F328693

General Info

Members Datasets Scaffolds Average Seq Length
217 159 209 255

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10092487|Ga0105240_100924871
Length 282
Sequence MDLSYGTCYGCGLCYTYLELSKQQKMKIALFSDIHANLPALEAFFASIEEQKPDAIYCLGDLVGYNTWPNEVINAIRGRGIPTIAGNYDFGVGRNSDDCGCAYKTEQEQANGAVSISYTNRVVGEEQRAYLRTLPAHIRVEFRLNTEPLNLLLVHGSPRRINEYLFEDREEKSLMRIMHDADADILCFGHTHKPYHRVLADGGGGSERYRHAVNIGSVGKPKDGDARGCYVLLHLFDNSSVLVKDSIRVEFVRFAYDIEKAARAVEDSPLPKAFAEALRIAK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
4 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
5 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
6 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
7 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
58 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
59 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
63 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
64 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
86 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
87 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
88 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
94 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
95 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
96 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
102 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
103 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
104 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
105 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
106 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
107 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
108 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
109 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
110 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
111 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
112 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
119 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
120 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
121 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
122 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
123 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
124 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
125 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
128 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
129 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
130 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
131 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
132 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
135 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
136 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
142 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
143 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
146 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
147 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
148 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
149 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
150 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
151 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
152 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
153 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
154 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
155 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
156 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
157 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
158 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
159 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.77
Metatranscriptomes 0
Isolates 3.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.21
Nodule 0
Rhizoplane 0.92
Rhizosphere 72.81
Stem 0
Stem Tuber 0
Unclassified 11.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1663050 2162886007 Bacteria 482194
2 JGI25154J39366_1000016 3300002738 Bacteria 255057
3 JGI25157J39369_1006096 3300002741 Bacteria 1876
4 JGI25153J46596_10005236 3300003215 Bacteria 6823
5 rootH2_10001201 3300003320 Bacteria 26611
6 rootH2_10150023 3300003320 Unclassified 1743
7 rootH2_10226751 3300003320 Bacteria 2594
8 rootH2_10325803 3300003320 Bacteria 1179
9 rootH1_10027082 3300003323 Bacteria 3745
10 JGI25160J50197_1001714 3300003354 Bacteria 10638
11 Ga0055526_1005853 3300003771 Bacteria 6902
12 Ga0055526_1008112 3300003771 Bacteria 5296
13 Ga0055528_1000610 3300003790 Bacteria 26690
14 Ga0065165_1000232 3300005262 Bacteria 97117
15 Ga0065704_10070140 3300005289 Bacteria 482257
16 Ga0065704_10163530 3300005289 Bacteria 1338
