749

General Info

Members Datasets Scaffolds Average Seq Length
217 161 182 231

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10017183|Ga0157371_100171835
Length 262
Sequence LKSYKKIKNLKSNIFFERFFFFLIYIRFLNYLIMEGSHFAIRDWSEDDKPREKLMLKGKEALSDAELMAILIGSGSRNESAVALSQRILASAKNLNSLWKMSVSQLIKFKGIGEAKAVSIVAALELGRRQRAEDILKLKKITSSKDAFTIMQPIIGELPHEEFWVLFLNNSNKVISKAQLSKGGIAGTIVDVRLVFKLGLENGATGLILCHNHPSGELNPSQADKQITKKIKTAGEILDVKILDHLIITETKYYSFVDEGIF

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
3 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
4 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
5 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
6 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
7 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
8 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
9 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
10 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
11 2738543023 Pedobacter sp. OK628 Isolate Unclassified
12 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
13 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
14 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
15 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
16 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
17 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
18 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
19 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
20 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
21 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
22 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
23 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
24 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
25 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
26 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
27 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
28 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
29 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
30 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
31 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
32 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
33 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
34 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
35 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
36 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
37 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
38 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
39 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
40 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
41 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
42 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
57 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
58 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
59 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
76 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
88 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
89 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
92 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
93 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
94 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
95 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
96 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
100 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
110 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
111 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
112 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
113 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
114 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
115 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
116 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
117 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
123 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
124 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
125 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
126 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
127 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
128 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
129 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
130 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
133 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
134 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
135 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
136 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
137 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
141 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
142 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
143 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
144 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
