F328439
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 217 | 155 | 215 | 249 |
Family's Representative Sequence
| Representative Sequence | 3300005356|Ga0070674_100093459|Ga0070674_1000934592 |
| Length | 271 |
| Sequence | MDITTNLVADGSKENPNENNSMIRSIIIDDEPKNIRILRGLLEEFCPSVKVMAEANSAQDAIPLIREHQPDLLFLDIEMPFGNAFDLLDKLKPVDFEIIFITAFDEYTLKAFKYSALDYLLKPVNIDELKEAVQKAGKRIEHKNINKQLSNLFHNIKKPPTALQRIAFPDNEGVMVFIELKEISHLEAKRGYTYVYTRNKQVYISSRIIKEYEELLPEDIFFRVHNSSIINMNFIRKYHKGRGGMVEMEDGSMLEVAARRKDEFLSRFAIE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 2 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 48 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 50 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 52 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 53 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 54 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 55 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 56 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 78 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 112 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 113 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 114 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 115 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 116 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 117 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 118 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 119 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 120 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 121 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 122 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 123 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 124 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 125 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 126 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 127 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 128 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 129 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 130 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 134 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 135 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 136 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 137 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 138 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 139 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 140 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 141 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 142 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 143 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 144 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 145 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 146 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 147 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 148 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 149 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 150 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 151 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 152 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 153 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 154 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 155 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.54 |
| Metatranscriptomes | 0 |
| Isolates | 0.46 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.98 |
| Nodule | 0 |
| Rhizoplane | 0.46 |
| Rhizosphere | 80.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10074827 | 3300003316 | Bacteria | 5977 |
| 2 | rootH1_10152130 | 3300003316 | Bacteria | 2921 |
| 3 | rootH2_10016137 | 3300003320 | Bacteria | 3792 |
| 4 | rootL2_10293693 | 3300003322 | Bacteria | 1154 |
| 5 | rootH1_10034550 | 3300003323 | Bacteria | 12862 |
| 6 | rootH1_10165609 | 3300003323 | Bacteria | 1483 |
| 7 | rootH1_10223560 | 3300003323 | Bacteria | 2135 |
| 8 | JGI25160J50197_1008727 | 3300003354 | Bacteria | 3837 |
| 9 | JGI25160J50197_1012062 | 3300003354 | Bacteria | 3027 |
| 10 | Ga0065712_10085468 | 3300005290 | Bacteria | 2695 |
| 11 | Ga0065715_10096306 | 3300005293 | Bacteria | 3906 |
