F328439

General Info

Members Datasets Scaffolds Average Seq Length
217 155 215 249

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_100093459|Ga0070674_1000934592
Length 271
Sequence MDITTNLVADGSKENPNENNSMIRSIIIDDEPKNIRILRGLLEEFCPSVKVMAEANSAQDAIPLIREHQPDLLFLDIEMPFGNAFDLLDKLKPVDFEIIFITAFDEYTLKAFKYSALDYLLKPVNIDELKEAVQKAGKRIEHKNINKQLSNLFHNIKKPPTALQRIAFPDNEGVMVFIELKEISHLEAKRGYTYVYTRNKQVYISSRIIKEYEELLPEDIFFRVHNSSIINMNFIRKYHKGRGGMVEMEDGSMLEVAARRKDEFLSRFAIE

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
78 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
115 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
116 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
120 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
121 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
122 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
123 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
124 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
128 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
136 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
137 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
138 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
139 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
140 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
141 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
142 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
143 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
144 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
145 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
146 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
147 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
148 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
149 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
150 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
151 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
152 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
153 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
154 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
155 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0
Isolates 0.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.98
Nodule 0
Rhizoplane 0.46
Rhizosphere 80.18
Stem 0
Stem Tuber 0
Unclassified 7.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10074827 3300003316 Bacteria 5977
2 rootH1_10152130 3300003316 Bacteria 2921
3 rootH2_10016137 3300003320 Bacteria 3792
4 rootL2_10293693 3300003322 Bacteria 1154
5 rootH1_10034550 3300003323 Bacteria 12862
6 rootH1_10165609 3300003323 Bacteria 1483
7 rootH1_10223560 3300003323 Bacteria 2135
8 JGI25160J50197_1008727 3300003354 Bacteria 3837
9 JGI25160J50197_1012062 3300003354 Bacteria 3027
10 Ga0065712_10085468 3300005290 Bacteria 2695
11 Ga0065715_10096306 3300005293 Bacteria 3906
12 Ga0065707_10164748 3300005295 Bacteria 1522
13 Ga0070683_100051656 3300005329 Bacteria 3806
14 Ga0070690_100035300 3300005330 Bacteria 3137
15 Ga0070670_100580680 3300005331 Bacteria 1002
16 Ga0068869_100135487 3300005334 Bacteria 1897
17 Ga0070666_10007987 3300005335 Bacteria 6543
18 Ga0070666_10044875 3300005335 Bacteria 2963
19 Ga0070680_100083237 3300005336 Bacteria 2642
20 Ga0070682_100081198 3300005337 Bacteria 2099
21 Ga0068868_100045099 3300005338 Bacteria 3448
22 Ga0070660_100008134 3300005339 Bacteria 7330
23 Ga0070689_100026931 3300005340 Bacteria 4332
24 Ga0070687_100227858 3300005343 Bacteria 1145
25 Ga0070675_100087854 3300005354 Bacteria 2600
26 Ga0070675_100201558 3300005354 Bacteria 1727
27 Ga0070671_100559926 3300005355 Bacteria 986
28 Ga0070674_100093459 3300005356 Bacteria 2176
29 Ga0070673_100033988 3300005364 Bacteria 3854
30 Ga0070673_100333024 3300005364 Bacteria 1343
31 Ga0070688_100049223 3300005365 Bacteria 2622
32 Ga0070659_100002526 3300005366 Bacteria 12997
33 Ga0070701_10164997 3300005438 Bacteria 1286
34 Ga0070662_100038521 3300005457 Bacteria 3396
35 Ga0070662_100374738 3300005457 Bacteria 1170
36 Ga0070681_10704075 3300005458 Bacteria 926
37 Ga0070685_10012594 3300005466 Unclassified 4446
38 Ga0070698_100009374 3300005471 Bacteria 10499
39 Ga0070684_100004197 3300005535 Bacteria 10918