17 Ga0065712_10171102 3300005290 Bacteria 1243
18 Ga0065715_10221826 3300005293 Bacteria 1269
19 Ga0070677_10005107 3300005333 Unclassified 4314
20 Ga0070669_100159191 3300005353 Bacteria 1753
21 Ga0070675_100156552 3300005354 Unclassified 1956
22 Ga0070674_100226461 3300005356 Bacteria 1457
23 Ga0070659_100001238 3300005366 Bacteria 18539
24 Ga0070681_10164399 3300005458 Bacteria 2142
25 Ga0070681_10322895 3300005458 Bacteria 1453
26 Ga0070698_100062591 3300005471 Bacteria 3754
27 Ga0070679_100042383 3300005530 Bacteria 4532
28 Ga0070679_100060507 3300005530 Bacteria 3774
29 Ga0070672_100049156 3300005543 Bacteria 3279
30 Ga0070665_100000189 3300005548 Bacteria 109948
31 Ga0068855_100004200 3300005563 Bacteria 17576
32 Ga0068855_100042754 3300005563 Bacteria 5369
33 Ga0068855_100185422 3300005563 Bacteria 2350
34 Ga0068855_100274577 3300005563 Bacteria 1873
35 Ga0068857_100153860 3300005577 Bacteria 2085
36 Ga0068856_100011868 3300005614 Bacteria 8439
37 Ga0068856_100254464 3300005614 Bacteria 1771
38 Ga0068861_100446968 3300005719 Bacteria 1157
39 Ga0068860_100000005 3300005843 Bacteria 472349
40 Ga0068860_100051825 3300005843 Bacteria 3904
41 Ga0081540_1061318 3300005983 Bacteria 1793
42 Ga0075366_10044763 3300006195 Bacteria 2623
43 Ga0075428_100127381 3300006844 Unclassified 2770
44 Ga0075431_100008453 3300006847 Bacteria 10309
45 Ga0075429_100120411 3300006880 Unclassified 2294
46 Ga0068865_100483584 3300006881 Bacteria 1029
47 Ga0105240_10000023 3300009093 Bacteria 385028
48 Ga0105240_10000833 3300009093 Bacteria 55556
49 Ga0105240_10002592 3300009093 Bacteria 28936
50 Ga0105240_10092487 3300009093 Bacteria 3693
51 Ga0114129_10098406 3300009147 Unclassified 4049
52 Ga0105237_10002503 3300009545 Bacteria 22768
53 Ga0105237_10026390 3300009545 Bacteria 5937
54 Ga0105238_10031339 3300009551 Bacteria 5412
55 Ga0105238_10361293 3300009551 Unclassified 1441
56 Ga0105239_10000267 3300010375 Bacteria 77181
57 Ga0105239_10001651 3300010375 Bacteria 29415
58 Ga0105239_10003037 3300010375 Bacteria 20874
59 Ga0105239_10068134 3300010375 Bacteria 3911
60 Ga0157371_10012811 3300013102 Bacteria 6393
61 Ga0157371_10049742 3300013102 Bacteria 2977
62 Ga0157370_10098961 3300013104 Bacteria 2734
63 Ga0157370_10140471 3300013104 Bacteria 2250
64 Ga0157369_10076857 3300013105 Bacteria 3579
65 Ga0157374_10000003 3300013296 Bacteria 854471
66 Ga0157378_10005828 3300013297 Bacteria 10800
67 Ga0157378_10230909 3300013297 Bacteria 1763
68 Ga0157378_10383206 3300013297 Bacteria 1381
69 Ga0163162_10001420 3300013306 Bacteria 22262
70 Ga0157372_10007012 3300013307 Bacteria 12004
71 Ga0157372_10014136 3300013307 Bacteria 8528
72 Ga0157372_10016648 3300013307 Bacteria 7891
73 Ga0157372_10046901 3300013307 Unclassified 4798
74 Ga0157372_10204494 3300013307 Bacteria 2288
75 Ga0157372_10236405 3300013307 Bacteria 2119
76 Ga0163163_10185717 3300014325 Bacteria 2127
77 Ga0157376_10000580 3300014969 Bacteria 23607
78 Ga0157376_10422493 3300014969 Bacteria 1294
79 Ga0163161_10002279 3300017792 Bacteria 13770
80 Ga0209258_100234 3300025242 Bacteria 103648
81 Ga0209646_1000003 3300025246 Bacteria 1160860
82 Ga0209646_1004869 3300025246 Bacteria 2404
83 Ga0209026_1000202 3300025250 Bacteria 82517
84 Ga0209148_1000234 3300025254 Bacteria 90627
85 Ga0209673_1000166 3300025273 Bacteria 135260
86 Ga0209564_1001708 3300025295 Bacteria 20697
87 Ga0209564_1005882 3300025295 Bacteria 6806
88 Ga0209758_1001413 3300025297 Bacteria 28443
89 Ga0209758_1003452 3300025297 Bacteria 14342
90 Ga0209758_1026529 3300025297 Bacteria 2503
91 Ga0207426_1000364 3300025302 Bacteria 80671
92 Ga0207426_1000583 3300025302 Bacteria 48573
93 Ga0207426_1001181 3300025302 Bacteria 23338
94 Ga0209257_1003086 3300025304 Bacteria 14985
95 Ga0207705_10271771 3300025909 Bacteria 1296
96 Ga0207707_10136355 3300025912 Bacteria 2146
97 Ga0207695_10000016 3300025913 Bacteria 771991
98 Ga0207695_10000184 3300025913 Bacteria 181201
99 Ga0207695_10000645 3300025913 Bacteria 69294
100 Ga0207695_10063601 3300025913 Bacteria 3803
101 Ga0207671_10001942 3300025914 Bacteria 22821
102 Ga0207660_10021044 3300025917 Bacteria 4383
103 Ga0207652_10000278 3300025921 Bacteria 53117
104 Ga0207652_10013779 3300025921 Bacteria 6539
105 Ga0207694_10382396 3300025924 Bacteria 1169
106 Ga0207650_10148853 3300025925 Bacteria 1846
107 Ga0207690_10000943 3300025932 Bacteria 18615
108 Ga0207669_10164440 3300025937 Bacteria 1572
109 Ga0207704_10692909 3300025938 Bacteria 843
110 Ga0207691_10012734 3300025940 Bacteria 8056
111 Ga0207667_10003030 3300025949 Bacteria 20857
112 Ga0207667_10132017 3300025949 Bacteria 2572