| 12 | Ga0065707_10164748 | 3300005295 | Bacteria | 1522 |
| 13 | Ga0070683_100051656 | 3300005329 | Bacteria | 3806 |
| 14 | Ga0070690_100035300 | 3300005330 | Bacteria | 3137 |
| 15 | Ga0070670_100580680 | 3300005331 | Bacteria | 1002 |
| 16 | Ga0068869_100135487 | 3300005334 | Bacteria | 1897 |
| 17 | Ga0070666_10007987 | 3300005335 | Bacteria | 6543 |
| 18 | Ga0070666_10044875 | 3300005335 | Bacteria | 2963 |
| 19 | Ga0070680_100083237 | 3300005336 | Bacteria | 2642 |
| 20 | Ga0070682_100081198 | 3300005337 | Bacteria | 2099 |
| 21 | Ga0068868_100045099 | 3300005338 | Bacteria | 3448 |
| 22 | Ga0070660_100008134 | 3300005339 | Bacteria | 7330 |
| 23 | Ga0070689_100026931 | 3300005340 | Bacteria | 4332 |
| 24 | Ga0070687_100227858 | 3300005343 | Bacteria | 1145 |
| 25 | Ga0070675_100087854 | 3300005354 | Bacteria | 2600 |
| 26 | Ga0070675_100201558 | 3300005354 | Bacteria | 1727 |
| 27 | Ga0070671_100559926 | 3300005355 | Bacteria | 986 |
| 28 | Ga0070674_100093459 | 3300005356 | Bacteria | 2176 |
| 29 | Ga0070673_100033988 | 3300005364 | Bacteria | 3854 |
| 30 | Ga0070673_100333024 | 3300005364 | Bacteria | 1343 |
| 31 | Ga0070688_100049223 | 3300005365 | Bacteria | 2622 |
| 32 | Ga0070659_100002526 | 3300005366 | Bacteria | 12997 |
| 33 | Ga0070701_10164997 | 3300005438 | Bacteria | 1286 |
| 34 | Ga0070662_100038521 | 3300005457 | Bacteria | 3396 |
| 35 | Ga0070662_100374738 | 3300005457 | Bacteria | 1170 |
| 36 | Ga0070681_10704075 | 3300005458 | Bacteria | 926 |
| 37 | Ga0070685_10012594 | 3300005466 | Unclassified | 4446 |
| 38 | Ga0070698_100009374 | 3300005471 | Bacteria | 10499 |
| 39 | Ga0070684_100004197 | 3300005535 | Bacteria | 10918 |
| 40 | Ga0068853_100012180 | 3300005539 | Bacteria | 6994 |
| 41 | Ga0068853_100136158 | 3300005539 | Bacteria | 2202 |
| 42 | Ga0068853_100515213 | 3300005539 | Bacteria | 1130 |
| 43 | Ga0070672_100025327 | 3300005543 | Bacteria | 4398 |
| 44 | Ga0070704_100158472 | 3300005549 | Bacteria | 1788 |
| 45 | Ga0068855_100009348 | 3300005563 | Bacteria | 11834 |
| 46 | Ga0068855_100009545 | 3300005563 | Bacteria | 11719 |
| 47 | Ga0070664_100192123 | 3300005564 | Bacteria | 1819 |
| 48 | Ga0068857_100398673 | 3300005577 | Bacteria | 1280 |
| 49 | Ga0068854_100288282 | 3300005578 | Bacteria | 1324 |
| 50 | Ga0068856_100088747 | 3300005614 | Bacteria | 3075 |
| 51 | Ga0068856_100113052 | 3300005614 | Bacteria | 2713 |
| 52 | Ga0068852_100025052 | 3300005616 | Bacteria | 4829 |
| 53 | Ga0068852_100099284 | 3300005616 | Bacteria | 2624 |
| 54 | Ga0068859_100038941 | 3300005617 | Bacteria | 4768 |
| 55 | Ga0068859_100809289 | 3300005617 | Bacteria | 1024 |
| 56 | Ga0068864_100484336 | 3300005618 | Bacteria | 1188 |
| 57 | Ga0068861_100017707 | 3300005719 | Bacteria | 5063 |
| 58 | Ga0068861_100442771 | 3300005719 | Bacteria | 1162 |
| 59 | Ga0068861_100848033 | 3300005719 | Bacteria | 861 |
| 60 | Ga0068870_10309562 | 3300005840 | Bacteria | 1000 |
| 61 | Ga0068860_100765064 | 3300005843 | Bacteria | 978 |
| 62 | Ga0068862_100345068 | 3300005844 | Bacteria | 1380 |
| 63 | Ga0070712_100047190 | 3300006175 | Bacteria | 2980 |
| 64 | Ga0075366_10005117 | 3300006195 | Bacteria | 7092 |
| 65 | Ga0075366_10023526 | 3300006195 | Bacteria | 3589 |
| 66 | Ga0075366_10199360 | 3300006195 | Bacteria | 1217 |
| 67 | Ga0075366_10422664 | 3300006195 | Bacteria | 821 |
| 68 | Ga0097621_100046591 | 3300006237 | Bacteria | 3509 |
| 69 | Ga0097621_100694921 | 3300006237 | Bacteria | 936 |
| 70 | Ga0068871_100044141 | 3300006358 | Bacteria | 3583 |
| 71 | Ga0075428_100006060 | 3300006844 | Bacteria | 13438 |
| 72 | Ga0075430_100015995 | 3300006846 | Bacteria | 6389 |
| 73 | Ga0075431_100010571 | 3300006847 | Bacteria | 9281 |
| 74 | Ga0075429_100032640 | 3300006880 | Bacteria | 4525 |
| 75 | Ga0075429_100094992 | 3300006880 | Bacteria | 2600 |
| 76 | Ga0097620_100038941 | 3300006931 | Bacteria | 4768 |
| 77 | Ga0097620_100809337 | 3300006931 | Bacteria | 1024 |
| 78 | Ga0105240_10000306 | 3300009093 | Bacteria | 94696 |
| 79 | Ga0105240_10004660 | 3300009093 | Bacteria | 20755 |
| 80 | Ga0111539_10040228 | 3300009094 | Bacteria | 5629 |
| 81 | Ga0111539_10069646 | 3300009094 | Unclassified | 4153 |
| 82 | Ga0111539_10367735 | 3300009094 | Bacteria | 1674 |