40 Ga0068853_100012180 3300005539 Bacteria 6994
41 Ga0068853_100136158 3300005539 Bacteria 2202
42 Ga0068853_100515213 3300005539 Bacteria 1130
43 Ga0070672_100025327 3300005543 Bacteria 4398
44 Ga0070704_100158472 3300005549 Bacteria 1788
45 Ga0068855_100009348 3300005563 Bacteria 11834
46 Ga0068855_100009545 3300005563 Bacteria 11719
47 Ga0070664_100192123 3300005564 Bacteria 1819
48 Ga0068857_100398673 3300005577 Bacteria 1280
49 Ga0068854_100288282 3300005578 Bacteria 1324
50 Ga0068856_100088747 3300005614 Bacteria 3075
51 Ga0068856_100113052 3300005614 Bacteria 2713
52 Ga0068852_100025052 3300005616 Bacteria 4829
53 Ga0068852_100099284 3300005616 Bacteria 2624
54 Ga0068859_100038941 3300005617 Bacteria 4768
55 Ga0068859_100809289 3300005617 Bacteria 1024
56 Ga0068864_100484336 3300005618 Bacteria 1188
57 Ga0068861_100017707 3300005719 Bacteria 5063
58 Ga0068861_100442771 3300005719 Bacteria 1162
59 Ga0068861_100848033 3300005719 Bacteria 861
60 Ga0068870_10309562 3300005840 Bacteria 1000
61 Ga0068860_100765064 3300005843 Bacteria 978
62 Ga0068862_100345068 3300005844 Bacteria 1380
63 Ga0070712_100047190 3300006175 Bacteria 2980
64 Ga0075366_10005117 3300006195 Bacteria 7092
65 Ga0075366_10023526 3300006195 Bacteria 3589
66 Ga0075366_10199360 3300006195 Bacteria 1217
67 Ga0075366_10422664 3300006195 Bacteria 821
68 Ga0097621_100046591 3300006237 Bacteria 3509
69 Ga0097621_100694921 3300006237 Bacteria 936
70 Ga0068871_100044141 3300006358 Bacteria 3583
71 Ga0075428_100006060 3300006844 Bacteria 13438
72 Ga0075430_100015995 3300006846 Bacteria 6389
73 Ga0075431_100010571 3300006847 Bacteria 9281
74 Ga0075429_100032640 3300006880 Bacteria 4525
75 Ga0075429_100094992 3300006880 Bacteria 2600
76 Ga0097620_100038941 3300006931 Bacteria 4768
77 Ga0097620_100809337 3300006931 Bacteria 1024
78 Ga0105240_10000306 3300009093 Bacteria 94696
79 Ga0105240_10004660 3300009093 Bacteria 20755
80 Ga0111539_10040228 3300009094 Bacteria 5629
81 Ga0111539_10069646 3300009094 Unclassified 4153
82 Ga0111539_10367735 3300009094 Bacteria 1674
83 Ga0114129_10008303 3300009147 Bacteria 14815
84 Ga0114129_10085972 3300009147 Bacteria 4363
85 Ga0114129_10521725 3300009147 Bacteria 1549
86 Ga0105241_10049773 3300009174 Bacteria 3192
87 Ga0105241_10226918 3300009174 Bacteria 1573
88 Ga0105242_10032044 3300009176 Bacteria 4202
89 Ga0105237_10108520 3300009545 Bacteria 2767
90 Ga0105237_10184038 3300009545 Unclassified 2089
91 Ga0105238_10003545 3300009551 Bacteria 15557
92 Ga0105238_10087653 3300009551 Bacteria 3099
93 Ga0105239_10027344 3300010375 Bacteria 6279
94 Ga0105246_10170074 3300011119 Bacteria 1668
95 Ga0105246_10377700 3300011119 Bacteria 1170
96 Ga0157373_10007761 3300013100 Bacteria 7977
97 Ga0157371_10029879 3300013102 Bacteria 3935
98 Ga0157371_10181467 3300013102 Bacteria 1505
99 Ga0157370_10184509 3300013104 Unclassified 1937
100 Ga0157369_10003221 3300013105 Bacteria 19454
101 Ga0157374_10001251 3300013296 Bacteria 21688
102 Ga0157374_10057963 3300013296 Bacteria 3619
103 Ga0157378_10012233 3300013297 Bacteria 7515
104 Ga0157378_10339015 3300013297 Unclassified 1465
105 Ga0163162_10069634 3300013306 Bacteria 3570
106 Ga0157372_10064337 3300013307 Bacteria 4115
107 Ga0157372_10109208 3300013307 Bacteria 3167
108 Ga0157375_10149671 3300013308 Bacteria 2468
109 Ga0157380_10000067 3300014326 Bacteria 58606
110 Ga0157380_10011219 3300014326 Bacteria 6469
111 Ga0157380_10096003 3300014326 Bacteria 2457
112 Ga0157380_10283472 3300014326 Unclassified 1517
113 Ga0157377_10006639 3300014745 Bacteria 5528
114 Ga0157377_10015350 3300014745 Bacteria 3917
115 Ga0209646_1000981 3300025246 Bacteria 8829
116 Ga0207426_1000023 3300025302 Bacteria 545465
117 Ga0207680_10063064 3300025903 Bacteria 2267
118 Ga0207643_10034995 3300025908 Bacteria 2815
119 Ga0207654_10014261 3300025911 Bacteria 4104
120 Ga0207654_10348150 3300025911 Bacteria 1019
121 Ga0207707_10606877 3300025912 Bacteria 926
122 Ga0207695_10000795 3300025913 Bacteria 59172
123 Ga0207695_10008668 3300025913 Bacteria 12689
124 Ga0207671_10003696 3300025914 Bacteria 15087
125 Ga0207693_10059782 3300025915 Bacteria 2985
126 Ga0207657_10000828 3300025919 Bacteria 32724
127 Ga0207649_10023836 3300025920 Bacteria 3549
128 Ga0207652_10097073 3300025921 Bacteria 2597