113 Ga0207651_10127508 3300025960 Bacteria 1942
114 Ga0207639_10055324 3300026041 Bacteria 3036
115 Ga0207678_10160987 3300026067 Bacteria 1917
116 Ga0207702_10008170 3300026078 Bacteria 8848
117 Ga0207702_10052178 3300026078 Bacteria 3459
118 Ga0207683_10627782 3300026121 Unclassified 995
119 Ga0268266_10000180 3300028379 Bacteria 112295
120 Ga0268264_10000012 3300028381 Bacteria 521740
121 Ga0268264_10063985 3300028381 Unclassified 3095
122 Ga0307517_10017476 3300028786 Bacteria 9348
123 Ga0307517_10049828 3300028786 Bacteria 4274
124 Ga0307511_10000367 3300030521 Bacteria 48024
125 Ga0265327_10000351 3300031251 Bacteria 87732
126 Ga0265327_10035519 3300031251 Bacteria 2753
127 Ga0307509_10085194 3300031507 Bacteria 3253
128 Ga0307408_100000650 3300031548 Bacteria 29170
129 Ga0307516_10000956 3300031730 Bacteria 39870
130 Ga0307516_10006597 3300031730 Bacteria 13564
131 Ga0307407_10000001 3300031903 Bacteria 570048
132 Ga0307416_100000026 3300032002 Bacteria 172622
133 Ga0307414_10080650 3300032004 Bacteria 2380
134 Ga0307510_10001340 3300033180 Bacteria 26855
135 Ga0373955_0203985 3300035172 Bacteria 1178
136 Ga0373937_0191487 3300036401 Bacteria 1922
137 Ga0373937_0447052 3300036401 Unclassified 1227
138 Ga0395899_0014129 3300037312 Bacteria 6094
139 Ga0395900_0018985 3300037418 Bacteria 7013
140 Ga0395898_0034113 3300037466 Bacteria 5074
141 Ga0395901_0023413 3300038443 Bacteria 6331
142 Ga0439439_0041099 3300041406 Bacteria 1199
143 Ga0451853_2966421 3300041512 Unclassified 1726
144 Ga0439431_0004005 3300041997 Bacteria 3242
145 Ga0439431_0015152 3300041997 Bacteria 1793
146 Ga0439449_0008015 3300042007 Bacteria 4012
147 Ga0450898_003244 3300042134 Bacteria 2328
148 Ga0439434_0010224 3300042435 Bacteria 2766
149 Ga0466972_0000027 3300044658 Bacteria 174082
150 Ga0466972_0000139 3300044658 Bacteria 59557
151 Ga0466972_0028069 3300044658 Bacteria 2780
152 Ga0466965_0061789 3300044683 Bacteria 1873
153 Ga0466961_0101298 3300044693 Unclassified 1814
154 Ga0453684_0054362 3300044712 Bacteria 5216
155 Ga0466971_0006251 3300044719 Bacteria 5177
156 Ga0466970_0006622 3300044765 Bacteria 5794
157 Ga0466957_0014862 3300044842 Bacteria 4539
158 Ga0466957_0418964 3300044842 Unclassified 918
159 Ga0466959_0001248 3300045049 Bacteria 15359
160 Ga0451576_0000002 3300045051 Bacteria 1670975
161 Ga0495627_004166 3300046453 Bacteria 6131
162 Ga0495629_0068102 3300046459 Bacteria 2484
163 Ga0495585_0000477 3300046492 Bacteria 38276
164 Ga0495583_0121018 3300046506 Bacteria 1102
165 Ga0495632_0051185 3300046519 Bacteria 2034
166 Ga0495648_0007084 3300046524 Bacteria 9028
167 Ga0495587_0230115 3300046536 Bacteria 1045
168 Ga0495609_0006151 3300046538 Bacteria 6174
169 Ga0495622_0076587 3300046557 Bacteria 1541
170 Ga0495633_0000154 3300046558 Bacteria 90209
171 Ga0495668_0000121 3300046616 Bacteria 116234
172 Ga0495668_0003336 3300046616 Bacteria 12103
173 Ga0495611_0000057 3300046648 Bacteria 80239
174 Ga0495625_0003507 3300046660 Bacteria 15548
175 Ga0495625_0356968 3300046660 Unclassified 922
176 Ga0495661_0013486 3300046665 Bacteria 5487
177 Ga0495658_0022505 3300046683 Bacteria 3334
178 Ga0495660_0069215 3300046810 Bacteria 1876
179 Ga0495614_0008696 3300048089 Bacteria 4515
180 Ga0496114_0003996 3300048917 Bacteria 11388
181 Ga0496115_0024899 3300048918 Unclassified 4655
182 Ga0496125_0000586 3300048928 Bacteria 62077
183 Ga0496126_0013166 3300048929 Bacteria 8436
184 Ga0501034_0003261 3300049571 Bacteria 18539
185 Ga0501034_0472970 3300049571 Bacteria 1169
186 Ga0501037_0037043 3300049573 Bacteria 3595
187 Ga0501043_0038806 3300049579 Bacteria 3745
188 Ga0501047_0066988 3300049581 Bacteria 3461
189 Ga0501070_0001260 3300049586 Bacteria 22710
190 Ga0501219_000015 3300049703 Bacteria 26451
191 Ga0501241_000617 3300049758 Bacteria 7641
192 Ga0501241_009774 3300049758 Bacteria 1746
193 Ga0501044_0003358 3300049823 Bacteria 18047
194 Ga0501284_00001 3300050005 Bacteria 261916
195 nmdc:mga0k408_37624_c1 3300050493 Bacteria 2778
196 nmdc:mga0k408_41411_c1 3300050493 Bacteria 2651
197 nmdc:mga09592_10367_c1 3300050508 Bacteria 7582
198 Ga0500578_0087360 3300053086 Bacteria 1981
199 Ga0500644_0000222 3300053088 Bacteria 32776
200 Ga0500651_0069880 3300053093 Bacteria 2186
201 Ga0500556_0087877 3300053104 Bacteria 1184
202 Ga0500569_007222 3300053109 Bacteria 2481
203 Ga0500614_047832 3300053123 Bacteria 1112
204 Ga0500652_005034 3300053131 Bacteria 4132
205 Ga0500559_0051817 3300053136 Bacteria 1813
206 Ga0500561_0004123 3300053137 Bacteria 2600
207 Ga0500561_0010640 3300053137 Bacteria 1909
208 Ga0500577_0015841 3300053142 Bacteria 2364
209 Ga0500616_0040817 3300053153 Bacteria 2494

