F328200

General Info

Members Datasets Scaffolds Average Seq Length
216 125 432 182

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2855386786|2855390601
Length 210
Sequence PYDATGPLLGAVLEEGRGSLPFALIHGEALVTCAAWALGEAGVSPVDLGPDRTALAELAELAARAETAGTDGTGGETDPQRPFVLHDSLCPMTPAGFVAECVAHAERTGEVVVGTRPVTDTVKQTADGRVGETVDRDQLLAVASPVVLPAPVLAVLHRSGAVAELPVADLAALVPWLRERFAVALVTAPSEGRRVASEDDVRLLEALTSR

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
3 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
4 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
7 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
8 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
9 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
10 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
11 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
12 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
14 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
15 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
16 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
17 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
18 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
19 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
20 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
21 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
22 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
23 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
24 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
25 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
26 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
27 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
28 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
29 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
30 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
48 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
49 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
50 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
51 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
52 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
53 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
54 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
55 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
56 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
57 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
58 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
59 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
60 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
61 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
62 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
63 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
64 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
65 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
66 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
67 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
68 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
69 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
70 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
71 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
72 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
73 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
74 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
75 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
76 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
77 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
78 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
79 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
97 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
98 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
99 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
100 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
101 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
102 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
103 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
104 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
105 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
106 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
108 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
109 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
110 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
111 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
112 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
113 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
114 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
115 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
116 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
117 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
118 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
119 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
120 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
121 2643221615 Nocardioides sp. Root224 Isolate Unclassified
122 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
123 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
124 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
125 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 95.83
Metatranscriptomes 1.39
Isolates 2.78