| 83 | Ga0114129_10008303 | 3300009147 | Bacteria | 14815 |
| 84 | Ga0114129_10085972 | 3300009147 | Bacteria | 4363 |
| 85 | Ga0114129_10521725 | 3300009147 | Bacteria | 1549 |
| 86 | Ga0105241_10049773 | 3300009174 | Bacteria | 3192 |
| 87 | Ga0105241_10226918 | 3300009174 | Bacteria | 1573 |
| 88 | Ga0105242_10032044 | 3300009176 | Bacteria | 4202 |
| 89 | Ga0105237_10108520 | 3300009545 | Bacteria | 2767 |
| 90 | Ga0105237_10184038 | 3300009545 | Unclassified | 2089 |
| 91 | Ga0105238_10003545 | 3300009551 | Bacteria | 15557 |
| 92 | Ga0105238_10087653 | 3300009551 | Bacteria | 3099 |
| 93 | Ga0105239_10027344 | 3300010375 | Bacteria | 6279 |
| 94 | Ga0105246_10170074 | 3300011119 | Bacteria | 1668 |
| 95 | Ga0105246_10377700 | 3300011119 | Bacteria | 1170 |
| 96 | Ga0157373_10007761 | 3300013100 | Bacteria | 7977 |
| 97 | Ga0157371_10029879 | 3300013102 | Bacteria | 3935 |
| 98 | Ga0157371_10181467 | 3300013102 | Bacteria | 1505 |
| 99 | Ga0157370_10184509 | 3300013104 | Unclassified | 1937 |
| 100 | Ga0157369_10003221 | 3300013105 | Bacteria | 19454 |
| 101 | Ga0157374_10001251 | 3300013296 | Bacteria | 21688 |
| 102 | Ga0157374_10057963 | 3300013296 | Bacteria | 3619 |
| 103 | Ga0157378_10012233 | 3300013297 | Bacteria | 7515 |
| 104 | Ga0157378_10339015 | 3300013297 | Unclassified | 1465 |
| 105 | Ga0163162_10069634 | 3300013306 | Bacteria | 3570 |
| 106 | Ga0157372_10064337 | 3300013307 | Bacteria | 4115 |
| 107 | Ga0157372_10109208 | 3300013307 | Bacteria | 3167 |
| 108 | Ga0157375_10149671 | 3300013308 | Bacteria | 2468 |
| 109 | Ga0157380_10000067 | 3300014326 | Bacteria | 58606 |
| 110 | Ga0157380_10011219 | 3300014326 | Bacteria | 6469 |
| 111 | Ga0157380_10096003 | 3300014326 | Bacteria | 2457 |
| 112 | Ga0157380_10283472 | 3300014326 | Unclassified | 1517 |
| 113 | Ga0157377_10006639 | 3300014745 | Bacteria | 5528 |
| 114 | Ga0157377_10015350 | 3300014745 | Bacteria | 3917 |
| 115 | Ga0209646_1000981 | 3300025246 | Bacteria | 8829 |
| 116 | Ga0207426_1000023 | 3300025302 | Bacteria | 545465 |
| 117 | Ga0207680_10063064 | 3300025903 | Bacteria | 2267 |
| 118 | Ga0207643_10034995 | 3300025908 | Bacteria | 2815 |
| 119 | Ga0207654_10014261 | 3300025911 | Bacteria | 4104 |
| 120 | Ga0207654_10348150 | 3300025911 | Bacteria | 1019 |
| 121 | Ga0207707_10606877 | 3300025912 | Bacteria | 926 |
| 122 | Ga0207695_10000795 | 3300025913 | Bacteria | 59172 |
| 123 | Ga0207695_10008668 | 3300025913 | Bacteria | 12689 |
| 124 | Ga0207671_10003696 | 3300025914 | Bacteria | 15087 |
| 125 | Ga0207693_10059782 | 3300025915 | Bacteria | 2985 |
| 126 | Ga0207657_10000828 | 3300025919 | Bacteria | 32724 |
| 127 | Ga0207649_10023836 | 3300025920 | Bacteria | 3549 |
| 128 | Ga0207652_10097073 | 3300025921 | Bacteria | 2597 |
| 129 | Ga0207694_10236136 | 3300025924 | Unclassified | 1493 |
| 130 | Ga0207659_10085359 | 3300025926 | Bacteria | 2345 |
| 131 | Ga0207706_10057079 | 3300025933 | Bacteria | 3440 |
| 132 | Ga0207670_10101852 | 3300025936 | Bacteria | 2052 |
| 133 | Ga0207669_10085277 | 3300025937 | Bacteria | 2038 |
| 134 | Ga0207691_10024182 | 3300025940 | Bacteria | 5712 |
| 135 | Ga0207689_10077247 | 3300025942 | Bacteria | 2737 |
| 136 | Ga0207667_10066384 | 3300025949 | Unclassified | 3761 |
| 137 | Ga0207640_10181540 | 3300025981 | Bacteria | 1578 |
| 138 | Ga0207677_10052976 | 3300026023 | Bacteria | 2759 |
| 139 | Ga0207639_10074382 | 3300026041 | Unclassified | 2668 |
| 140 | Ga0207708_10289172 | 3300026075 | Bacteria | 1330 |
| 141 | Ga0207702_10067002 | 3300026078 | Unclassified | 3080 |
| 142 | Ga0207702_10209799 | 3300026078 | Bacteria | 1810 |
| 143 | Ga0207641_10281240 | 3300026088 | Bacteria | 1565 |
| 144 | Ga0207648_10215046 | 3300026089 | Bacteria | 1707 |
| 145 | Ga0207676_10289076 | 3300026095 | Bacteria | 1492 |
| 146 | Ga0207674_10064384 | 3300026116 | Unclassified | 3699 |
| 147 | Ga0207674_10145949 | 3300026116 | Bacteria | 2325 |
| 148 | Ga0207674_10258466 | 3300026116 | Bacteria | 1689 |
| 149 | Ga0207675_100077885 | 3300026118 | Bacteria | 3106 |
| 150 | Ga0207675_100115649 | 3300026118 | Unclassified | 2535 |
| 151 | Ga0207675_100219553 | 3300026118 | Bacteria | 1831 |
| 152 | Ga0207675_100573246 | 3300026118 | Unclassified | 1130 |
| 153 | Ga0207698_10074650 | 3300026142 | Bacteria | 2706 |