129 Ga0207694_10236136 3300025924 Unclassified 1493
130 Ga0207659_10085359 3300025926 Bacteria 2345
131 Ga0207706_10057079 3300025933 Bacteria 3440
132 Ga0207670_10101852 3300025936 Bacteria 2052
133 Ga0207669_10085277 3300025937 Bacteria 2038
134 Ga0207691_10024182 3300025940 Bacteria 5712
135 Ga0207689_10077247 3300025942 Bacteria 2737
136 Ga0207667_10066384 3300025949 Unclassified 3761
137 Ga0207640_10181540 3300025981 Bacteria 1578
138 Ga0207677_10052976 3300026023 Bacteria 2759
139 Ga0207639_10074382 3300026041 Unclassified 2668
140 Ga0207708_10289172 3300026075 Bacteria 1330
141 Ga0207702_10067002 3300026078 Unclassified 3080
142 Ga0207702_10209799 3300026078 Bacteria 1810
143 Ga0207641_10281240 3300026088 Bacteria 1565
144 Ga0207648_10215046 3300026089 Bacteria 1707
145 Ga0207676_10289076 3300026095 Bacteria 1492
146 Ga0207674_10064384 3300026116 Unclassified 3699
147 Ga0207674_10145949 3300026116 Bacteria 2325
148 Ga0207674_10258466 3300026116 Bacteria 1689
149 Ga0207675_100077885 3300026118 Bacteria 3106
150 Ga0207675_100115649 3300026118 Unclassified 2535
151 Ga0207675_100219553 3300026118 Bacteria 1831
152 Ga0207675_100573246 3300026118 Unclassified 1130
153 Ga0207698_10074650 3300026142 Bacteria 2706
154 Ga0268266_10000065 3300028379 Bacteria 246498
155 Ga0268265_10490401 3300028380 Bacteria 1156
156 Ga0268264_10597159 3300028381 Bacteria 1087
157 Ga0268264_10620699 3300028381 Bacteria 1067
158 Ga0265327_10001369 3300031251 Bacteria 31355
159 Ga0265327_10019685 3300031251 Unclassified 4139
160 Ga0265316_10068091 3300031344 Bacteria 2752
161 Ga0307513_10094236 3300031456 Bacteria 3040
162 Ga0307509_10094726 3300031507 Bacteria 3044
163 Ga0307516_10356697 3300031730 Unclassified 1127
164 Ga0307510_10000058 3300033180 Bacteria 85118
165 Ga0373925_0561445 3300037068 Unclassified 939
166 Ga0395905_0571490 3300037471 Bacteria 1032
167 Ga0451835_0999691 3300041492 Bacteria 861
168 Ga0451853_2901014 3300041512 Bacteria 1790
169 Ga0451853_3109340 3300041512 Bacteria 1409
170 Ga0439457_001214 3300042014 Bacteria 7761
171 Ga0439434_0046808 3300042435 Bacteria 1335
172 Ga0466969_0002611 3300044656 Bacteria 9639
173 Ga0466972_0000096 3300044658 Bacteria 77400
174 Ga0466972_0005134 3300044658 Bacteria 6555
175 Ga0466966_0001334 3300044684 Bacteria 15833
176 Ga0466961_0157074 3300044693 Bacteria 1419
177 Ga0466957_0005787 3300044842 Bacteria 6951
178 Ga0466959_0000051 3300045049 Bacteria 81799
179 Ga0466967_0240769 3300045976 Bacteria 1726
180 Ga0466967_0260619 3300045976 Bacteria 1659
181 Ga0495638_0184930 3300046460 Bacteria 1186
182 Ga0495625_0142813 3300046660 Unclassified 1614
183 Ga0495687_000001 3300047443 Bacteria 1215582
184 Ga0496115_0001597 3300048918 Bacteria 16289
185 Ga0501039_0421270 3300049575 Bacteria 1049
186 Ga0501219_000553 3300049703 Bacteria 5485
187 Ga0501225_0000184 3300049705 Bacteria 19482
188 Ga0501044_0012811 3300049823 Bacteria 9081
189 Ga0501284_00014 3300050005 Bacteria 114419
190 nmdc:mga0k408_11369_c1 3300050493 Bacteria 4846
191 nmdc:mga0k408_189530_c1 3300050493 Bacteria 1227
192 nmdc:mga0k408_285805_c1 3300050493 Bacteria 984
193 nmdc:mga0k408_388587_c1 3300050493 Bacteria 831
194 nmdc:mga0k408_87264_c1 3300050493 Bacteria 1832
195 nmdc:mga05p37_1722_c1 3300050507 Bacteria 22019
196 nmdc:mga05p37_9261_c1 3300050507 Bacteria 11640
197 nmdc:mga09592_175510_c1 3300050508 Bacteria 1853
198 nmdc:mga0qj67_99190_c1 3300050509 Bacteria 2347
199 nmdc:mga06r32_104297_c1 3300050510 Bacteria 2784
200 nmdc:mga08y16_117569_c1 3300050511 Bacteria 2767
201 nmdc:mga08y16_75806_c1 3300050511 Unclassified 3505
202 Ga0500578_0000074 3300053086 Bacteria 109442
203 Ga0500578_0116087 3300053086 Bacteria 1685
204 Ga0500646_0032006 3300053090 Unclassified 1449
205 Ga0500583_0000015 3300053092 Bacteria 147804
206 Ga0500583_0001134 3300053092 Bacteria 7609
207 Ga0500554_055826 3300053102 Bacteria 1255
208 Ga0500652_024062 3300053131 Bacteria 2321
209 Ga0500568_0001023 3300053139 Bacteria 19133
210 Ga0500616_0000044 3300053153 Bacteria 339611
211 Ga0500622_0011597 3300053156 Bacteria 4795
212 Ga0500622_0107066 3300053156 Bacteria 1370
213 Ga0500639_136118 3300053163 Bacteria 1156
214 Ga0500637_0044624 3300053178 Bacteria 2512
215 Ga0466962_0270715 3300061719 Bacteria 837