Biome Distribution

Category Percentage (%)
Aerial Root 0.93
Bulb 0
Endosphere 22.22
Nodule 0
Rhizoplane 0.46
Rhizosphere 72.69
Stem 0
Stem Tuber 0
Unclassified 0.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100869514 3300005329 Bacteria 865
2 Ga0070660_100106412 3300005339 Bacteria 2228
3 Ga0070660_100430736 3300005339 Bacteria 1093
4 Ga0070660_100726019 3300005339 Bacteria 834
5 Ga0070687_100173998 3300005343 Bacteria 1284
6 Ga0070687_100390346 3300005343 Bacteria 910
7 Ga0070692_10621276 3300005345 Bacteria 718
8 Ga0070667_100109904 3300005367 Bacteria 2390
9 Ga0070667_100207213 3300005367 Bacteria 1742
10 Ga0070663_100057395 3300005455 Bacteria 2793
11 Ga0070665_100762772 3300005548 Bacteria 980
12 Ga0070664_100023565 3300005564 Bacteria 5085
13 Ga0068864_101271141 3300005618 Bacteria 736
14 Ga0068861_100213425 3300005719 Bacteria 1627
15 Ga0068860_100000539 3300005843 Bacteria 46099
16 Ga0081539_10039929 3300005985 Bacteria 2762
17 Ga0075365_10019537 3300006038 Bacteria 4184
18 Ga0075365_10027245 3300006038 Bacteria 3634
19 Ga0075365_10063820 3300006038 Bacteria 2466
20 Ga0075365_10067380 3300006038 Bacteria 2403
21 Ga0075365_10074456 3300006038 Bacteria 2290
22 Ga0075365_10097038 3300006038 Bacteria 2014
23 Ga0075365_10117320 3300006038 Bacteria 1833
24 Ga0075365_10157660 3300006038 Bacteria 1580
25 Ga0075365_10203473 3300006038 Bacteria 1387
26 Ga0075365_10380620 3300006038 Bacteria 996
27 Ga0075363_100007511 3300006048 Bacteria 5019
28 Ga0075363_100101401 3300006048 Bacteria 1593
29 Ga0075363_100414412 3300006048 Bacteria 793
30 Ga0075364_10033877 3300006051 Bacteria 3291
31 Ga0075364_10123482 3300006051 Bacteria 1734
32 Ga0075364_10148656 3300006051 Bacteria 1578
33 Ga0075364_10177621 3300006051 Bacteria 1440
34 Ga0075364_10213298 3300006051 Bacteria 1309
35 Ga0075367_10110329 3300006178 Bacteria 1688
36 Ga0075367_10119933 3300006178 Bacteria 1620
37 Ga0075370_10016850 3300006353 Bacteria 3939
38 Ga0075370_10094873 3300006353 Bacteria 1723
39 Ga0075370_10269473 3300006353 Bacteria 1011
40 Ga0068865_100110714 3300006881 Bacteria 2026
41 Ga0105243_10635396 3300009148 Bacteria 1033
42 Ga0105241_10229707 3300009174 Bacteria 1563
43 Ga0105237_10080736 3300009545 Bacteria 3242
44 Ga0105237_10918442 3300009545 Bacteria 882
45 Ga0105238_10573829 3300009551 Bacteria 1134
46 Ga0105249_10754377 3300009553 Bacteria 1035
47 Ga0105239_10108290 3300010375 Bacteria 3079
48 Ga0105246_10386985 3300011119 Bacteria 1157
49 Ga0163163_10236089 3300014325 Bacteria 1878
50 Ga0163163_10399903 3300014325 Bacteria 1432
51 Ga0157377_10056375 3300014745 Bacteria 2231
52 Ga0163161_10008550 3300017792 Bacteria 7080
53 Ga0163161_10049495 3300017792 Bacteria 3038
54 Ga0206353_10511385 3300020082 Bacteria 1335
55 Ga0207688_10349288 3300025901 Bacteria 911
56 Ga0207671_10100253 3300025914 Bacteria 2193
57 Ga0207662_10114267 3300025918 Bacteria 1687
58 Ga0207657_10020546 3300025919 Bacteria 6238
59 Ga0207690_10549541 3300025932 Bacteria 939
60 Ga0207706_10324891 3300025933 Bacteria 1339
61 Ga0207670_10374756 3300025936 Bacteria 1132
62 Ga0207704_10286152 3300025938 Bacteria 1255
63 Ga0207691_10183858 3300025940 Bacteria 1825
64 Ga0207712_10555354 3300025961 Bacteria 988
65 Ga0207668_10917730 3300025972 Bacteria 780
66 Ga0207658_10428799 3300025986 Bacteria 1167
67 Ga0207678_10325669 3300026067 Bacteria 1322
68 Ga0207708_10017225 3300026075 Bacteria 5438
69 Ga0207676_10859367 3300026095 Bacteria 888
70 Ga0207675_100013494 3300026118 Bacteria 7623
71 Ga0207675_100108685 3300026118 Bacteria 2616
72 Ga0268264_10000195 3300028381 Bacteria 123899
73 Ga0307515_10487855 3300028794 Bacteria 844
74 Ga0307413_10085659 3300031824 Bacteria 2035
75 Ga0307406_10082621 3300031901 Bacteria 2140
76 Ga0307406_10330063 3300031901 Bacteria 1184
77 Ga0307406_10447070 3300031901 Bacteria 1036