| 154 | Ga0268266_10000065 | 3300028379 | Bacteria | 246498 |
| 155 | Ga0268265_10490401 | 3300028380 | Bacteria | 1156 |
| 156 | Ga0268264_10597159 | 3300028381 | Bacteria | 1087 |
| 157 | Ga0268264_10620699 | 3300028381 | Bacteria | 1067 |
| 158 | Ga0265327_10001369 | 3300031251 | Bacteria | 31355 |
| 159 | Ga0265327_10019685 | 3300031251 | Unclassified | 4139 |
| 160 | Ga0265316_10068091 | 3300031344 | Bacteria | 2752 |
| 161 | Ga0307513_10094236 | 3300031456 | Bacteria | 3040 |
| 162 | Ga0307509_10094726 | 3300031507 | Bacteria | 3044 |
| 163 | Ga0307516_10356697 | 3300031730 | Unclassified | 1127 |
| 164 | Ga0307510_10000058 | 3300033180 | Bacteria | 85118 |
| 165 | Ga0373925_0561445 | 3300037068 | Unclassified | 939 |
| 166 | Ga0395905_0571490 | 3300037471 | Bacteria | 1032 |
| 167 | Ga0451835_0999691 | 3300041492 | Bacteria | 861 |
| 168 | Ga0451853_2901014 | 3300041512 | Bacteria | 1790 |
| 169 | Ga0451853_3109340 | 3300041512 | Bacteria | 1409 |
| 170 | Ga0439457_001214 | 3300042014 | Bacteria | 7761 |
| 171 | Ga0439434_0046808 | 3300042435 | Bacteria | 1335 |
| 172 | Ga0466969_0002611 | 3300044656 | Bacteria | 9639 |
| 173 | Ga0466972_0000096 | 3300044658 | Bacteria | 77400 |
| 174 | Ga0466972_0005134 | 3300044658 | Bacteria | 6555 |
| 175 | Ga0466966_0001334 | 3300044684 | Bacteria | 15833 |
| 176 | Ga0466961_0157074 | 3300044693 | Bacteria | 1419 |
| 177 | Ga0466957_0005787 | 3300044842 | Bacteria | 6951 |
| 178 | Ga0466959_0000051 | 3300045049 | Bacteria | 81799 |
| 179 | Ga0466967_0240769 | 3300045976 | Bacteria | 1726 |
| 180 | Ga0466967_0260619 | 3300045976 | Bacteria | 1659 |
| 181 | Ga0495638_0184930 | 3300046460 | Bacteria | 1186 |
| 182 | Ga0495625_0142813 | 3300046660 | Unclassified | 1614 |
| 183 | Ga0495687_000001 | 3300047443 | Bacteria | 1215582 |
| 184 | Ga0496115_0001597 | 3300048918 | Bacteria | 16289 |
| 185 | Ga0501039_0421270 | 3300049575 | Bacteria | 1049 |
| 186 | Ga0501219_000553 | 3300049703 | Bacteria | 5485 |
| 187 | Ga0501225_0000184 | 3300049705 | Bacteria | 19482 |
| 188 | Ga0501044_0012811 | 3300049823 | Bacteria | 9081 |
| 189 | Ga0501284_00014 | 3300050005 | Bacteria | 114419 |
| 190 | nmdc:mga0k408_11369_c1 | 3300050493 | Bacteria | 4846 |
| 191 | nmdc:mga0k408_189530_c1 | 3300050493 | Bacteria | 1227 |
| 192 | nmdc:mga0k408_285805_c1 | 3300050493 | Bacteria | 984 |
| 193 | nmdc:mga0k408_388587_c1 | 3300050493 | Bacteria | 831 |
| 194 | nmdc:mga0k408_87264_c1 | 3300050493 | Bacteria | 1832 |
| 195 | nmdc:mga05p37_1722_c1 | 3300050507 | Bacteria | 22019 |
| 196 | nmdc:mga05p37_9261_c1 | 3300050507 | Bacteria | 11640 |
| 197 | nmdc:mga09592_175510_c1 | 3300050508 | Bacteria | 1853 |
| 198 | nmdc:mga0qj67_99190_c1 | 3300050509 | Bacteria | 2347 |
| 199 | nmdc:mga06r32_104297_c1 | 3300050510 | Bacteria | 2784 |
| 200 | nmdc:mga08y16_117569_c1 | 3300050511 | Bacteria | 2767 |
| 201 | nmdc:mga08y16_75806_c1 | 3300050511 | Unclassified | 3505 |
| 202 | Ga0500578_0000074 | 3300053086 | Bacteria | 109442 |
| 203 | Ga0500578_0116087 | 3300053086 | Bacteria | 1685 |
| 204 | Ga0500646_0032006 | 3300053090 | Unclassified | 1449 |
| 205 | Ga0500583_0000015 | 3300053092 | Bacteria | 147804 |
| 206 | Ga0500583_0001134 | 3300053092 | Bacteria | 7609 |
| 207 | Ga0500554_055826 | 3300053102 | Bacteria | 1255 |
| 208 | Ga0500652_024062 | 3300053131 | Bacteria | 2321 |
| 209 | Ga0500568_0001023 | 3300053139 | Bacteria | 19133 |
| 210 | Ga0500616_0000044 | 3300053153 | Bacteria | 339611 |
| 211 | Ga0500622_0011597 | 3300053156 | Bacteria | 4795 |
| 212 | Ga0500622_0107066 | 3300053156 | Bacteria | 1370 |
| 213 | Ga0500639_136118 | 3300053163 | Bacteria | 1156 |
| 214 | Ga0500637_0044624 | 3300053178 | Bacteria | 2512 |
| 215 | Ga0466962_0270715 | 3300061719 | Bacteria | 837 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300061719 | Ga0466962_0270715 | Ga0466962_0270715_123_806 | 221 |
| 2 | 3300026116 | Ga0207674_10145949 | Ga0207674_101459492 | 225 |
| 3 | 3300003323 | rootH1_10165609 | rootH1_101656092 | 226 |
| 4 | 3300005458 | Ga0070681_10704075 | Ga0070681_107040751 | 228 |
| 5 | 3300013102 | Ga0157371_10181467 | Ga0157371_101814672 | 228 |
| 6 | 3300013307 | Ga0157372_10064337 | Ga0157372_100643372 | 228 |
| 7 | 3300025912 | Ga0207707_10606877 | Ga0207707_106068771 | 228 |