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044842 Ga0466957_0418964 Ga0466957_0418964_306_905 199
2 3300031251 Ga0265327_10035519 Ga0265327_100355194 236
3 3300046665 Ga0495661_0013486 Ga0495661_0013486_3773_4507 236
4 3300009551 Ga0105238_10361293 Ga0105238_103612932 239
5 3300013297 Ga0157378_10005828 Ga0157378_100058282 239
6 iso_pu_bacteria 2852627209 2852630079 241
7 3300041997 Ga0439431_0004005 Ga0439431_0004005_398_1138 243
8 3300050493 nmdc:mga0k408_37624_c1 nmdc:mga0k408_37624_c1_751_1482 243
9 3300017792 Ga0163161_10002279 Ga0163161_100022797 244
10 3300046538 Ga0495609_0006151 Ga0495609_0006151_5124_5858 244
11 3300046810 Ga0495660_0069215 Ga0495660_0069215_982_1716 244
12 3300003320 rootH2_10226751 rootH2_102267511 245
13 3300003323 rootH1_10027082 rootH1_100270826 245
14 3300005289 Ga0065704_10163530 Ga0065704_101635302 245
15 3300013307 Ga0157372_10016648 Ga0157372_100166486 245
16 3300031548 Ga0307408_100000650 Ga0307408_10000065023 245
17 3300031903 Ga0307407_10000001 Ga0307407_10000001512 245
18 3300032002 Ga0307416_100000026 Ga0307416_10000002641 245
19 3300044693 Ga0466961_0101298 Ga0466961_0101298_1010_1747 245
20 3300044719 Ga0466971_0006251 Ga0466971_0006251_480_1217 245
21 3300045049 Ga0466959_0001248 Ga0466959_0001248_6638_7375 245
22 3300046459 Ga0495629_0068102 Ga0495629_0068102_197_934 245
23 3300046492 Ga0495585_0000477 Ga0495585_0000477_23105_23842 245
24 3300046506 Ga0495583_0121018 Ga0495583_0121018_294_1031 245
25 3300046524 Ga0495648_0007084 Ga0495648_0007084_4311_5048 245
26 3300046557 Ga0495622_0076587 Ga0495622_0076587_435_1172 245
27 3300046616 Ga0495668_0000121 Ga0495668_0000121_43512_44249 245
28 3300046660 Ga0495625_0003507 Ga0495625_0003507_14449_15186 245
29 3300048089 Ga0495614_0008696 Ga0495614_0008696_2259_2996 245
30 3300053123 Ga0500614_047832 Ga0500614_047832_77_814 245
31 3300053137 Ga0500561_0004123 Ga0500561_0004123_539_1276 245
32 3300005366 Ga0070659_100001238 Ga0070659_1000012385 246
33 3300006881 Ga0068865_100483584 Ga0068865_1004835841 246
34 3300025932 Ga0207690_10000943 Ga0207690_1000094322 246
35 3300025938 Ga0207704_10692909 Ga0207704_106929091 246
36 3300046453 Ga0495627_004166 Ga0495627_004166_4318_5067 248
37 3300046558 Ga0495633_0000154 Ga0495633_0000154_51914_52663 248
38 3300053093 Ga0500651_0069880 Ga0500651_0069880_1026_1775 248
39 iso_pu_bacteria 2852623160 2852624241 248
40 3300005293 Ga0065715_10221826 Ga0065715_102218262 249
41 iso_pu_bacteria 8003151029 8003156546 250
42 3300003320 rootH2_10325803 rootH2_103258031 252
43 3300005353 Ga0070669_100159191 Ga0070669_1001591912 253
44 3300045051 Ga0451576_0000002 Ga0451576_0000002_379632_380393 253
45 3300046519 Ga0495632_0051185 Ga0495632_0051185_202_963 253
46 3300053109 Ga0500569_007222 Ga0500569_007222_1627_2388 253
47 3300053142 Ga0500577_0015841 Ga0500577_0015841_1561_2322 253
48 3300053153 Ga0500616_0040817 Ga0500616_0040817_744_1505 253
49 iso_pu_bacteria 2896344016 2896345282 253
50 iso_pu_bacteria 2929921140 2929925832 253
51 3300005471 Ga0070698_100062591 Ga0070698_1000625914 254
52 3300006195 Ga0075366_10044763 Ga0075366_100447633 254
53 3300025242 Ga0209258_100234 Ga0209258_1002343 254
54 3300025254 Ga0209148_1000234 Ga0209148_10002343 254