78 Ga0307407_10173856 3300031903 Bacteria 1421
79 Ga0307407_10199801 3300031903 Bacteria 1339
80 Ga0307412_10264091 3300031911 Bacteria 1344
81 Ga0307412_10489999 3300031911 Bacteria 1021
82 Ga0307409_100091612 3300031995 Bacteria 2492
83 Ga0307409_100158358 3300031995 Bacteria 1977
84 Ga0307409_100576061 3300031995 Bacteria 1109
85 Ga0307409_101828240 3300031995 Bacteria 637
86 Ga0307416_100081917 3300032002 Bacteria 2731
87 Ga0307416_100224363 3300032002 Bacteria 1805
88 Ga0307416_100493953 3300032002 Bacteria 1287
89 Ga0307416_100881707 3300032002 Bacteria 994
90 Ga0307416_101419945 3300032002 Bacteria 800
91 Ga0307414_10055971 3300032004 Bacteria 2764
92 Ga0307411_10192625 3300032005 Bacteria 1558
93 Ga0307415_100018929 3300032126 Bacteria 4170
94 Ga0307415_100060671 3300032126 Bacteria 2615
95 Ga0395899_0030932 3300037312 Bacteria 4025
96 Ga0395900_0034203 3300037418 Bacteria 5233
97 Ga0395898_0122353 3300037466 Bacteria 2493
98 Ga0395898_0523909 3300037466 Bacteria 1127
99 Ga0395905_0084938 3300037471 Bacteria 2966
100 Ga0395905_1220551 3300037471 Bacteria 656
101 Ga0436364_0622343 3300037853 Bacteria 1214
102 Ga0395901_0052558 3300038443 Bacteria 4234
103 Ga0451837_0611985 3300041494 Bacteria 1104
104 Ga0451853_3900292 3300041512 Bacteria 1552
105 Ga0466969_0029653 3300044656 Bacteria 2793
106 Ga0466972_0027222 3300044658 Bacteria 2829
107 Ga0466972_0036269 3300044658 Bacteria 2413
108 Ga0466965_0010398 3300044683 Bacteria 4339
109 Ga0466965_0158841 3300044683 Bacteria 1185
110 Ga0466961_0002887 3300044693 Bacteria 10658
111 Ga0466961_0034866 3300044693 Bacteria 3231
112 Ga0466961_0422815 3300044693 Bacteria 807
113 Ga0466971_0006231 3300044719 Bacteria 5185
114 Ga0466971_0117187 3300044719 Bacteria 1231
115 Ga0466968_0286137 3300044735 Bacteria 790
116 Ga0466970_0009522 3300044765 Bacteria 4912
117 Ga0466970_0018070 3300044765 Bacteria 3650
118 Ga0466970_0043597 3300044765 Bacteria 2387
119 Ga0466970_0078259 3300044765 Bacteria 1784
120 Ga0466970_0117659 3300044765 Bacteria 1454
121 Ga0466970_0521979 3300044765 Bacteria 685
122 Ga0466957_0812835 3300044842 Bacteria 665
123 Ga0466960_0002664 3300044901 Bacteria 6736
124 Ga0466960_0186695 3300044901 Bacteria 1126
125 Ga0466967_0026902 3300045976 Bacteria 4775
126 Ga0466967_0026946 3300045976 Bacteria 4772
127 Ga0466967_0088712 3300045976 Bacteria 2807
128 Ga0466967_0216305 3300045976 Bacteria 1819
129 Ga0495629_0571708 3300046459 Bacteria 757
130 Ga0495620_0156754 3300046515 Bacteria 886
131 Ga0495674_0283505 3300047319 Bacteria 1357
132 Ga0496105_0377277 3300048908 Bacteria 1129
133 Ga0501307_040157 3300049162 Bacteria 677
134 Ga0501321_036975 3300049537 Bacteria 674
135 Ga0501031_0098376 3300049568 Bacteria 1909
136 Ga0501032_0039158 3300049569 Bacteria 3225
137 Ga0501032_0089877 3300049569 Bacteria 2038
138 Ga0501033_0005797 3300049570 Bacteria 9720
139 Ga0501033_0074844 3300049570 Bacteria 2486
140 Ga0501033_0355108 3300049570 Bacteria 1026
141 Ga0501034_0003893 3300049571 Bacteria 16796
142 Ga0501036_0005037 3300049572 Bacteria 10692
143 Ga0501036_0061246 3300049572 Bacteria 3188
144 Ga0501036_0075921 3300049572 Bacteria 2842
145 Ga0501036_0527577 3300049572 Bacteria 982
146 Ga0501037_0009581 3300049573 Bacteria 7107
147 Ga0501037_0030258 3300049573 Bacteria 4002
148 Ga0501038_0001756 3300049574 Bacteria 20144
149 Ga0501038_0055099 3300049574 Bacteria 3417
150 Ga0501038_0148301 3300049574 Bacteria 1914
151 Ga0501039_0019902 3300049575 Bacteria 5145
152 Ga0501039_0074397 3300049575 Bacteria 2640
153 Ga0501040_0312383 3300049576 Bacteria 1124
154 Ga0501041_0181044 3300049577 Bacteria 1319
155 Ga0501042_0007600 3300049578 Bacteria 7111
156 Ga0501043_0007532 3300049579 Bacteria 8639
157 Ga0501043_0140259 3300049579 Bacteria 1893
158 Ga0501043_0419257 3300049579 Bacteria 1009
159 Ga0501046_0002283 3300049580 Bacteria 18080