145 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
146 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
147 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
148 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
149 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
150 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
151 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
152 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
153 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
154 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
155 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
156 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
157 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
158 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
159 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere
160 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
161 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.87
Metatranscriptomes 0
Isolates 16.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.29
Nodule 2.76
Rhizoplane 0.46
Rhizosphere 71.89
Stem 0
Stem Tuber 0
Unclassified 16.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2027686 2162886007 Bacteria 1792
2 JGI25157J39369_1012184 3300002741 Bacteria 1097
3 rootH2_10172266 3300003320 Bacteria 1675
4 rootL2_10072329 3300003322 Bacteria 7034
5 rootL2_10088700 3300003322 Bacteria 4048
6 rootH1_10201858 3300003323 Bacteria 1660
7 Ga0055531_10000027 3300003794 Bacteria 160284
8 Ga0065714_10002437 3300005288 Bacteria 17662
9 Ga0065714_10025225 3300005288 Bacteria 1207
10 Ga0065714_10073205 3300005288 Bacteria 3226
11 Ga0065714_10073984 3300005288 Bacteria 3100
12 Ga0065704_10071272 3300005289 Bacteria 12099
13 Ga0065715_10008415 3300005293 Bacteria 2594
14 Ga0070658_10152780 3300005327 Bacteria 1933
15 Ga0070683_100097008 3300005329 Bacteria 2773
16 Ga0070682_100157107 3300005337 Bacteria 1567
17 Ga0070660_100150083 3300005339 Bacteria 1873
18 Ga0070668_100292042 3300005347 Bacteria 1365
19 Ga0070659_100089916 3300005366 Bacteria 2460
20 Ga0070667_100267912 3300005367 Unclassified 1531
21 Ga0070681_10097470 3300005458 Bacteria 2888
22 Ga0070681_10134546 3300005458 Bacteria 2403
23 Ga0070685_10010889 3300005466 Bacteria 4741
24 Ga0070679_100075839 3300005530 Bacteria 3352
25 Ga0070679_100093947 3300005530 Bacteria 2986
26 Ga0070684_100446341 3300005535 Bacteria 1195
27 Ga0068853_100026581 3300005539 Bacteria 4860
28 Ga0068853_100429997 3300005539 Bacteria 1239
29 Ga0068854_100029874 3300005578 Bacteria 3776
30 Ga0068856_100092245 3300005614 Bacteria 3013
31 Ga0068852_100106214 3300005616 Bacteria 2545
32 Ga0068852_100505108 3300005616 Bacteria 1204
33 Ga0068871_100022327 3300006358 Bacteria 4878
34 Ga0099824_1001317 3300006942 Bacteria 34468
35 Ga0079104_1002005 3300006946 Bacteria 11888
36 Ga0099826_10043284 3300006948 Bacteria 3102
37 Ga0105244_10000057 3300009036 Bacteria 129775
38 Ga0105240_10092674 3300009093 Bacteria 3689
39 Ga0105241_10034959 3300009174 Bacteria 3779
40 Ga0105239_10118906 3300010375 Bacteria 2933
41 Ga0157373_10000111 3300013100 Bacteria 64336
42 Ga0157373_10014033 3300013100 Bacteria 5874
43 Ga0157371_10011397 3300013102 Bacteria 6855
44 Ga0157371_10017183 3300013102 Bacteria 5379
45 Ga0157371_10040147 3300013102 Bacteria 3345
46 Ga0157370_10000395 3300013104 Bacteria 54849
47 Ga0157370_10002067 3300013104 Bacteria 24583
48 Ga0157370_10003092 3300013104 Bacteria 19702
49 Ga0157370_10021845 3300013104 Bacteria 6375
50 Ga0157370_10029057 3300013104 Bacteria 5431
51 Ga0157369_10000613 3300013105 Bacteria 46357
52 Ga0157369_10013039 3300013105 Bacteria 9414
53 Ga0157369_10223796 3300013105 Bacteria 1969
54 Ga0157374_10518522 3300013296 Bacteria 1198
55 Ga0157378_10012066 3300013297 Bacteria 7566
56 Ga0157372_10134265 3300013307 Bacteria 2849
57 Ga0157372_10216158 3300013307 Bacteria 2222
58 Ga0157375_10017297 3300013308 Bacteria 6503
59 Ga0157379_10228034 3300014968 Bacteria 1688
60 Ga0182006_1002471 3300015261 Bacteria 10082
61 Ga0182006_1017946 3300015261 Bacteria 2997
62 Ga0163161_10000075 3300017792 Bacteria 101567
63 Ga0163161_10069525 3300017792 Bacteria 2574
64 Ga0163161_10218185 3300017792 Bacteria 1476
65 Ga0209258_100041 3300025242 Bacteria 381381
66 Ga0209026_1000523 3300025250 Bacteria 27037
67 Ga0209148_1000090 3300025254 Bacteria 250982
68 Ga0207655_1000038 3300025728 Bacteria 348340
69 Ga0207645_10100876 3300025907 Bacteria 1862
70 Ga0207705_10097507 3300025909 Bacteria 2159
71 Ga0207707_10364239 3300025912 Bacteria 1244
72 Ga0207657_10061006 3300025919 Bacteria 3235
73 Ga0207652_10000961 3300025921 Bacteria 26939
74 Ga0207668_10220617 3300025972 Unclassified 1522
75 Ga0207640_10331242 3300025981 Bacteria 1216
76 Ga0207658_10553727 3300025986 Bacteria 1029
77 Ga0207698_10228289 3300026142 Bacteria 1688
78 Ga0207698_10237306 3300026142 Bacteria 1659