55 3300028786 Ga0307517_10049828 Ga0307517_100498282 254
56 3300041512 Ga0451853_2966421 Ga0451853_2966421_643_1407 254
57 3300049758 Ga0501241_000617 Ga0501241_000617_5015_5779 254
58 3300050493 nmdc:mga0k408_41411_c1 nmdc:mga0k408_41411_c1_735_1499 254
59 3300053088 Ga0500644_0000222 Ga0500644_0000222_21524_22288 254
60 3300053136 Ga0500559_0051817 Ga0500559_0051817_237_1001 254
61 3300053137 Ga0500561_0010640 Ga0500561_0010640_1101_1865 254
62 iso_pu_bacteria 2738541278 2738728534 254
63 iso_pu_bacteria 2839989709 2839990987 254
64 3300002738 JGI25154J39366_1000016 JGI25154J39366_100001662 255
65 3300002741 JGI25157J39369_1006096 JGI25157J39369_10060962 255
66 3300003215 JGI25153J46596_10005236 JGI25153J46596_100052366 255
67 3300003320 rootH2_10150023 rootH2_101500233 255
68 3300013104 Ga0157370_10098961 Ga0157370_100989613 255
69 3300025246 Ga0209646_1000003 Ga0209646_100000362 255
70 3300025250 Ga0209026_1000202 Ga0209026_100020235 255
71 3300025297 Ga0209758_1026529 Ga0209758_10265293 255
72 3300025302 Ga0207426_1000364 Ga0207426_100036454 255
73 3300025913 Ga0207695_10063601 Ga0207695_100636015 255
74 3300005614 Ga0068856_100254464 Ga0068856_1002544642 256
75 3300032004 Ga0307414_10080650 Ga0307414_100806503 256
76 3300035172 Ga0373955_0203985 Ga0373955_0203985_307_1098 256
77 3300036401 Ga0373937_0447052 Ga0373937_0447052_77_850 256
78 3300046536 Ga0495587_0230115 Ga0495587_0230115_255_1025 256
79 3300046683 Ga0495658_0022505 Ga0495658_0022505_1462_2304 256
80 3300048918 Ga0496115_0024899 Ga0496115_0024899_3078_3848 256
81 3300048928 Ga0496125_0000586 Ga0496125_0000586_55224_55994 256
82 3300048929 Ga0496126_0013166 Ga0496126_0013166_6241_7011 256
83 2162886007 SwRhRL2b_contig_1663050 SwRhRL2b_0644.00005800 257
84 3300003320 rootH2_10001201 rootH2_100012016 257
85 3300003354 JGI25160J50197_1001714 JGI25160J50197_100171413 257
86 3300003771 Ga0055526_1005853 Ga0055526_10058536 257
87 3300003771 Ga0055526_1008112 Ga0055526_10081122 257
88 3300003790 Ga0055528_1000610 Ga0055528_10006107 257
89 3300005262 Ga0065165_1000232 Ga0065165_100023242 257
90 3300005289 Ga0065704_10070140 Ga0065704_10070140364 257
91 3300005290 Ga0065712_10171102 Ga0065712_101711022 257
92 3300005333 Ga0070677_10005107 Ga0070677_100051072 257
93 3300005354 Ga0070675_100156552 Ga0070675_1001565522 257
94 3300005356 Ga0070674_100226461 Ga0070674_1002264612 257
95 3300005458 Ga0070681_10164399 Ga0070681_101643992 257
96 3300005458 Ga0070681_10322895 Ga0070681_103228951 257
97 3300005530 Ga0070679_100042383 Ga0070679_1000423832 257
98 3300005530 Ga0070679_100060507 Ga0070679_1000605075 257
99 3300005543 Ga0070672_100049156 Ga0070672_1000491563 257
100 3300005548 Ga0070665_100000189 Ga0070665_10000018954 257
101 3300005563 Ga0068855_100004200 Ga0068855_1000042002 257
102 3300005563 Ga0068855_100042754 Ga0068855_1000427545 257
103 3300005563 Ga0068855_100185422 Ga0068855_1001854222 257
104 3300005563 Ga0068855_100274577 Ga0068855_1002745772 257
105 3300005577 Ga0068857_100153860 Ga0068857_1001538601 257
106 3300005614 Ga0068856_100011868 Ga0068856_1000118686 257
107 3300005719 Ga0068861_100446968 Ga0068861_1004469682 257
108 3300005843 Ga0068860_100000005 Ga0068860_100000005116 257
109 3300005843 Ga0068860_100051825 Ga0068860_1000518254 257