| 8 | 3300031730 | Ga0307516_10356697 | Ga0307516_103566971 | 229 |
| 9 | 3300006175 | Ga0070712_100047190 | Ga0070712_1000471902 | 237 |
| 10 | 3300025915 | Ga0207693_10059782 | Ga0207693_100597823 | 237 |
| 11 | 3300048918 | Ga0496115_0001597 | Ga0496115_0001597_13179_13937 | 245 |
| 12 | iso_pu_bacteria | 2738541278 | 2738730929 | 245 |
| 13 | 3300005329 | Ga0070683_100051656 | Ga0070683_1000516562 | 246 |
| 14 | 3300005331 | Ga0070670_100580680 | Ga0070670_1005806801 | 246 |
| 15 | 3300005335 | Ga0070666_10044875 | Ga0070666_100448753 | 246 |
| 16 | 3300005336 | Ga0070680_100083237 | Ga0070680_1000832371 | 246 |
| 17 | 3300005337 | Ga0070682_100081198 | Ga0070682_1000811982 | 246 |
| 18 | 3300005338 | Ga0068868_100045099 | Ga0068868_1000450992 | 246 |
| 19 | 3300005339 | Ga0070660_100008134 | Ga0070660_1000081342 | 246 |
| 20 | 3300005354 | Ga0070675_100087854 | Ga0070675_1000878542 | 246 |
| 21 | 3300005355 | Ga0070671_100559926 | Ga0070671_1005599261 | 246 |
| 22 | 3300005364 | Ga0070673_100033988 | Ga0070673_1000339882 | 246 |
| 23 | 3300005366 | Ga0070659_100002526 | Ga0070659_1000025267 | 246 |
| 24 | 3300005457 | Ga0070662_100038521 | Ga0070662_1000385211 | 246 |
| 25 | 3300005535 | Ga0070684_100004197 | Ga0070684_1000041976 | 246 |
| 26 | 3300005539 | Ga0068853_100012180 | Ga0068853_1000121806 | 246 |
| 27 | 3300005563 | Ga0068855_100009348 | Ga0068855_1000093482 | 246 |
| 28 | 3300005564 | Ga0070664_100192123 | Ga0070664_1001921231 | 246 |
| 29 | 3300005578 | Ga0068854_100288282 | Ga0068854_1002882821 | 246 |
| 30 | 3300005614 | Ga0068856_100113052 | Ga0068856_1001130522 | 246 |
| 31 | 3300005616 | Ga0068852_100025052 | Ga0068852_1000250522 | 246 |
| 32 | 3300006237 | Ga0097621_100046591 | Ga0097621_1000465912 | 246 |
| 33 | 3300006358 | Ga0068871_100044141 | Ga0068871_1000441412 | 246 |
| 34 | 3300013100 | Ga0157373_10007761 | Ga0157373_100077612 | 246 |
| 35 | 3300013102 | Ga0157371_10029879 | Ga0157371_100298792 | 246 |
| 36 | 3300013105 | Ga0157369_10003221 | Ga0157369_100032212 | 246 |
| 37 | 3300013296 | Ga0157374_10001251 | Ga0157374_1000125111 | 246 |
| 38 | 3300013297 | Ga0157378_10012233 | Ga0157378_100122337 | 246 |
| 39 | 3300013306 | Ga0163162_10069634 | Ga0163162_100696343 | 246 |
| 40 | 3300013307 | Ga0157372_10109208 | Ga0157372_101092082 | 246 |
| 41 | 3300014745 | Ga0157377_10015350 | Ga0157377_100153503 | 246 |
| 42 | 3300025919 | Ga0207657_10000828 | Ga0207657_1000082825 | 246 |
| 43 | 3300025920 | Ga0207649_10023836 | Ga0207649_100238363 | 246 |
| 44 | 3300025921 | Ga0207652_10097073 | Ga0207652_100970732 | 246 |
| 45 | 3300025926 | Ga0207659_10085359 | Ga0207659_100853592 | 246 |
| 46 | 3300025933 | Ga0207706_10057079 | Ga0207706_100570791 | 246 |
| 47 | 3300025981 | Ga0207640_10181540 | Ga0207640_101815402 | 246 |
| 48 | 3300026023 | Ga0207677_10052976 | Ga0207677_100529762 | 246 |
| 49 | 3300026078 | Ga0207702_10209799 | Ga0207702_102097992 | 246 |
| 50 | 3300026089 | Ga0207648_10215046 | Ga0207648_102150462 | 246 |
| 51 | 3300026142 | Ga0207698_10074650 | Ga0207698_100746501 | 246 |
| 52 | 3300037471 | Ga0395905_0571490 | Ga0395905_0571490_104_844 | 246 |
| 53 | 3300045976 | Ga0466967_0240769 | Ga0466967_0240769_344_1084 | 246 |
| 54 | 3300045976 | Ga0466967_0260619 | Ga0466967_0260619_674_1414 | 246 |
| 55 | 3300009094 | Ga0111539_10069646 | Ga0111539_100696462 | 247 |
| 56 | 3300014326 | Ga0157380_10000067 | Ga0157380_1000006719 | 247 |
| 57 | 3300014326 | Ga0157380_10283472 | Ga0157380_102834722 | 247 |
| 58 | 3300025937 | Ga0207669_10085277 | Ga0207669_100852772 | 247 |
| 59 | 3300026088 | Ga0207641_10281240 | Ga0207641_102812402 | 247 |
| 60 | 3300031251 | Ga0265327_10019685 | Ga0265327_100196851 | 247 |
| 61 | 3300031344 | Ga0265316_10068091 | Ga0265316_100680912 | 247 |
| 62 | 3300049703 | Ga0501219_000553 | Ga0501219_000553_859_1608 | 247 |
| 63 | 3300050005 | Ga0501284_00014 | Ga0501284_00014_40047_40796 | 247 |
| 64 | 3300050511 | nmdc:mga08y16_75806_c1 | nmdc:mga08y16_75806_c1_1329_2072 | 247 |
| 65 | 3300053153 | Ga0500616_0000044 | Ga0500616_0000044_79152_79895 | 247 |
| 66 | 3300006195 | Ga0075366_10023526 | Ga0075366_100235262 | 248 |
| 67 | 3300009551 | Ga0105238_10087653 | Ga0105238_100876533 | 248 |