160 Ga0501047_0031093 3300049581 Bacteria 5148
161 Ga0501047_0070222 3300049581 Bacteria 3372
162 Ga0501048_0013330 3300049582 Bacteria 6099
163 Ga0501048_0146831 3300049582 Bacteria 1668
164 Ga0501067_0157630 3300049583 Bacteria 1264
165 Ga0501067_0169255 3300049583 Bacteria 1217
166 Ga0501068_0327807 3300049584 Bacteria 982
167 Ga0501068_0450328 3300049584 Bacteria 833
168 Ga0501069_0008195 3300049585 Bacteria 5488
169 Ga0501070_0146969 3300049586 Bacteria 1945
170 Ga0501070_0291354 3300049586 Bacteria 1330
171 Ga0501070_0323103 3300049586 Bacteria 1255
172 Ga0501070_0692349 3300049586 Bacteria 806
173 Ga0501072_0407442 3300049588 Bacteria 1078
174 Ga0501072_0548019 3300049588 Bacteria 913
175 Ga0501072_1132004 3300049588 Unclassified 609
176 Ga0501073_0033082 3300049589 Bacteria 3684
177 Ga0501075_0350411 3300049591 Bacteria 1125
178 Ga0501076_0286862 3300049592 Bacteria 1349
179 Ga0501243_056830 3300049675 Bacteria 718
180 Ga0501081_0636341 3300049743 Bacteria 799
181 Ga0501035_0002737 3300049822 Bacteria 17089
182 Ga0501035_0212095 3300049822 Bacteria 1656
183 Ga0501044_0014844 3300049823 Bacteria 8395
184 nmdc:mga03n38_76444_c1 3300050490 Bacteria 1562
185 nmdc:mga00v17_144494_c1 3300050491 Bacteria 1527
186 nmdc:mga00v17_165340_c1 3300050491 Bacteria 1425
187 nmdc:mga00v17_58611_c1 3300050491 Bacteria 2360
188 nmdc:mga0yw44_111762_c1 3300050492 Bacteria 1752
189 nmdc:mga0yw44_129298_c1 3300050492 Bacteria 1633
190 nmdc:mga0yw44_271231_c1 3300050492 Bacteria 1133
191 nmdc:mga0yw44_303704_c1 3300050492 Bacteria 1070
192 nmdc:mga0yw44_408736_c1 3300050492 Bacteria 918
193 nmdc:mga0yw44_410098_c1 3300050492 Bacteria 917
194 nmdc:mga0yw44_480305_c1 3300050492 Bacteria 843
195 nmdc:mga0yw44_58514_c1 3300050492 Bacteria 2355
196 nmdc:mga0yw44_83070_c1 3300050492 Bacteria 2011
197 nmdc:mga0yw44_90427_c1 3300050492 Bacteria 1934
198 nmdc:mga06z11_116681_c1 3300050494 Bacteria 1484
199 nmdc:mga06z11_35108_c1 3300050494 Bacteria 2466
200 nmdc:mga06z11_72232_c1 3300050494 Bacteria 1829
201 nmdc:mga07m45_16475_c1 3300050496 Bacteria 3957
202 nmdc:mga07m45_16827_c1 3300050496 Bacteria 3918
203 nmdc:mga07m45_187980_c1 3300050496 Bacteria 1201
204 Ga0500644_0037674 3300053088 Bacteria 1582
205 Ga0500554_008607 3300053102 Bacteria 2407
206 Ga0500556_0000769 3300053104 Bacteria 19005
207 Ga0500593_000522 3300053117 Bacteria 15114
208 Ga0500573_0272906 3300053140 Bacteria 860
209 Ga0501084_0472570 3300054114 Bacteria 1060
210 Ga0466962_0035676 3300061719 Bacteria 2380
211 2855390601 2855386786 Bacteria 4752232
212 2644090931 2643221615 Bacteria 5487866
213 2644320734 2643221657 Bacteria 5490246
214 2857485922 2857481737 Bacteria 4761446
215 2984579379 2984576629 Bacteria 4248407
216 2990256989 2990256926 Bacteria 4252839
217 Ga0070683_100869514
218 Ga0070660_100106412
219 Ga0070660_100430736
220 Ga0070660_100726019
221 Ga0070687_100173998
222 Ga0070687_100390346
223 Ga0070692_10621276
224 Ga0070667_100109904
225 Ga0070667_100207213
226 Ga0070663_100057395
227 Ga0070665_100762772
228 Ga0070664_100023565
229 Ga0068864_101271141
230 Ga0068861_100213425
231 Ga0068860_100000539
232 Ga0081539_10039929
233 Ga0075365_10019537
234 Ga0075365_10027245
235 Ga0075365_10063820
236 Ga0075365_10067380
237 Ga0075365_10074456
238 Ga0075365_10097038
239 Ga0075365_10117320
240 Ga0075365_10157660
241 Ga0075365_10203473
242 Ga0075365_10380620
243 Ga0075363_100007511
244 Ga0075363_100101401
245 Ga0075363_100414412
246 Ga0075364_10033877
247 Ga0075364_10123482
248 Ga0075364_10148656
249 Ga0075364_10177621
250 Ga0075364_10213298
251 Ga0075367_10110329
252 Ga0075367_10119933
253 Ga0075370_10016850
254 Ga0075370_10094873
255 Ga0075370_10269473
256 Ga0068865_100110714
257 Ga0105243_10635396
258 Ga0105241_10229707
259 Ga0105237_10080736
260 Ga0105237_10918442
261 Ga0105238_10573829
262 Ga0105249_10754377
263 Ga0105239_10108290
264 Ga0105246_10386985
265 Ga0163163_10236089
266 Ga0163163_10399903
267 Ga0157377_10056375
268 Ga0163161_10008550
269 Ga0163161_10049495
270 Ga0206353_10511385
271 Ga0207688_10349288
272 Ga0207671_10100253
273 Ga0207662_10114267
274 Ga0207657_10020546
275 Ga0207690_10549541
276 Ga0207706_10324891
277 Ga0207670_10374756
278 Ga0207704_10286152
279 Ga0207691_10183858
280 Ga0207712_10555354
281 Ga0207668_10917730
282 Ga0207658_10428799
283 Ga0207678_10325669
284 Ga0207708_10017225
285 Ga0207676_10859367
286 Ga0207675_100013494
287 Ga0207675_100108685
288 Ga0268264_10000195
289 Ga0307515_10487855
290 Ga0307413_10085659
291 Ga0307406_10082621
292 Ga0307406_10330063
293 Ga0307406_10447070
294 Ga0307407_10173856
295 Ga0307407_10199801
296 Ga0307412_10264091
297 Ga0307412_10489999
298 Ga0307409_100091612
299 Ga0307409_100158358
300 Ga0307409_100576061
301 Ga0307409_101828240
302 Ga0307416_100081917
303 Ga0307416_100224363
304 Ga0307416_100493953
305 Ga0307416_100881707
306 Ga0307416_101419945
307 Ga0307414_10055971
308 Ga0307411_10192625
309 Ga0307415_100018929
310 Ga0307415_100060671
311 Ga0395899_0030932
312 Ga0395900_0034203
313 Ga0395898_0122353
314 Ga0395898_0523909
315 Ga0395905_0084938
316 Ga0395905_1220551
317 Ga0436364_0622343
318 Ga0395901_0052558
319 Ga0451837_0611985
320 Ga0451853_3900292
321 Ga0466969_0029653
322 Ga0466972_0027222
323 Ga0466972_0036269
324 Ga0466965_0010398
325 Ga0466965_0158841
326 Ga0466961_0002887
327 Ga0466961_0034866
328 Ga0466961_0422815
329 Ga0466971_0006231
330 Ga0466971_0117187
331 Ga0466968_0286137
332 Ga0466970_0009522
333 Ga0466970_0018070
334 Ga0466970_0043597
335 Ga0466970_0078259
336 Ga0466970_0117659
337 Ga0466970_0521979
338 Ga0466957_0812835
339 Ga0466960_0002664
340 Ga0466960_0186695
341 Ga0466967_0026902
342 Ga0466967_0026946
343 Ga0466967_0088712
344 Ga0466967_0216305
345 Ga0495629_0571708
346 Ga0495620_0156754
347 Ga0495674_0283505
348 Ga0496105_0377277
349 Ga0501307_040157
350 Ga0501321_036975
351 Ga0501031_0098376
352 Ga0501032_0039158
353 Ga0501032_0089877
354 Ga0501033_0005797
355 Ga0501033_0074844
356 Ga0501033_0355108
357 Ga0501034_0003893
358 Ga0501036_0005037
359 Ga0501036_0061246
360 Ga0501036_0075921
361 Ga0501036_0527577
362 Ga0501037_0009581
363 Ga0501037_0030258
364 Ga0501038_0001756
365 Ga0501038_0055099
366 Ga0501038_0148301
367 Ga0501039_0019902
368 Ga0501039_0074397
369 Ga0501040_0312383
370 Ga0501041_0181044
371 Ga0501042_0007600
372 Ga0501043_0007532
373 Ga0501043_0140259
374 Ga0501043_0419257
375 Ga0501046_0002283
376 Ga0501047_0031093
377 Ga0501047_0070222
378 Ga0501048_0013330
379 Ga0501048_0146831
380 Ga0501067_0157630
381 Ga0501067_0169255
382 Ga0501068_0327807
383 Ga0501068_0450328
384 Ga0501069_0008195
385 Ga0501070_0146969
386 Ga0501070_0291354
387 Ga0501070_0323103
388 Ga0501070_0692349
389 Ga0501072_0407442
390 Ga0501072_0548019
391 Ga0501072_1132004
392 Ga0501073_0033082
393 Ga0501075_0350411
394 Ga0501076_0286862
395 Ga0501243_056830
396 Ga0501081_0636341
397 Ga0501035_0002737
398 Ga0501035_0212095
399 Ga0501044_0014844
400 nmdc:mga03n38_76444_c1
401 nmdc:mga00v17_144494_c1
402 nmdc:mga00v17_165340_c1
403 nmdc:mga00v17_58611_c1
404 nmdc:mga0yw44_111762_c1
405 nmdc:mga0yw44_129298_c1
406 nmdc:mga0yw44_271231_c1
407 nmdc:mga0yw44_303704_c1
408 nmdc:mga0yw44_408736_c1
409 nmdc:mga0yw44_410098_c1
410 nmdc:mga0yw44_480305_c1
411 nmdc:mga0yw44_58514_c1
412 nmdc:mga0yw44_83070_c1
413 nmdc:mga0yw44_90427_c1
414 nmdc:mga06z11_116681_c1
415 nmdc:mga06z11_35108_c1
416 nmdc:mga06z11_72232_c1
417 nmdc:mga07m45_16475_c1
418 nmdc:mga07m45_16827_c1
419 nmdc:mga07m45_187980_c1
420 Ga0500644_0037674
421 Ga0500554_008607
422 Ga0500556_0000769
423 Ga0500593_000522
424 Ga0500573_0272906
425 Ga0501084_0472570
426 Ga0466962_0035676
427 2855390601
428 2644090931
429 2644320734
430 2857485922
431 2984579379
432 2990256989

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01128

IspD

2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase

75

210

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xwm-assembly1.cif.gz_A crystal structure of ispd from mycobacterium smegmatis in complex with cmp 0.7617 19 163
1vpa-assembly1.cif.gz_B crystal structure of 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase (tm1393) from thermotoga maritima at 2.67 a resolution 0.7613 41 164
2xwn-assembly1.cif.gz_B crystal structure of ispd from mycobacterium tuberculosis in complex with ctp and mg 0.7484 19 163
6xhr-assembly3.cif.gz_E crystal structure of s. aureus tari (space group p1211) 0.7475 50 164
6xhp-assembly1.cif.gz_A crystal structure of s. aureus tari (space group c121) 0.7444 50 164
ID Description Score Start End Superfamily
1vpaB00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7613 41 164 3.90.550.10
af_A0JPF9_66_301_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7478 49 164 3.90.550.10
3okrA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7299 19 163 3.90.550.10
5ddvA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7269 41 164 3.90.550.10
2px7B00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7193 43 163 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A6J4LY34-F1-model_v4 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 0.9574 22 164 GO:0070567
AF-A0A316TM40-F1-model_v4 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 0.9254 1 164
AF-A0A1A9GLD3-F1-model_v4 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 0.9238 4 164 GO:0016779
AF-A0A316TM40-F1-model_v4 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 0.9146 1 164
AF-A0A6J7HHZ0-F1-model_v4 Unannotated protein 0.9142 46 164 GO:0070567

Map