110 3300005983 Ga0081540_1061318 Ga0081540_10613182 257
111 3300006844 Ga0075428_100127381 Ga0075428_1001273813 257
112 3300006847 Ga0075431_100008453 Ga0075431_1000084538 257
113 3300006880 Ga0075429_100120411 Ga0075429_1001204112 257
114 3300009093 Ga0105240_10000023 Ga0105240_1000002386 257
115 3300009093 Ga0105240_10000833 Ga0105240_1000083336 257
116 3300009093 Ga0105240_10002592 Ga0105240_1000259218 257
117 3300009093 Ga0105240_10092487 Ga0105240_100924871 257
118 3300009147 Ga0114129_10098406 Ga0114129_100984064 257
119 3300009545 Ga0105237_10002503 Ga0105237_1000250317 257
120 3300009545 Ga0105237_10026390 Ga0105237_100263905 257
121 3300009551 Ga0105238_10031339 Ga0105238_100313396 257
122 3300010375 Ga0105239_10000267 Ga0105239_1000026729 257
123 3300010375 Ga0105239_10001651 Ga0105239_100016516 257
124 3300010375 Ga0105239_10003037 Ga0105239_100030376 257
125 3300010375 Ga0105239_10068134 Ga0105239_100681343 257
126 3300013102 Ga0157371_10012811 Ga0157371_100128113 257
127 3300013102 Ga0157371_10049742 Ga0157371_100497421 257
128 3300013104 Ga0157370_10140471 Ga0157370_101404712 257
129 3300013105 Ga0157369_10076857 Ga0157369_100768575 257
130 3300013296 Ga0157374_10000003 Ga0157374_10000003323 257
131 3300013297 Ga0157378_10230909 Ga0157378_102309091 257
132 3300013297 Ga0157378_10383206 Ga0157378_103832062 257
133 3300013306 Ga0163162_10001420 Ga0163162_1000142013 257
134 3300013307 Ga0157372_10007012 Ga0157372_100070126 257
135 3300013307 Ga0157372_10014136 Ga0157372_100141363 257
136 3300013307 Ga0157372_10046901 Ga0157372_100469014 257
137 3300013307 Ga0157372_10204494 Ga0157372_102044942 257
138 3300013307 Ga0157372_10236405 Ga0157372_102364055 257
139 3300014325 Ga0163163_10185717 Ga0163163_101857174 257
140 3300014969 Ga0157376_10000580 Ga0157376_100005805 257
141 3300014969 Ga0157376_10422493 Ga0157376_104224932 257
142 3300025246 Ga0209646_1004869 Ga0209646_10048692 257
143 3300025273 Ga0209673_1000166 Ga0209673_100016662 257
144 3300025295 Ga0209564_1001708 Ga0209564_100170815 257
145 3300025295 Ga0209564_1005882 Ga0209564_10058823 257
146 3300025297 Ga0209758_1001413 Ga0209758_10014138 257
147 3300025297 Ga0209758_1003452 Ga0209758_10034527 257
148 3300025302 Ga0207426_1000583 Ga0207426_100058333 257
149 3300025302 Ga0207426_1001181 Ga0207426_100118124 257
150 3300025304 Ga0209257_1003086 Ga0209257_100308612 257
151 3300025909 Ga0207705_10271771 Ga0207705_102717713 257
152 3300025912 Ga0207707_10136355 Ga0207707_101363555 257
153 3300025913 Ga0207695_10000016 Ga0207695_10000016231 257
154 3300025913 Ga0207695_10000184 Ga0207695_1000018464 257
155 3300025913 Ga0207695_10000645 Ga0207695_1000064550 257
156 3300025914 Ga0207671_10001942 Ga0207671_1000194217 257
157 3300025917 Ga0207660_10021044 Ga0207660_100210448 257
158 3300025921 Ga0207652_10000278 Ga0207652_1000027851 257
159 3300025921 Ga0207652_10013779 Ga0207652_100137798 257
160 3300025924 Ga0207694_10382396 Ga0207694_103823962 257
161 3300025925 Ga0207650_10148853 Ga0207650_101488532 257
162 3300025937 Ga0207669_10164440 Ga0207669_101644402 257
163 3300025940 Ga0207691_10012734 Ga0207691_100127346 257
164 3300025949 Ga0207667_10003030 Ga0207667_1000303015 257
165 3300025949 Ga0207667_10132017 Ga0207667_101320175 257