79 Ga0209281_1000337 3300027111 Bacteria 79938
80 Ga0209489_114225 3300027361 Bacteria 5753
81 Ga0209995_1003861 3300027471 Bacteria 2391
82 Ga0209968_1001721 3300027526 Bacteria 3309
83 Ga0209282_1034928 3300027666 Bacteria 3052
84 Ga0316177_1197006 3300030731 Bacteria 9744
85 Ga0316176_1205455 3300030732 Bacteria 7320
86 Ga0316183_1073865 3300030742 Bacteria 13477
87 Ga0316181_1003409 3300030744 Bacteria 9767
88 Ga0265327_10004341 3300031251 Bacteria 12622
89 Ga0265327_10018384 3300031251 Unclassified 4336
90 Ga0307513_10266993 3300031456 Bacteria 1497
91 Ga0307408_100003022 3300031548 Bacteria 11615
92 Ga0316576_10015616 3300031727 Bacteria 5101
93 Ga0316576_10574158 3300031727 Bacteria 825
94 Ga0316578_10126626 3300031728 Bacteria 1536
95 Ga0307405_10000005 3300031731 Bacteria 376536
96 Ga0307413_10000044 3300031824 Bacteria 32403
97 Ga0307413_10077456 3300031824 Bacteria 2117
98 Ga0307410_10000034 3300031852 Bacteria 48449
99 Ga0307406_10000004 3300031901 Bacteria 179772
100 Ga0307406_10050370 3300031901 Bacteria 2640
101 Ga0307407_10001817 3300031903 Bacteria 8003
102 Ga0307416_100017384 3300032002 Bacteria 5031
103 Ga0307414_10000051 3300032004 Bacteria 127567
104 Ga0307414_10002090 3300032004 Bacteria 10393
105 Ga0307414_10017058 3300032004 Bacteria 4434
106 Ga0307414_10040629 3300032004 Bacteria 3143
107 Ga0307414_10081990 3300032004 Bacteria 2363
108 Ga0307414_10098187 3300032004 Bacteria 2196
109 Ga0307414_10140733 3300032004 Bacteria 1889
110 Ga0307414_10711412 3300032004 Bacteria 910
111 Ga0307411_10000023 3300032005 Bacteria 62112
112 Ga0307411_10180128 3300032005 Bacteria 1603
113 Ga0307510_10051433 3300033180 Bacteria 4357
114 Ga0316574_0120538 3300035398 Bacteria 1684
115 Ga0316574_0190812 3300035398 Bacteria 1318
116 Ga0316582_0305846 3300036647 Bacteria 1093
117 Ga0316584_0000698 3300036712 Bacteria 18586
118 Ga0400483_214980 3300039062 Bacteria 1544
119 Ga0439447_000454 3300041407 Bacteria 15278
120 Ga0439466_0000296 3300041411 Bacteria 19213
121 Ga0439445_0028860 3300042004 Bacteria 1432
122 Ga0450906_033029 3300042145 Bacteria 914
123 Ga0451577_0277430 3300042876 Bacteria 1518
124 Ga0453683_0000238 3300044673 Bacteria 73041
125 Ga0453683_0295646 3300044673 Bacteria 1035
126 Ga0453684_0007656 3300044712 Bacteria 19769
127 Ga0453684_0041744 3300044712 Bacteria 6196
128 Ga0453684_0094535 3300044712 Bacteria 3677
129 Ga0453684_0203007 3300044712 Bacteria 2309
130 Ga0453684_0245925 3300044712 Unclassified 2057
131 Ga0453684_0284842 3300044712 Unclassified 1883
132 Ga0453684_0329965 3300044712 Bacteria 1725
133 Ga0453684_0343859 3300044712 Bacteria 1684
134 Ga0453684_0884274 3300044712 Bacteria 958
135 Ga0451576_0000729 3300045051 Bacteria 66020
136 Ga0451576_0021859 3300045051 Bacteria 6947
137 Ga0451576_0191966 3300045051 Unclassified 2133
138 Ga0451576_0205253 3300045051 Bacteria 2058
139 Ga0451576_0907223 3300045051 Bacteria 924
140 Ga0495607_0064077 3300046501 Bacteria 2077
141 Ga0495610_0149156 3300046512 Bacteria 1000
142 Ga0495616_0109214 3300046513 Bacteria 1286
143 Ga0495643_0000294 3300046522 Bacteria 70329
144 Ga0495654_0019683 3300046530 Bacteria 3529
145 Ga0495633_0000049 3300046558 Bacteria 156684
146 Ga0495668_0000212 3300046616 Bacteria 84542
147 Ga0495625_0005604 3300046660 Bacteria 11381
148 Ga0495660_0124382 3300046810 Bacteria 1301
149 Ga0496114_0046777 3300048917 Bacteria 3596
150 Ga0496116_0000024 3300048919 Bacteria 471420
151 Ga0496118_0036498 3300048921 Bacteria 3973
152 Ga0496121_0080522 3300048924 Bacteria 2581
153 Ga0496124_0033070 3300048927 Bacteria 4554
154 Ga0496124_0127167 3300048927 Bacteria 2029
155 Ga0496125_0000018 3300048928 Bacteria 482390
156 Ga0496126_0059217 3300048929 Bacteria 3449
157 Ga0496126_0352223 3300048929 Bacteria 1204
158 Ga0501034_0028963 3300049571 Bacteria 5632
159 Ga0501040_0325438 3300049576 Bacteria 1100
160 Ga0501223_001609 3300049663 Bacteria 5195
161 Ga0501238_000015 3300049671 Bacteria 31964
162 Ga0501249_000008 3300049679 Bacteria 197587
163 Ga0501249_009780 3300049679 Bacteria 1996
164 Ga0501249_016042 3300049679 Bacteria 1606
165 Ga0501266_000002 3300049763 Bacteria 459947
166 Ga0501266_005861 3300049763 Bacteria 1527
167 Ga0501280_000210 3300049776 Bacteria 14648
168 Ga0500644_0000182 3300053088 Bacteria 40141
169 Ga0500644_0030642 3300053088 Bacteria 1704
170 Ga0500641_0000008 3300053096 Bacteria 174314
171 Ga0500641_0000727 3300053096 Bacteria 11920
172 Ga0500569_000166 3300053109 Bacteria 10409
173 Ga0500607_027221 3300053121 Bacteria 3174
174 Ga0500658_0000002 3300053134 Bacteria 548440
175 Ga0500658_0015108 3300053134 Bacteria 2862
176 Ga0500559_0057005 3300053136 Bacteria 1735
177 Ga0500577_0002429 3300053142 Bacteria 4765
178 Ga0500616_0016029 3300053153 Bacteria 4276
179 Ga0500622_0063365 3300053156 Bacteria 1882
180 Ga0500633_0005127 3300053160 Bacteria 3080
181 Ga0500584_001284 3300053726 Bacteria 8602
182 Ga0500661_005042 3300055283 Bacteria 2475