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300061719 Ga0466962_0270715 Ga0466962_0270715_123_806 221
2 3300026116 Ga0207674_10145949 Ga0207674_101459492 225
3 3300003323 rootH1_10165609 rootH1_101656092 226
4 3300005458 Ga0070681_10704075 Ga0070681_107040751 228
5 3300013102 Ga0157371_10181467 Ga0157371_101814672 228
6 3300013307 Ga0157372_10064337 Ga0157372_100643372 228
7 3300025912 Ga0207707_10606877 Ga0207707_106068771 228
8 3300031730 Ga0307516_10356697 Ga0307516_103566971 229
9 3300006175 Ga0070712_100047190 Ga0070712_1000471902 237
10 3300025915 Ga0207693_10059782 Ga0207693_100597823 237
11 3300048918 Ga0496115_0001597 Ga0496115_0001597_13179_13937 245
12 iso_pu_bacteria 2738541278 2738730929 245
13 3300005329 Ga0070683_100051656 Ga0070683_1000516562 246
14 3300005331 Ga0070670_100580680 Ga0070670_1005806801 246
15 3300005335 Ga0070666_10044875 Ga0070666_100448753 246
16 3300005336 Ga0070680_100083237 Ga0070680_1000832371 246
17 3300005337 Ga0070682_100081198 Ga0070682_1000811982 246
18 3300005338 Ga0068868_100045099 Ga0068868_1000450992 246
19 3300005339 Ga0070660_100008134 Ga0070660_1000081342 246
20 3300005354 Ga0070675_100087854 Ga0070675_1000878542 246
21 3300005355 Ga0070671_100559926 Ga0070671_1005599261 246
22 3300005364 Ga0070673_100033988 Ga0070673_1000339882 246
23 3300005366 Ga0070659_100002526 Ga0070659_1000025267 246
24 3300005457 Ga0070662_100038521 Ga0070662_1000385211 246
25 3300005535 Ga0070684_100004197 Ga0070684_1000041976 246
26 3300005539 Ga0068853_100012180 Ga0068853_1000121806 246
27 3300005563 Ga0068855_100009348 Ga0068855_1000093482 246
28 3300005564 Ga0070664_100192123 Ga0070664_1001921231 246
29 3300005578 Ga0068854_100288282 Ga0068854_1002882821 246
30 3300005614 Ga0068856_100113052 Ga0068856_1001130522 246
31 3300005616 Ga0068852_100025052 Ga0068852_1000250522 246
32 3300006237 Ga0097621_100046591 Ga0097621_1000465912 246
33 3300006358 Ga0068871_100044141 Ga0068871_1000441412 246
34 3300013100 Ga0157373_10007761 Ga0157373_100077612 246
35 3300013102 Ga0157371_10029879 Ga0157371_100298792 246
36 3300013105 Ga0157369_10003221 Ga0157369_100032212 246
37 3300013296 Ga0157374_10001251 Ga0157374_1000125111 246
38 3300013297 Ga0157378_10012233 Ga0157378_100122337 246
39 3300013306 Ga0163162_10069634 Ga0163162_100696343 246
40 3300013307 Ga0157372_10109208 Ga0157372_101092082 246
41 3300014745 Ga0157377_10015350 Ga0157377_100153503 246
42 3300025919 Ga0207657_10000828 Ga0207657_1000082825 246
43 3300025920 Ga0207649_10023836 Ga0207649_100238363 246
44 3300025921 Ga0207652_10097073 Ga0207652_100970732 246
45 3300025926 Ga0207659_10085359 Ga0207659_100853592 246
46 3300025933 Ga0207706_10057079 Ga0207706_100570791 246
47 3300025981 Ga0207640_10181540 Ga0207640_101815402 246
48 3300026023 Ga0207677_10052976 Ga0207677_100529762 246
49 3300026078 Ga0207702_10209799 Ga0207702_102097992 246
50 3300026089 Ga0207648_10215046 Ga0207648_102150462 246
51 3300026142 Ga0207698_10074650 Ga0207698_100746501 246
52 3300037471 Ga0395905_0571490 Ga0395905_0571490_104_844 246
53 3300045976 Ga0466967_0240769 Ga0466967_0240769_344_1084 246
54 3300045976 Ga0466967_0260619 Ga0466967_0260619_674_1414 246
55 3300009094 Ga0111539_10069646 Ga0111539_100696462 247
56 3300014326 Ga0157380_10000067 Ga0157380_1000006719 247