166 3300025960 Ga0207651_10127508 Ga0207651_101275081 257
167 3300026041 Ga0207639_10055324 Ga0207639_100553242 257
168 3300026067 Ga0207678_10160987 Ga0207678_101609873 257
169 3300026078 Ga0207702_10008170 Ga0207702_100081708 257
170 3300026078 Ga0207702_10052178 Ga0207702_100521781 257
171 3300026121 Ga0207683_10627782 Ga0207683_106277822 257
172 3300028379 Ga0268266_10000180 Ga0268266_1000018043 257
173 3300028381 Ga0268264_10000012 Ga0268264_1000001298 257
174 3300028381 Ga0268264_10063985 Ga0268264_100639852 257
175 3300028786 Ga0307517_10017476 Ga0307517_100174763 257
176 3300030521 Ga0307511_10000367 Ga0307511_1000036740 257
177 3300031251 Ga0265327_10000351 Ga0265327_100003514 257
178 3300031507 Ga0307509_10085194 Ga0307509_100851943 257
179 3300031730 Ga0307516_10000956 Ga0307516_100009567 257
180 3300031730 Ga0307516_10006597 Ga0307516_100065976 257
181 3300033180 Ga0307510_10001340 Ga0307510_100013402 257
182 3300036401 Ga0373937_0191487 Ga0373937_0191487_802_1575 257
183 3300037312 Ga0395899_0014129 Ga0395899_0014129_3411_4184 257
184 3300037418 Ga0395900_0018985 Ga0395900_0018985_764_1537 257
185 3300037466 Ga0395898_0034113 Ga0395898_0034113_2037_2810 257
186 3300038443 Ga0395901_0023413 Ga0395901_0023413_2140_2913 257
187 3300041406 Ga0439439_0041099 Ga0439439_0041099_23_796 257
188 3300041997 Ga0439431_0015152 Ga0439431_0015152_822_1595 257
189 3300042007 Ga0439449_0008015 Ga0439449_0008015_1650_2423 257
190 3300042134 Ga0450898_003244 Ga0450898_003244_121_894 257
191 3300042435 Ga0439434_0010224 Ga0439434_0010224_73_846 257
192 3300044658 Ga0466972_0000027 Ga0466972_0000027_103576_104349 257
193 3300044658 Ga0466972_0000139 Ga0466972_0000139_16480_17253 257
194 3300044658 Ga0466972_0028069 Ga0466972_0028069_64_837 257
195 3300044683 Ga0466965_0061789 Ga0466965_0061789_308_1099 257
196 3300044712 Ga0453684_0054362 Ga0453684_0054362_589_1362 257
197 3300044765 Ga0466970_0006622 Ga0466970_0006622_192_965 257
198 3300044842 Ga0466957_0014862 Ga0466957_0014862_70_843 257
199 3300046558 Ga0495633_0000154 Ga0495633_0000154_50666_51439 257
200 3300046616 Ga0495668_0003336 Ga0495668_0003336_10682_11455 257
201 3300046648 Ga0495611_0000057 Ga0495611_0000057_23522_24295 257
202 3300046660 Ga0495625_0356968 Ga0495625_0356968_92_865 257
203 3300048917 Ga0496114_0003996 Ga0496114_0003996_955_1728 257
204 3300049571 Ga0501034_0003261 Ga0501034_0003261_4874_5647 257
205 3300049571 Ga0501034_0472970 Ga0501034_0472970_117_890 257
206 3300049573 Ga0501037_0037043 Ga0501037_0037043_1349_2122 257
207 3300049579 Ga0501043_0038806 Ga0501043_0038806_2520_3293 257
208 3300049581 Ga0501047_0066988 Ga0501047_0066988_1054_1827 257
209 3300049586 Ga0501070_0001260 Ga0501070_0001260_9182_9955 257
210 3300049703 Ga0501219_000015 Ga0501219_000015_12458_13231 257
211 3300049758 Ga0501241_009774 Ga0501241_009774_537_1310 257
212 3300049823 Ga0501044_0003358 Ga0501044_0003358_9057_9830 257
213 3300050005 Ga0501284_00001 Ga0501284_00001_131853_132626 257
214 3300050508 nmdc:mga09592_10367_c1 nmdc:mga09592_10367_c1_6600_7373 257
215 3300053086 Ga0500578_0087360 Ga0500578_0087360_209_982 257
216 3300053104 Ga0500556_0087877 Ga0500556_0087877_116_889 257
217 3300053131 Ga0500652_005034 Ga0500652_005034_2324_3100 257