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025242 Ga0209258_100041 Ga0209258_100041108 208
2 3300025254 Ga0209148_1000090 Ga0209148_1000090127 208
3 3300046810 Ga0495660_0124382 Ga0495660_0124382_487_1197 208
4 3300053088 Ga0500644_0000182 Ga0500644_0000182_33472_34182 208
5 3300053160 Ga0500633_0005127 Ga0500633_0005127_1607_2317 208
6 3300053121 Ga0500607_027221 Ga0500607_027221_556_1266 209
7 3300036712 Ga0316584_0000698 Ga0316584_0000698_222_908 214
8 iso_pu_bacteria 2738543023 2739303563 216
9 3300031728 Ga0316578_10126626 Ga0316578_101266262 217
10 3300005535 Ga0070684_100446341 Ga0070684_1004463411 218
11 3300044712 Ga0453684_0245925 Ga0453684_0245925_768_1466 218
12 3300046513 Ga0495616_0109214 Ga0495616_0109214_148_843 218
13 3300046522 Ga0495643_0000294 Ga0495643_0000294_14401_15096 218
14 3300046660 Ga0495625_0005604 Ga0495625_0005604_9035_9730 218
15 iso_pu_bacteria 8055588893 8055591868 220
16 3300005329 Ga0070683_100097008 Ga0070683_1000970086 222
17 3300005458 Ga0070681_10134546 Ga0070681_101345463 222
18 3300005530 Ga0070679_100075839 Ga0070679_1000758395 222
19 3300005539 Ga0068853_100026581 Ga0068853_1000265813 222
20 3300005578 Ga0068854_100029874 Ga0068854_1000298747 222
21 3300005614 Ga0068856_100092245 Ga0068856_1000922453 222
22 3300009093 Ga0105240_10092674 Ga0105240_100926745 222
23 3300009174 Ga0105241_10034959 Ga0105241_100349595 222
24 3300010375 Ga0105239_10118906 Ga0105239_101189064 222
25 3300013100 Ga0157373_10014033 Ga0157373_100140333 222
26 3300013102 Ga0157371_10040147 Ga0157371_100401472 222
27 3300013105 Ga0157369_10013039 Ga0157369_100130397 222
28 3300013296 Ga0157374_10518522 Ga0157374_105185222 222
29 3300013307 Ga0157372_10216158 Ga0157372_102161583 222
30 3300025912 Ga0207707_10364239 Ga0207707_103642392 222
31 3300005466 Ga0070685_10010889 Ga0070685_100108896 224
32 iso_pu_bacteria 2513020052 2513232351 225
33 iso_pu_bacteria 2519899754 2520879512 225
34 iso_pu_bacteria 2643221600 2644009173 225
35 iso_pu_bacteria 2643221667 2644373912 225
36 iso_pu_bacteria 2643221716 2644643956 225
37 iso_pu_bacteria 2643221725 2644681854 225
38 iso_pu_bacteria 2738541279 2738733089 225
39 iso_pu_bacteria 2738541285 2738765627 225
40 iso_pu_bacteria 2738543007 2739214670 225
41 iso_pu_bacteria 2739367857 2740002817 225
42 iso_pu_bacteria 2739367858 2740007634 225
43 iso_pu_bacteria 2802428842 2802655237 225
44 iso_pu_bacteria 2816332280 2817413571 225
45 iso_pu_bacteria 2857613821 2857617030 225
46 iso_pu_bacteria 2857618242 2857619699 225
47 iso_pu_bacteria 2881359912 2881364083 225
48 iso_pu_bacteria 2903895155 2903898640 225
49 iso_pu_bacteria 2904419702 2904422419 225
50 iso_pu_bacteria 2904555929 2904558475 225
51 iso_pu_bacteria 2919191525 2919194201 225
52 iso_pu_bacteria 2919683626 2919684635 225
53 iso_pu_bacteria 2929150217 2929150627 225
54 iso_pu_bacteria 2958458903 2958462025 225
55 iso_pu_bacteria 2977268062 2977272097 225
56 iso_pu_bacteria 8055419101 8055423602 225
57 iso_pu_bacteria 8055592153 8055595042 225
58 iso_pu_bacteria 8056440228 8056443536 225
59 iso_pu_bacteria 2919509842 2919511804 226
60 iso_pu_bacteria 2833640130 2833640649 227
61 iso_pu_bacteria 2881247448 2881247549 227
62 iso_pu_bacteria 2902048731 2902052539 227
63 3300002741 JGI25157J39369_1012184 JGI25157J39369_10121841 228
64 3300025250 Ga0209026_1000523 Ga0209026_100052318 228
65 3300044673 Ga0453683_0000238 Ga0453683_0000238_48021_48710 228
66 3300045051 Ga0451576_0205253 Ga0451576_0205253_1130_1819 228
67 iso_pu_bacteria 2842903701 2842906982 228
68 3300005288 Ga0065714_10025225 Ga0065714_100252251 229
69 3300005288 Ga0065714_10073205 Ga0065714_100732053 229
70 3300005288 Ga0065714_10073984 Ga0065714_100739842 229
71 3300005293 Ga0065715_10008415 Ga0065715_100084152 229
72 3300005337 Ga0070682_100157107 Ga0070682_1001571073 229
73 3300006942 Ga0099824_1001317 Ga0099824_100131717 229
74 3300006946 Ga0079104_1002005 Ga0079104_10020055 229
75 3300006948 Ga0099826_10043284 Ga0099826_100432842 229
76 3300009036 Ga0105244_10000057 Ga0105244_10000057111 229
77 3300013100 Ga0157373_10000111 Ga0157373_1000011117 229
78 3300013102 Ga0157371_10017183 Ga0157371_100171835 229
79 3300013104 Ga0157370_10000395 Ga0157370_1000039536 229
80 3300013104 Ga0157370_10003092 Ga0157370_1000309215 229
81 3300013104 Ga0157370_10021845 Ga0157370_100218458 229
82 3300013105 Ga0157369_10000613 Ga0157369_1000061356 229
83 3300015261 Ga0182006_1002471 Ga0182006_10024712 229
84 3300017792 Ga0163161_10000075 Ga0163161_1000007583 229
85 3300025728 Ga0207655_1000038 Ga0207655_1000038225 229
86 3300027111 Ga0209281_1000337 Ga0209281_10003372 229
87 3300027361 Ga0209489_114225 Ga0209489_1142255 229
88 3300027471 Ga0209995_1003861 Ga0209995_10038612 229
89 3300027526 Ga0209968_1001721 Ga0209968_10017213 229
90 3300027666 Ga0209282_1034928 Ga0209282_10349282 229
91 3300031548 Ga0307408_100003022 Ga0307408_10000302210 229
92 3300031824 Ga0307413_10000044 Ga0307413_1000004416 229
93 3300031824 Ga0307413_10077456 Ga0307413_100774562 229
94 3300031852 Ga0307410_10000034 Ga0307410_1000003458 229
95 3300031901 Ga0307406_10000004 Ga0307406_1000000492 229
96 3300031903 Ga0307407_10001817 Ga0307407_100018173 229
97 3300032002 Ga0307416_100017384 Ga0307416_1000173844 229
98 3300032004 Ga0307414_10000051 Ga0307414_1000005182 229
99 3300032004 Ga0307414_10081990 Ga0307414_100819903 229
100 3300032004 Ga0307414_10098187 Ga0307414_100981871 229
101 3300032004 Ga0307414_10711412 Ga0307414_107114122 229
102 3300032005 Ga0307411_10000023 Ga0307411_1000002343 229
103 3300032005 Ga0307411_10180128 Ga0307411_101801282 229
104 3300033180 Ga0307510_10051433 Ga0307510_100514333 229
105 3300039062 Ga0400483_214980 Ga0400483_214980_610_1302 229
106 3300041407 Ga0439447_000454 Ga0439447_000454_9382_10071 229
107 3300041411 Ga0439466_0000296 Ga0439466_0000296_930_1619 229
108 3300042004 Ga0439445_0028860 Ga0439445_0028860_123_812 229
109 3300042145 Ga0450906_033029 Ga0450906_033029_185_874 229
110 3300044712 Ga0453684_0284842 Ga0453684_0284842_932_1642 229
111 3300046512 Ga0495610_0149156 Ga0495610_0149156_44_733 229
112 3300046530 Ga0495654_0019683 Ga0495654_0019683_497_1192 229
113 3300048919 Ga0496116_0000024 Ga0496116_0000024_74055_74843 229
114 3300048921 Ga0496118_0036498 Ga0496118_0036498_1281_2069 229
115 3300048924 Ga0496121_0080522 Ga0496121_0080522_415_1104 229
116 3300048927 Ga0496124_0033070 Ga0496124_0033070_2433_3221 229
117 3300048927 Ga0496124_0127167 Ga0496124_0127167_184_873 229
118 3300048928 Ga0496125_0000018 Ga0496125_0000018_405773_406561 229
119 3300048929 Ga0496126_0059217 Ga0496126_0059217_1295_1990 229
120 3300048929 Ga0496126_0352223 Ga0496126_0352223_246_935 229
121 3300049571 Ga0501034_0028963 Ga0501034_0028963_3422_4114 229
122 3300049663 Ga0501223_001609 Ga0501223_001609_3099_3791 229
123 3300049671 Ga0501238_000015 Ga0501238_000015_28429_29118 229
124 3300049679 Ga0501249_000008 Ga0501249_000008_180050_180745 229
125 3300049679 Ga0501249_009780 Ga0501249_009780_1146_1838 229
126 3300049679 Ga0501249_016042 Ga0501249_016042_759_1448 229
127 3300049763 Ga0501266_000002 Ga0501266_000002_365925_366617 229
128 3300049763 Ga0501266_005861 Ga0501266_005861_730_1419 229
129 3300049776 Ga0501280_000210 Ga0501280_000210_1652_2341 229
130 3300053088 Ga0500644_0030642 Ga0500644_0030642_385_1074 229
131 3300053096 Ga0500641_0000008 Ga0500641_0000008_154832_155521 229
132 3300053096 Ga0500641_0000727 Ga0500641_0000727_10979_11668 229
133 3300053134 Ga0500658_0000002 Ga0500658_0000002_172807_173499 229
134 3300053136 Ga0500559_0057005 Ga0500559_0057005_383_1078 229
135 3300053726 Ga0500584_001284 Ga0500584_001284_4054_4746 229
136 iso_pu_bacteria 8054307821 8054311409 229
137 2162886007 SwRhRL2b_contig_2027686 SwRhRL2b_0207.00008160 230
138 3300003320 rootH2_10172266 rootH2_101722662 230
139 3300003322 rootL2_10072329 rootL2_100723296 230
140 3300003322 rootL2_10088700 rootL2_100887004 230
141 3300003323 rootH1_10201858 rootH1_102018581 230
142 3300003794 Ga0055531_10000027 Ga0055531_1000002783 230
143 3300005288 Ga0065714_10002437 Ga0065714_100024378 230
144 3300005289 Ga0065704_10071272 Ga0065704_100712729 230
145 3300005327 Ga0070658_10152780 Ga0070658_101527802 230
146 3300005339 Ga0070660_100150083 Ga0070660_1001500832 230
147 3300005347 Ga0070668_100292042 Ga0070668_1002920422 230
148 3300005366 Ga0070659_100089916 Ga0070659_1000899162 230
149 3300005367 Ga0070667_100267912 Ga0070667_1002679122 230
150 3300005458 Ga0070681_10097470 Ga0070681_100974703 230
151 3300005530 Ga0070679_100093947 Ga0070679_1000939472 230
152 3300005539 Ga0068853_100429997 Ga0068853_1004299971 230
153 3300005616 Ga0068852_100106214 Ga0068852_1001062143 230
154 3300005616 Ga0068852_100505108 Ga0068852_1005051082 230
155 3300006358 Ga0068871_100022327 Ga0068871_1000223274 230
156 3300013102 Ga0157371_10011397 Ga0157371_100113977 230
157 3300013104 Ga0157370_10002067 Ga0157370_1000206722 230
158 3300013104 Ga0157370_10029057 Ga0157370_100290572 230
159 3300013105 Ga0157369_10223796 Ga0157369_102237962 230
160 3300013297 Ga0157378_10012066 Ga0157378_100120666 230
161 3300013307 Ga0157372_10134265 Ga0157372_101342653 230
162 3300013308 Ga0157375_10017297 Ga0157375_100172975 230
163 3300014968 Ga0157379_10228034 Ga0157379_102280343 230
164 3300015261 Ga0182006_1017946 Ga0182006_10179462 230
165 3300017792 Ga0163161_10069525 Ga0163161_100695253 230
166 3300017792 Ga0163161_10218185 Ga0163161_102181852 230
167 3300025907 Ga0207645_10100876 Ga0207645_101008763 230
168 3300025909 Ga0207705_10097507 Ga0207705_100975072 230
169 3300025919 Ga0207657_10061006 Ga0207657_100610063 230
170 3300025921 Ga0207652_10000961 Ga0207652_1000096119 230
171 3300025972 Ga0207668_10220617 Ga0207668_102206173 230
172 3300025981 Ga0207640_10331242 Ga0207640_103312421 230
173 3300025986 Ga0207658_10553727 Ga0207658_105537272 230
174 3300026142 Ga0207698_10228289 Ga0207698_102282893 230
175 3300026142 Ga0207698_10237306 Ga0207698_102373062 230
176 3300030731 Ga0316177_1197006 Ga0316177_11970068 230
177 3300030732 Ga0316176_1205455 Ga0316176_12054552 230
178 3300030742 Ga0316183_1073865 Ga0316183_10738655 230
179 3300030744 Ga0316181_1003409 Ga0316181_10034093 230
180 3300031251 Ga0265327_10004341 Ga0265327_100043416 230
181 3300031251 Ga0265327_10018384 Ga0265327_100183844 230
182 3300031456 Ga0307513_10266993 Ga0307513_102669931 230
183 3300031727 Ga0316576_10015616 Ga0316576_100156166 230
184 3300031727 Ga0316576_10574158 Ga0316576_105741581 230
185 3300031731 Ga0307405_10000005 Ga0307405_10000005258 230
186 3300031901 Ga0307406_10050370 Ga0307406_100503703 230
187 3300032004 Ga0307414_10002090 Ga0307414_100020907 230
188 3300032004 Ga0307414_10017058 Ga0307414_100170584 230
189 3300032004 Ga0307414_10040629 Ga0307414_100406292 230
190 3300032004 Ga0307414_10140733 Ga0307414_101407333 230
191 3300035398 Ga0316574_0120538 Ga0316574_0120538_925_1623 230
192 3300035398 Ga0316574_0190812 Ga0316574_0190812_12_713 230
193 3300036647 Ga0316582_0305846 Ga0316582_0305846_99_794 230
194 3300042876 Ga0451577_0277430 Ga0451577_0277430_506_1207 230
195 3300044673 Ga0453683_0295646 Ga0453683_0295646_173_868 230
196 3300044712 Ga0453684_0007656 Ga0453684_0007656_4039_4737 230
197 3300044712 Ga0453684_0041744 Ga0453684_0041744_5040_5738 230
198 3300044712 Ga0453684_0094535 Ga0453684_0094535_335_1033 230
199 3300044712 Ga0453684_0203007 Ga0453684_0203007_1070_1822 230
200 3300044712 Ga0453684_0329965 Ga0453684_0329965_583_1278 230
201 3300044712 Ga0453684_0343859 Ga0453684_0343859_812_1507 230
202 3300044712 Ga0453684_0884274 Ga0453684_0884274_66_764 230
203 3300045051 Ga0451576_0000729 Ga0451576_0000729_41505_42203 230
204 3300045051 Ga0451576_0021859 Ga0451576_0021859_3757_4458 230
205 3300045051 Ga0451576_0191966 Ga0451576_0191966_1247_1948 230
206 3300045051 Ga0451576_0907223 Ga0451576_0907223_191_886 230
207 3300046501 Ga0495607_0064077 Ga0495607_0064077_1167_1865 230
208 3300046558 Ga0495633_0000049 Ga0495633_0000049_147242_147952 230
209 3300046616 Ga0495668_0000212 Ga0495668_0000212_41475_42176 230
210 3300048917 Ga0496114_0046777 Ga0496114_0046777_408_1106 230
211 3300049576 Ga0501040_0325438 Ga0501040_0325438_159_857 230
212 3300053109 Ga0500569_000166 Ga0500569_000166_6350_7060 230
213 3300053134 Ga0500658_0015108 Ga0500658_0015108_523_1233 230
214 3300053142 Ga0500577_0002429 Ga0500577_0002429_3176_3886 230
215 3300053153 Ga0500616_0016029 Ga0500616_0016029_45_755 230
216 3300053156 Ga0500622_0063365 Ga0500622_0063365_513_1208 230
217 3300055283 Ga0500661_005042 Ga0500661_005042_1053_1763 230

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04002

RadC

RadC-like JAB domain

141

261

0.98

PF20582

UPF0758_N

UPF0758 N-terminal

41

118

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qlc-assembly5.cif.gz_E the crystal structure of dna repair protein radc from chlorobium tepidum tls 0.951 107 230
2qlc-assembly5.cif.gz_E the crystal structure of dna repair protein radc from chlorobium tepidum tls 0.9436 107 230
4h4n-assembly1.cif.gz_A 1.1 angstrom crystal structure of hypothetical protein ba_2335 from bacillus anthracis 0.8723 129 147
8b0q-assembly1.cif.gz_A deinococcus radiodurans uvrc c-terminal half 0.868 52 94
4yxm-assembly1.cif.gz_A structure of thermotoga maritima disa d75n mutant with reaction product c-di-amp 0.8309 35 98
ID Description Score Start End Superfamily
af_P31337_89_213_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.975 107 228 3.40.140.10
2qlcA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9594 108 230 3.40.140.10
af_P31337_89_213_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9445 107 228 3.40.140.10
af_Q47685_35_158_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9422 107 230 3.40.140.10
af_P25531_100_221_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.941 109 228 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A5C9BMI4-F1-model_v4 DNA repair protein RadC 0.9799 117 230 GO:0006508
GO:0008237
GO:0046872
AF-A0A7Y7NCF2-F1-model_v4 DNA repair protein RadC 0.9744 105 230 GO:0006508
GO:0008237
GO:0046872
AF-K6A130-F1-model_v4 DNA repair protein RadC 0.9727 119 230 GO:0006508
GO:0008237
GO:0046872
AF-A0A016ESB4-F1-model_v4 deleted 0.9707 134 230
AF-A0A2N1TNT5-F1-model_v4 DNA repair protein RadC 0.9697 105 230 GO:0006508
GO:0008237
GO:0046872

Feature Viewer

pLDDT pTM Quality
88.09 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map