| 68 | 3300031251 | Ga0265327_10001369 | Ga0265327_1000136912 | 248 |
| 69 | 3300042435 | Ga0439434_0046808 | Ga0439434_0046808_453_1202 | 248 |
| 70 | 3300050493 | nmdc:mga0k408_11369_c1 | nmdc:mga0k408_11369_c1_328_1074 | 248 |
| 71 | 3300053139 | Ga0500568_0001023 | Ga0500568_0001023_11336_12082 | 248 |
| 72 | 3300003316 | rootH1_10074827 | rootH1_100748273 | 249 |
| 73 | 3300003316 | rootH1_10152130 | rootH1_101521302 | 249 |
| 74 | 3300003320 | rootH2_10016137 | rootH2_100161372 | 249 |
| 75 | 3300003322 | rootL2_10293693 | rootL2_102936932 | 249 |
| 76 | 3300003323 | rootH1_10034550 | rootH1_100345502 | 249 |
| 77 | 3300003323 | rootH1_10223560 | rootH1_102235604 | 249 |
| 78 | 3300003354 | JGI25160J50197_1008727 | JGI25160J50197_10087274 | 249 |
| 79 | 3300003354 | JGI25160J50197_1012062 | JGI25160J50197_10120622 | 249 |
| 80 | 3300005290 | Ga0065712_10085468 | Ga0065712_100854682 | 249 |
| 81 | 3300005293 | Ga0065715_10096306 | Ga0065715_100963061 | 249 |
| 82 | 3300005295 | Ga0065707_10164748 | Ga0065707_101647481 | 249 |
| 83 | 3300005330 | Ga0070690_100035300 | Ga0070690_1000353002 | 249 |
| 84 | 3300005334 | Ga0068869_100135487 | Ga0068869_1001354872 | 249 |
| 85 | 3300005335 | Ga0070666_10007987 | Ga0070666_100079874 | 249 |
| 86 | 3300005340 | Ga0070689_100026931 | Ga0070689_1000269314 | 249 |
| 87 | 3300005343 | Ga0070687_100227858 | Ga0070687_1002278581 | 249 |
| 88 | 3300005354 | Ga0070675_100201558 | Ga0070675_1002015582 | 249 |
| 89 | 3300005356 | Ga0070674_100093459 | Ga0070674_1000934592 | 249 |
| 90 | 3300005364 | Ga0070673_100333024 | Ga0070673_1003330243 | 249 |
| 91 | 3300005365 | Ga0070688_100049223 | Ga0070688_1000492232 | 249 |
| 92 | 3300005438 | Ga0070701_10164997 | Ga0070701_101649972 | 249 |
| 93 | 3300005457 | Ga0070662_100374738 | Ga0070662_1003747382 | 249 |
| 94 | 3300005466 | Ga0070685_10012594 | Ga0070685_100125945 | 249 |
| 95 | 3300005471 | Ga0070698_100009374 | Ga0070698_1000093745 | 249 |
| 96 | 3300005539 | Ga0068853_100136158 | Ga0068853_1001361582 | 249 |
| 97 | 3300005539 | Ga0068853_100515213 | Ga0068853_1005152131 | 249 |
| 98 | 3300005543 | Ga0070672_100025327 | Ga0070672_1000253273 | 249 |
| 99 | 3300005549 | Ga0070704_100158472 | Ga0070704_1001584721 | 249 |
| 100 | 3300005563 | Ga0068855_100009545 | Ga0068855_10000954510 | 249 |
| 101 | 3300005577 | Ga0068857_100398673 | Ga0068857_1003986732 | 249 |
| 102 | 3300005614 | Ga0068856_100088747 | Ga0068856_1000887472 | 249 |
| 103 | 3300005616 | Ga0068852_100099284 | Ga0068852_1000992842 | 249 |
| 104 | 3300005617 | Ga0068859_100038941 | Ga0068859_1000389412 | 249 |
| 105 | 3300005617 | Ga0068859_100809289 | Ga0068859_1008092892 | 249 |
| 106 | 3300005618 | Ga0068864_100484336 | Ga0068864_1004843362 | 249 |
| 107 | 3300005719 | Ga0068861_100017707 | Ga0068861_1000177074 | 249 |
| 108 | 3300005719 | Ga0068861_100442771 | Ga0068861_1004427712 | 249 |
| 109 | 3300005719 | Ga0068861_100848033 | Ga0068861_1008480331 | 249 |
| 110 | 3300005840 | Ga0068870_10309562 | Ga0068870_103095621 | 249 |
| 111 | 3300005843 | Ga0068860_100765064 | Ga0068860_1007650642 | 249 |
| 112 | 3300005844 | Ga0068862_100345068 | Ga0068862_1003450682 | 249 |
| 113 | 3300006195 | Ga0075366_10005117 | Ga0075366_100051172 | 249 |
| 114 | 3300006195 | Ga0075366_10199360 | Ga0075366_101993601 | 249 |
| 115 | 3300006195 | Ga0075366_10422664 | Ga0075366_104226641 | 249 |
| 116 | 3300006237 | Ga0097621_100694921 | Ga0097621_1006949211 | 249 |
| 117 | 3300006844 | Ga0075428_100006060 | Ga0075428_1000060607 | 249 |
| 118 | 3300006846 | Ga0075430_100015995 | Ga0075430_1000159954 | 249 |
| 119 | 3300006847 | Ga0075431_100010571 | Ga0075431_1000105712 | 249 |
| 120 | 3300006880 | Ga0075429_100032640 | Ga0075429_1000326402 | 249 |
| 121 | 3300006880 | Ga0075429_100094992 | Ga0075429_1000949922 | 249 |
| 122 | 3300006931 | Ga0097620_100038941 | Ga0097620_1000389412 | 249 |
| 123 | 3300006931 | Ga0097620_100809337 | Ga0097620_1008093372 | 249 |
| 124 | 3300009093 | Ga0105240_10000306 | Ga0105240_100003062 | 249 |
| 125 | 3300009093 | Ga0105240_10004660 | Ga0105240_100046606 | 249 |
| 126 | 3300009094 | Ga0111539_10040228 | Ga0111539_100402282 | 249 |
| 127 | 3300009094 | Ga0111539_10367735 | Ga0111539_103677352 | 249 |