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

26

238

0.82

PF00149

Metallophos

Calcineurin-like phosphoesterase

26

194

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qfn-assembly1.cif.gz_B crystal structure of streptococcal asymmetric ap4a hydrolase and phosphodiesterase spr1479/saph in complex with inorganic phosphate 0.8029 1 257
3qfn-assembly1.cif.gz_B crystal structure of streptococcal asymmetric ap4a hydrolase and phosphodiesterase spr1479/saph in complex with inorganic phosphate 0.797 1 257
2gju-assembly1.cif.gz_B crystal structure of hypothetical protein ph1004 from pyrococcus horikoshii ot3 0.7916 2 257
3rqz-assembly2.cif.gz_B crystal structure of metallophosphoesterase from sphaerobacter thermophilus 0.778 1 257
2gju-assembly1.cif.gz_B crystal structure of hypothetical protein ph1004 from pyrococcus horikoshii ot3 0.7776 2 257
ID Description Score Start End Superfamily
af_Q58322_5_243_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8048 3 257 3.60.21.10
3qfnB00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8029 1 257 3.60.21.10
af_Q58322_5_243_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7984 3 257 3.60.21.10
3qfnB00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.797 1 257 3.60.21.10
2gjuC00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7927 2 257 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A4Q3C0Z2-F1-model_v4 deleted 0.9975 1 172
AF-A0A7J2QXW9-F1-model_v4 Metallophosphoesterase 0.9952 1 169 GO:0005737
GO:0016791
AF-A0A7X9FYJ0-F1-model_v4 Metallophosphoesterase 0.9949 1 105 GO:0005737
GO:0016791
AF-A0A4Q6AP07-F1-model_v4 YfcE family phosphodiesterase 0.9921 40 257
AF-L8JWF1-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9903 1 257 GO:0005737
GO:0016791

Feature Viewer

pLDDT pTM Quality
94.91 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map