57 3300014326 Ga0157380_10283472 Ga0157380_102834722 247
58 3300025937 Ga0207669_10085277 Ga0207669_100852772 247
59 3300026088 Ga0207641_10281240 Ga0207641_102812402 247
60 3300031251 Ga0265327_10019685 Ga0265327_100196851 247
61 3300031344 Ga0265316_10068091 Ga0265316_100680912 247
62 3300049703 Ga0501219_000553 Ga0501219_000553_859_1608 247
63 3300050005 Ga0501284_00014 Ga0501284_00014_40047_40796 247
64 3300050511 nmdc:mga08y16_75806_c1 nmdc:mga08y16_75806_c1_1329_2072 247
65 3300053153 Ga0500616_0000044 Ga0500616_0000044_79152_79895 247
66 3300006195 Ga0075366_10023526 Ga0075366_100235262 248
67 3300009551 Ga0105238_10087653 Ga0105238_100876533 248
68 3300031251 Ga0265327_10001369 Ga0265327_1000136912 248
69 3300042435 Ga0439434_0046808 Ga0439434_0046808_453_1202 248
70 3300050493 nmdc:mga0k408_11369_c1 nmdc:mga0k408_11369_c1_328_1074 248
71 3300053139 Ga0500568_0001023 Ga0500568_0001023_11336_12082 248
72 3300003316 rootH1_10074827 rootH1_100748273 249
73 3300003316 rootH1_10152130 rootH1_101521302 249
74 3300003320 rootH2_10016137 rootH2_100161372 249
75 3300003322 rootL2_10293693 rootL2_102936932 249
76 3300003323 rootH1_10034550 rootH1_100345502 249
77 3300003323 rootH1_10223560 rootH1_102235604 249
78 3300003354 JGI25160J50197_1008727 JGI25160J50197_10087274 249
79 3300003354 JGI25160J50197_1012062 JGI25160J50197_10120622 249
80 3300005290 Ga0065712_10085468 Ga0065712_100854682 249
81 3300005293 Ga0065715_10096306 Ga0065715_100963061 249
82 3300005295 Ga0065707_10164748 Ga0065707_101647481 249
83 3300005330 Ga0070690_100035300 Ga0070690_1000353002 249
84 3300005334 Ga0068869_100135487 Ga0068869_1001354872 249
85 3300005335 Ga0070666_10007987 Ga0070666_100079874 249
86 3300005340 Ga0070689_100026931 Ga0070689_1000269314 249
87 3300005343 Ga0070687_100227858 Ga0070687_1002278581 249
88 3300005354 Ga0070675_100201558 Ga0070675_1002015582 249
89 3300005356 Ga0070674_100093459 Ga0070674_1000934592 249
90 3300005364 Ga0070673_100333024 Ga0070673_1003330243 249
91 3300005365 Ga0070688_100049223 Ga0070688_1000492232 249
92 3300005438 Ga0070701_10164997 Ga0070701_101649972 249
93 3300005457 Ga0070662_100374738 Ga0070662_1003747382 249
94 3300005466 Ga0070685_10012594 Ga0070685_100125945 249
95 3300005471 Ga0070698_100009374 Ga0070698_1000093745 249
96 3300005539 Ga0068853_100136158 Ga0068853_1001361582 249
97 3300005539 Ga0068853_100515213 Ga0068853_1005152131 249
98 3300005543 Ga0070672_100025327 Ga0070672_1000253273 249
99 3300005549 Ga0070704_100158472 Ga0070704_1001584721 249
100 3300005563 Ga0068855_100009545 Ga0068855_10000954510 249
101 3300005577 Ga0068857_100398673 Ga0068857_1003986732 249
102 3300005614 Ga0068856_100088747 Ga0068856_1000887472 249
103 3300005616 Ga0068852_100099284 Ga0068852_1000992842 249
104 3300005617 Ga0068859_100038941 Ga0068859_1000389412 249
105 3300005617 Ga0068859_100809289 Ga0068859_1008092892 249
106 3300005618 Ga0068864_100484336 Ga0068864_1004843362 249
107 3300005719 Ga0068861_100017707 Ga0068861_1000177074 249
108 3300005719 Ga0068861_100442771 Ga0068861_1004427712 249
109 3300005719 Ga0068861_100848033 Ga0068861_1008480331 249
110 3300005840 Ga0068870_10309562 Ga0068870_103095621 249
111 3300005843 Ga0068860_100765064 Ga0068860_1007650642 249
112 3300005844 Ga0068862_100345068 Ga0068862_1003450682 249
113 3300006195 Ga0075366_10005117 Ga0075366_100051172 249
114 3300006195 Ga0075366_10199360 Ga0075366_101993601 249
115 3300006195 Ga0075366_10422664 Ga0075366_104226641 249
116 3300006237 Ga0097621_100694921 Ga0097621_1006949211 249
117 3300006844 Ga0075428_100006060 Ga0075428_1000060607 249
118 3300006846 Ga0075430_100015995 Ga0075430_1000159954 249
119 3300006847 Ga0075431_100010571 Ga0075431_1000105712 249
120 3300006880 Ga0075429_100032640 Ga0075429_1000326402 249
121 3300006880 Ga0075429_100094992 Ga0075429_1000949922 249
122 3300006931 Ga0097620_100038941 Ga0097620_1000389412 249
123 3300006931 Ga0097620_100809337 Ga0097620_1008093372 249
124 3300009093 Ga0105240_10000306 Ga0105240_100003062 249
125 3300009093 Ga0105240_10004660 Ga0105240_100046606 249
126 3300009094 Ga0111539_10040228 Ga0111539_100402282 249
127 3300009094 Ga0111539_10367735 Ga0111539_103677352 249
128 3300009147 Ga0114129_10008303 Ga0114129_100083037 249
129 3300009147 Ga0114129_10085972 Ga0114129_100859722 249
130 3300009147 Ga0114129_10521725 Ga0114129_105217251 249
131 3300009174 Ga0105241_10049773 Ga0105241_100497732 249
132 3300009174 Ga0105241_10226918 Ga0105241_102269182 249
133 3300009176 Ga0105242_10032044 Ga0105242_100320442 249
134 3300009545 Ga0105237_10108520 Ga0105237_101085202 249
135 3300009545 Ga0105237_10184038 Ga0105237_101840382 249
136 3300009551 Ga0105238_10003545 Ga0105238_100035453 249
137 3300010375 Ga0105239_10027344 Ga0105239_100273446 249
138 3300011119 Ga0105246_10170074 Ga0105246_101700742 249
139 3300011119 Ga0105246_10377700 Ga0105246_103777001 249
140 3300013104 Ga0157370_10184509 Ga0157370_101845091 249
141 3300013296 Ga0157374_10057963 Ga0157374_100579633 249
142 3300013297 Ga0157378_10339015 Ga0157378_103390152 249
143 3300013308 Ga0157375_10149671 Ga0157375_101496712 249
144 3300014326 Ga0157380_10011219 Ga0157380_100112193 249
145 3300014326 Ga0157380_10096003 Ga0157380_100960032 249
146 3300014745 Ga0157377_10006639 Ga0157377_100066393 249
147 3300025246 Ga0209646_1000981 Ga0209646_10009813 249
148 3300025302 Ga0207426_1000023 Ga0207426_1000023177 249
149 3300025302 Ga0207426_1000023 Ga0207426_1000023179 249
150 3300025903 Ga0207680_10063064 Ga0207680_100630642 249
151 3300025908 Ga0207643_10034995 Ga0207643_100349951 249
152 3300025911 Ga0207654_10014261 Ga0207654_100142612 249
153 3300025911 Ga0207654_10348150 Ga0207654_103481502 249
154 3300025913 Ga0207695_10000795 Ga0207695_1000079513 249
155 3300025913 Ga0207695_10008668 Ga0207695_100086682 249
156 3300025914 Ga0207671_10003696 Ga0207671_100036969 249
157 3300025924 Ga0207694_10236136 Ga0207694_102361362 249
158 3300025936 Ga0207670_10101852 Ga0207670_101018522 249
159 3300025940 Ga0207691_10024182 Ga0207691_100241823 249
160 3300025942 Ga0207689_10077247 Ga0207689_100772473 249
161 3300025949 Ga0207667_10066384 Ga0207667_100663842 249
162 3300026041 Ga0207639_10074382 Ga0207639_100743822 249
163 3300026075 Ga0207708_10289172 Ga0207708_102891722 249
164 3300026078 Ga0207702_10067002 Ga0207702_100670022 249
165 3300026095 Ga0207676_10289076 Ga0207676_102890762 249
166 3300026116 Ga0207674_10064384 Ga0207674_100643843 249
167 3300026116 Ga0207674_10258466 Ga0207674_102584662 249
168 3300026118 Ga0207675_100077885 Ga0207675_1000778852 249
169 3300026118 Ga0207675_100115649 Ga0207675_1001156493 249
170 3300026118 Ga0207675_100219553 Ga0207675_1002195532 249
171 3300026118 Ga0207675_100573246 Ga0207675_1005732462 249
172 3300028379 Ga0268266_10000065 Ga0268266_10000065164 249
173 3300028380 Ga0268265_10490401 Ga0268265_104904012 249
174 3300028381 Ga0268264_10597159 Ga0268264_105971591 249
175 3300028381 Ga0268264_10620699 Ga0268264_106206991 249
176 3300031456 Ga0307513_10094236 Ga0307513_100942362 249
177 3300031507 Ga0307509_10094726 Ga0307509_100947262 249
178 3300033180 Ga0307510_10000058 Ga0307510_1000005825 249
179 3300037068 Ga0373925_0561445 Ga0373925_0561445_63_812 249
180 3300041492 Ga0451835_0999691 Ga0451835_0999691_85_834 249
181 3300041512 Ga0451853_2901014 Ga0451853_2901014_343_1134 249
182 3300041512 Ga0451853_3109340 Ga0451853_3109340_208_957 249
183 3300042014 Ga0439457_001214 Ga0439457_001214_1594_2343 249
184 3300044656 Ga0466969_0002611 Ga0466969_0002611_71_820 249
185 3300044658 Ga0466972_0000096 Ga0466972_0000096_33518_34267 249
186 3300044658 Ga0466972_0005134 Ga0466972_0005134_692_1450 249
187 3300044684 Ga0466966_0001334 Ga0466966_0001334_1434_2183 249
188 3300044693 Ga0466961_0157074 Ga0466961_0157074_267_1016 249
189 3300044842 Ga0466957_0005787 Ga0466957_0005787_1698_2447 249
190 3300045049 Ga0466959_0000051 Ga0466959_0000051_32090_32839 249
191 3300046460 Ga0495638_0184930 Ga0495638_0184930_58_807 249
192 3300046660 Ga0495625_0142813 Ga0495625_0142813_748_1503 249
193 3300047443 Ga0495687_000001 Ga0495687_000001_1079103_1079861 249
194 3300049575 Ga0501039_0421270 Ga0501039_0421270_94_843 249
195 3300049705 Ga0501225_0000184 Ga0501225_0000184_18310_19059 249
196 3300049823 Ga0501044_0012811 Ga0501044_0012811_1855_2604 249
197 3300050493 nmdc:mga0k408_189530_c1 nmdc:mga0k408_189530_c1_346_1098 249
198 3300050493 nmdc:mga0k408_285805_c1 nmdc:mga0k408_285805_c1_27_776 249
199 3300050493 nmdc:mga0k408_388587_c1 nmdc:mga0k408_388587_c1_56_805 249
200 3300050493 nmdc:mga0k408_87264_c1 nmdc:mga0k408_87264_c1_669_1418 249
201 3300050507 nmdc:mga05p37_1722_c1 nmdc:mga05p37_1722_c1_11350_12102 249
202 3300050507 nmdc:mga05p37_9261_c1 nmdc:mga05p37_9261_c1_5857_6606 249
203 3300050508 nmdc:mga09592_175510_c1 nmdc:mga09592_175510_c1_166_915 249
204 3300050509 nmdc:mga0qj67_99190_c1 nmdc:mga0qj67_99190_c1_438_1190 249
205 3300050510 nmdc:mga06r32_104297_c1 nmdc:mga06r32_104297_c1_1357_2109 249
206 3300050511 nmdc:mga08y16_117569_c1 nmdc:mga08y16_117569_c1_717_1466 249
207 3300053086 Ga0500578_0000074 Ga0500578_0000074_108433_109182 249
208 3300053086 Ga0500578_0116087 Ga0500578_0116087_841_1590 249
209 3300053090 Ga0500646_0032006 Ga0500646_0032006_158_907 249
210 3300053092 Ga0500583_0000015 Ga0500583_0000015_92298_93047 249
211 3300053092 Ga0500583_0001134 Ga0500583_0001134_1396_2145 249
212 3300053102 Ga0500554_055826 Ga0500554_055826_19_768 249
213 3300053131 Ga0500652_024062 Ga0500652_024062_1251_2000 249
214 3300053156 Ga0500622_0011597 Ga0500622_0011597_3799_4548 249
215 3300053156 Ga0500622_0107066 Ga0500622_0107066_281_1030 249
216 3300053163 Ga0500639_136118 Ga0500639_136118_284_1033 249
217 3300053178 Ga0500637_0044624 Ga0500637_0044624_176_940 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

26

134

0.94

PF04397

LytTR

LytTr DNA-binding domain

173

269

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m8o-assembly1.cif.gz_A crystal structure of the receiver domain of lytr from staphylococcus aureus 0.9121 3 115
2zwm-assembly1.cif.gz_B crystal structure of yycf receiver domain from bacillus subtilis 0.8873 1 115
4qyw-assembly1.cif.gz_A structure of phosphono-chey from t.maritima 0.8855 1 115
6eo3-assembly1.cif.gz_A conformational dynamism for dna interaction in salmonella typhimurium rcsb response regulator. s207c p212121 0.8828 2 117
6swl-assembly2.cif.gz_B the rec domain of xync, a response regulator from geobacillus stearothermophilus 0.8803 3 123
ID Description Score Start End Superfamily
af_P60611_135_244_2.40.50.1020 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);LytTr DNA-binding domain 0.9322 143 247 2.40.50.1020
af_P0AFT5_1_126_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9138 1 116 3.40.50.2300
6m8oA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9121 3 115 3.40.50.2300
af_P60611_1_129_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9043 3 123 3.40.50.2300
af_P0AE39_136_205_2.40.50.40 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.9019 142 211 2.40.50.40
ID Description Score Start End GO Terms
AF-A0A1W9QX15-F1-model_v4 Response regulatory domain-containing protein 0.9685 1 108 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A7C5R727-F1-model_v4 Response regulator transcription factor 0.9635 1 83 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A4Q5V1A5-F1-model_v4 Response regulator 0.9614 1 92 GO:0000160
AF-A0A0D8JCC1-F1-model_v4 HTH LytTR-type domain-containing protein 0.9524 142 247 GO:0000156
GO:0003677
AF-A0A7T9QH55-F1-model_v4 deleted 0.9509 2 118

Feature Viewer

pLDDT pTM Quality
81.58 0.5 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map