| 128 | 3300009147 | Ga0114129_10008303 | Ga0114129_100083037 | 249 |
| 129 | 3300009147 | Ga0114129_10085972 | Ga0114129_100859722 | 249 |
| 130 | 3300009147 | Ga0114129_10521725 | Ga0114129_105217251 | 249 |
| 131 | 3300009174 | Ga0105241_10049773 | Ga0105241_100497732 | 249 |
| 132 | 3300009174 | Ga0105241_10226918 | Ga0105241_102269182 | 249 |
| 133 | 3300009176 | Ga0105242_10032044 | Ga0105242_100320442 | 249 |
| 134 | 3300009545 | Ga0105237_10108520 | Ga0105237_101085202 | 249 |
| 135 | 3300009545 | Ga0105237_10184038 | Ga0105237_101840382 | 249 |
| 136 | 3300009551 | Ga0105238_10003545 | Ga0105238_100035453 | 249 |
| 137 | 3300010375 | Ga0105239_10027344 | Ga0105239_100273446 | 249 |
| 138 | 3300011119 | Ga0105246_10170074 | Ga0105246_101700742 | 249 |
| 139 | 3300011119 | Ga0105246_10377700 | Ga0105246_103777001 | 249 |
| 140 | 3300013104 | Ga0157370_10184509 | Ga0157370_101845091 | 249 |
| 141 | 3300013296 | Ga0157374_10057963 | Ga0157374_100579633 | 249 |
| 142 | 3300013297 | Ga0157378_10339015 | Ga0157378_103390152 | 249 |
| 143 | 3300013308 | Ga0157375_10149671 | Ga0157375_101496712 | 249 |
| 144 | 3300014326 | Ga0157380_10011219 | Ga0157380_100112193 | 249 |
| 145 | 3300014326 | Ga0157380_10096003 | Ga0157380_100960032 | 249 |
| 146 | 3300014745 | Ga0157377_10006639 | Ga0157377_100066393 | 249 |
| 147 | 3300025246 | Ga0209646_1000981 | Ga0209646_10009813 | 249 |
| 148 | 3300025302 | Ga0207426_1000023 | Ga0207426_1000023177 | 249 |
| 149 | 3300025302 | Ga0207426_1000023 | Ga0207426_1000023179 | 249 |
| 150 | 3300025903 | Ga0207680_10063064 | Ga0207680_100630642 | 249 |
| 151 | 3300025908 | Ga0207643_10034995 | Ga0207643_100349951 | 249 |
| 152 | 3300025911 | Ga0207654_10014261 | Ga0207654_100142612 | 249 |
| 153 | 3300025911 | Ga0207654_10348150 | Ga0207654_103481502 | 249 |
| 154 | 3300025913 | Ga0207695_10000795 | Ga0207695_1000079513 | 249 |
| 155 | 3300025913 | Ga0207695_10008668 | Ga0207695_100086682 | 249 |
| 156 | 3300025914 | Ga0207671_10003696 | Ga0207671_100036969 | 249 |
| 157 | 3300025924 | Ga0207694_10236136 | Ga0207694_102361362 | 249 |
| 158 | 3300025936 | Ga0207670_10101852 | Ga0207670_101018522 | 249 |
| 159 | 3300025940 | Ga0207691_10024182 | Ga0207691_100241823 | 249 |
| 160 | 3300025942 | Ga0207689_10077247 | Ga0207689_100772473 | 249 |
| 161 | 3300025949 | Ga0207667_10066384 | Ga0207667_100663842 | 249 |
| 162 | 3300026041 | Ga0207639_10074382 | Ga0207639_100743822 | 249 |
| 163 | 3300026075 | Ga0207708_10289172 | Ga0207708_102891722 | 249 |
| 164 | 3300026078 | Ga0207702_10067002 | Ga0207702_100670022 | 249 |
| 165 | 3300026095 | Ga0207676_10289076 | Ga0207676_102890762 | 249 |
| 166 | 3300026116 | Ga0207674_10064384 | Ga0207674_100643843 | 249 |
| 167 | 3300026116 | Ga0207674_10258466 | Ga0207674_102584662 | 249 |
| 168 | 3300026118 | Ga0207675_100077885 | Ga0207675_1000778852 | 249 |
| 169 | 3300026118 | Ga0207675_100115649 | Ga0207675_1001156493 | 249 |
| 170 | 3300026118 | Ga0207675_100219553 | Ga0207675_1002195532 | 249 |
| 171 | 3300026118 | Ga0207675_100573246 | Ga0207675_1005732462 | 249 |
| 172 | 3300028379 | Ga0268266_10000065 | Ga0268266_10000065164 | 249 |
| 173 | 3300028380 | Ga0268265_10490401 | Ga0268265_104904012 | 249 |
| 174 | 3300028381 | Ga0268264_10597159 | Ga0268264_105971591 | 249 |
| 175 | 3300028381 | Ga0268264_10620699 | Ga0268264_106206991 | 249 |
| 176 | 3300031456 | Ga0307513_10094236 | Ga0307513_100942362 | 249 |
| 177 | 3300031507 | Ga0307509_10094726 | Ga0307509_100947262 | 249 |
| 178 | 3300033180 | Ga0307510_10000058 | Ga0307510_1000005825 | 249 |
| 179 | 3300037068 | Ga0373925_0561445 | Ga0373925_0561445_63_812 | 249 |
| 180 | 3300041492 | Ga0451835_0999691 | Ga0451835_0999691_85_834 | 249 |
| 181 | 3300041512 | Ga0451853_2901014 | Ga0451853_2901014_343_1134 | 249 |
| 182 | 3300041512 | Ga0451853_3109340 | Ga0451853_3109340_208_957 | 249 |
| 183 | 3300042014 | Ga0439457_001214 | Ga0439457_001214_1594_2343 | 249 |
| 184 | 3300044656 | Ga0466969_0002611 | Ga0466969_0002611_71_820 | 249 |
| 185 | 3300044658 | Ga0466972_0000096 | Ga0466972_0000096_33518_34267 | 249 |
| 186 | 3300044658 | Ga0466972_0005134 | Ga0466972_0005134_692_1450 | 249 |
| 187 | 3300044684 | Ga0466966_0001334 | Ga0466966_0001334_1434_2183 | 249 |
| 188 | 3300044693 | Ga0466961_0157074 | Ga0466961_0157074_267_1016 | 249 |
| 189 | 3300044842 | Ga0466957_0005787 | Ga0466957_0005787_1698_2447 | 249 |
| 190 | 3300045049 | Ga0466959_0000051 | Ga0466959_0000051_32090_32839 | 249 |
| 191 | 3300046460 | Ga0495638_0184930 | Ga0495638_0184930_58_807 | 249 |
| 192 | 3300046660 | Ga0495625_0142813 | Ga0495625_0142813_748_1503 | 249 |
| 193 | 3300047443 | Ga0495687_000001 | Ga0495687_000001_1079103_1079861 | 249 |
| 194 | 3300049575 | Ga0501039_0421270 | Ga0501039_0421270_94_843 | 249 |
| 195 | 3300049705 | Ga0501225_0000184 | Ga0501225_0000184_18310_19059 | 249 |
| 196 | 3300049823 | Ga0501044_0012811 | Ga0501044_0012811_1855_2604 | 249 |
| 197 | 3300050493 | nmdc:mga0k408_189530_c1 | nmdc:mga0k408_189530_c1_346_1098 | 249 |
| 198 | 3300050493 | nmdc:mga0k408_285805_c1 | nmdc:mga0k408_285805_c1_27_776 | 249 |
| 199 | 3300050493 | nmdc:mga0k408_388587_c1 | nmdc:mga0k408_388587_c1_56_805 | 249 |
| 200 | 3300050493 | nmdc:mga0k408_87264_c1 | nmdc:mga0k408_87264_c1_669_1418 | 249 |
| 201 | 3300050507 | nmdc:mga05p37_1722_c1 | nmdc:mga05p37_1722_c1_11350_12102 | 249 |
| 202 | 3300050507 | nmdc:mga05p37_9261_c1 | nmdc:mga05p37_9261_c1_5857_6606 | 249 |
| 203 | 3300050508 | nmdc:mga09592_175510_c1 | nmdc:mga09592_175510_c1_166_915 | 249 |
| 204 | 3300050509 | nmdc:mga0qj67_99190_c1 | nmdc:mga0qj67_99190_c1_438_1190 | 249 |
| 205 | 3300050510 | nmdc:mga06r32_104297_c1 | nmdc:mga06r32_104297_c1_1357_2109 | 249 |
| 206 | 3300050511 | nmdc:mga08y16_117569_c1 | nmdc:mga08y16_117569_c1_717_1466 | 249 |
| 207 | 3300053086 | Ga0500578_0000074 | Ga0500578_0000074_108433_109182 | 249 |
| 208 | 3300053086 | Ga0500578_0116087 | Ga0500578_0116087_841_1590 | 249 |
| 209 | 3300053090 | Ga0500646_0032006 | Ga0500646_0032006_158_907 | 249 |
| 210 | 3300053092 | Ga0500583_0000015 | Ga0500583_0000015_92298_93047 | 249 |
| 211 | 3300053092 | Ga0500583_0001134 | Ga0500583_0001134_1396_2145 | 249 |
| 212 | 3300053102 | Ga0500554_055826 | Ga0500554_055826_19_768 | 249 |
| 213 | 3300053131 | Ga0500652_024062 | Ga0500652_024062_1251_2000 | 249 |
| 214 | 3300053156 | Ga0500622_0011597 | Ga0500622_0011597_3799_4548 | 249 |
| 215 | 3300053156 | Ga0500622_0107066 | Ga0500622_0107066_281_1030 | 249 |
| 216 | 3300053163 | Ga0500639_136118 | Ga0500639_136118_284_1033 | 249 |
| 217 | 3300053178 | Ga0500637_0044624 | Ga0500637_0044624_176_940 | 249 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6m8o-assembly1.cif.gz_A | crystal structure of the receiver domain of lytr from staphylococcus aureus | 0.9121 | 3 | 115 |
| 2zwm-assembly1.cif.gz_B | crystal structure of yycf receiver domain from bacillus subtilis | 0.8873 | 1 | 115 |
| 4qyw-assembly1.cif.gz_A | structure of phosphono-chey from t.maritima | 0.8855 | 1 | 115 |
| 6eo3-assembly1.cif.gz_A | conformational dynamism for dna interaction in salmonella typhimurium rcsb response regulator. s207c p212121 | 0.8828 | 2 | 117 |
| 6swl-assembly2.cif.gz_B | the rec domain of xync, a response regulator from geobacillus stearothermophilus | 0.8803 | 3 | 123 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P60611_135_244_2.40.50.1020 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);LytTr DNA-binding domain | 0.9322 | 143 | 247 | 2.40.50.1020 |
| af_P0AFT5_1_126_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9138 | 1 | 116 | 3.40.50.2300 |
| 6m8oA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9121 | 3 | 115 | 3.40.50.2300 |
| af_P60611_1_129_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9043 | 3 | 123 | 3.40.50.2300 |
| af_P0AE39_136_205_2.40.50.40 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); | 0.9019 | 142 | 211 | 2.40.50.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1W9QX15-F1-model_v4 | Response regulatory domain-containing protein | 0.9685 | 1 | 108 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A7C5R727-F1-model_v4 | Response regulator transcription factor | 0.9635 | 1 | 83 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A4Q5V1A5-F1-model_v4 | Response regulator | 0.9614 | 1 | 92 |
GO:0000160
|
| AF-A0A0D8JCC1-F1-model_v4 | HTH LytTR-type domain-containing protein | 0.9524 | 142 | 247 |
GO:0000156
GO:0003677 |
| AF-A0A7T9QH55-F1-model_v4 | deleted | 0.9509 | 2 | 118 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar