F328151

General Info

Members Datasets Scaffolds Average Seq Length
216 156 432 92

Family's Representative Sequence

Representative Sequence 3300060353|Ga0501082_0940988|Ga0501082_0940988_10_333
Length 107
Sequence VANDRSALRLRDDEATPASAMVAVALPAALVRLFPGAERRLELPASTVGEMIDALDSRWPGMRDRLCDSRPAIRRHINVFVEGRRATLDTRLAPGAEVTVLTAISGG

Samples

Sample ID Description Type Environment
1 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
80 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
81 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
82 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
83 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
84 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
85 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
86 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
87 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
88 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
91 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
92 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
97 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
98 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
99 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
100 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
101 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
104 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
105 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
106 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
107 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
108 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
109 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
110 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
111 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
112 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
113 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
114 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
128 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
129 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
130 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
131 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
132 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
133 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
134 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
135 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
136 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
137 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
138 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
140 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
141 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
142 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
143 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
144 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
145 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
146 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
147 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
148 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
149 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
150 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
151 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
152 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
153 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
154 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
155 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
156 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.3
Metatranscriptomes 2.31
Isolates 1.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.24
Nodule 0.46
Rhizoplane 3.7
Rhizosphere 86.11
Stem 0
Stem Tuber 0
Unclassified 18.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501082_0940988 3300060353 Bacteria 756
2 Ga0070683_100669786 3300005329 Bacteria 993
3 Ga0070682_100026512 3300005337 Bacteria 3470
4 Ga0070660_100123015 3300005339 Unclassified 2071
5 Ga0070692_10001832 3300005345 Bacteria 7969
6 Ga0070692_11150434 3300005345 Bacteria 550
7 Ga0070668_100678172 3300005347 Bacteria 907
8 Ga0070673_100576910 3300005364 Bacteria 1024
9 Ga0070714_100000036 3300005435 Bacteria 126916
10 Ga0070705_100186498 3300005440 Bacteria 1410
11 Ga0070708_101036541 3300005445 Bacteria 769
12 Ga0070708_101148294 3300005445 Bacteria 727
13 Ga0070663_100546099 3300005455 Bacteria 968
14 Ga0070681_10116269 3300005458 Unclassified 2612
15 Ga0068867_100980797 3300005459 Bacteria 765
16 Ga0070679_101045339 3300005530 Bacteria 761
17 Ga0070697_100278027 3300005536 Unclassified 1436
18 Ga0070704_101405838 3300005549 Unclassified 640
19 Ga0068855_101546448 3300005563 Bacteria 680
20 Ga0070664_101651701 3300005564 Unclassified 607
21 Ga0068856_100184444 3300005614 Unclassified 2100
22 Ga0068864_100538655 3300005618 Unclassified 1127
23 Ga0068861_102083245 3300005719 Unclassified 567
24 Ga0068870_10764608 3300005840 Unclassified 672
25 Ga0081455_10979054 3300005937 Bacteria 524
26 Ga0081538_10011883 3300005981 Bacteria 7028
27 Ga0081538_10148692 3300005981 Bacteria 1065
28 Ga0075428_100156576 3300006844 Bacteria 2475
29 Ga0075430_100055738 3300006846 Bacteria 3324
30 Ga0075430_100152098 3300006846 Bacteria 1927
31 Ga0075431_100029132 3300006847 Bacteria 5680
32 Ga0075433_10622223 3300006852 Bacteria 947
33 Ga0075429_100189355 3300006880 Bacteria 1803
34 Ga0111539_10845347 3300009094 Bacteria 1065
35 Ga0111539_11142878 3300009094 Bacteria 905
36 Ga0105245_10291775 3300009098 Bacteria 1598
37 Ga0105247_10570191 3300009101 Bacteria 835
38 Ga0114129_10043742 3300009147 Bacteria 6301
39 Ga0114129_10176288 3300009147 Bacteria 2912
40 Ga0114129_11847821 3300009147 Bacteria 734
41 Ga0105243_10175570 3300009148 Bacteria 1859
42 Ga0105243_10585164 3300009148 Unclassified 1072
43 Ga0105243_11063044 3300009148 Unclassified 816
44 Ga0105242_10511479 3300009176 Bacteria 1144
45 Ga0105248_11334675 3300009177 Bacteria 811
46 Ga0105238_10846771 3300009551 Bacteria 931
47 Ga0105238_12707871 3300009551 Bacteria 532
48 Ga0105249_12205042 3300009553 Unclassified 624
49 Ga0105239_10833172 3300010375 Bacteria 1057
50 Ga0105246_10704723 3300011119 Unclassified 885
51 Ga0157369_10002142 3300013105 Bacteria 23816
52 Ga0157374_12034500 3300013296 Bacteria 601
53 Ga0157378_11411221 3300013297 Unclassified 739
54 Ga0157372_10791045 3300013307 Unclassified 1102
55 Ga0157375_12356924 3300013308 Bacteria 635
56 Ga0157380_12041883 3300014326 Bacteria 635
57 Ga0182008_10119660 3300014497 Unclassified 1308
58 Ga0182008_10522501 3300014497 Bacteria 656
59 Ga0157379_10852871 3300014968 Bacteria 862
60 Ga0163161_12019194 3300017792 Unclassified 513
61 Ga0197907_10492529 3300020069 Unclassified 627
62 Ga0206356_11574989 3300020070 Bacteria 2416
63 Ga0206350_11185107 3300020080 Unclassified 759
64 Ga0206354_10629611 3300020081 Bacteria 1232
65 Ga0206353_10495701 3300020082 Bacteria 2625
66 Ga0213872_10001414 3300021361 Bacteria 15752
67 Ga0213872_10080386 3300021361 Bacteria 1465
68 Ga0213872_10106915 3300021361 Bacteria 1244
69 Ga0213875_10009574 3300021388 Bacteria 4899
70 Ga0213871_10319333 3300021441 Unclassified 504
71 Ga0207688_10531126 3300025901 Bacteria 738
72 Ga0207643_10535365 3300025908 Bacteria 751
73 Ga0207707_10678774 3300025912 Bacteria 866
74 Ga0207695_11749481 3300025913 Unclassified 503
75 Ga0207657_10101424 3300025919 Unclassified 2389
76 Ga0207694_11215015 3300025924 Bacteria 638
77 Ga0207700_10619570 3300025928 Bacteria 964
78 Ga0207664_10000025 3300025929 Bacteria 196804
79 Ga0207664_11159794 3300025929 Bacteria 690
80 Ga0207690_11154825 3300025932 Bacteria 646
81 Ga0207706_10787637 3300025933 Unclassified 808
82 Ga0207709_10323967 3300025935 Unclassified 1154
83 Ga0207669_10028372 3300025937 Bacteria 3079
84 Ga0207704_11113818 3300025938 Bacteria 671
85 Ga0207711_11650756 3300025941 Bacteria 584
86 Ga0207661_10365442 3300025944 Bacteria 1304
87 Ga0207661_10839356 3300025944 Bacteria 846
88 Ga0207667_11582499 3300025949 Bacteria 624
89 Ga0207668_12100912 3300025972 Unclassified 509
90 Ga0207677_10139076 3300026023 Unclassified 1856
91 Ga0207678_10239745 3300026067 Bacteria 1553
92 Ga0207678_11547111 3300026067 Unclassified 585
93 Ga0207676_10320556 3300026095 Bacteria 1423
94 Ga0268265_12067132 3300028380 Bacteria 577
95 Ga0265319_1027424 3300028563 Bacteria 2021
96 Ga0265319_1034801 3300028563 Bacteria 1731
97 Ga0265330_10030885 3300031235 Bacteria 2402
98 Ga0265328_10023712 3300031239 Bacteria 2325
99 Ga0265320_10041151 3300031240 Bacteria 2299
100 Ga0265325_10100504 3300031241 Bacteria 1416
101 Ga0265340_10290997 3300031247 Bacteria 725
102 Ga0265340_10402185 3300031247 Bacteria 604
103 Ga0265339_10004217 3300031249 Bacteria 9844
104 Ga0265339_10422865 3300031249 Bacteria 621
105 Ga0265313_10103501 3300031595 Bacteria 1261
106 Ga0265314_10089398 3300031711 Bacteria 2009
107 Ga0265342_10067661 3300031712 Bacteria 2090
108 Ga0307413_11832842 3300031824 Bacteria 544
109 Ga0373948_0221651 3300034817 Unclassified 501
110 Ga0316574_0404463 3300035398 Bacteria 859
111 Ga0373931_0141147 3300035691 Bacteria 1395
112 Ga0395899_0506240 3300037312 Bacteria 783
113 Ga0436364_0829074 3300037853 Bacteria 694
114 Ga0436364_1074949 3300037853 Bacteria 10367
115 Ga0436364_1106604 3300037853 Bacteria 48807
116 Ga0436364_1462168 3300037853 Bacteria 2146
117 Ga0436364_1550406 3300037853 Bacteria 519
118 Ga0436365_1555885 3300039437 Bacteria 734
119 Ga0436365_1876975 3300039437 Bacteria 2377
120 Ga0436360_0542702 3300039438 Bacteria 1955
121 Ga0436360_0809820 3300039438 Bacteria 805
122 Ga0436360_0879708 3300039438 Unclassified 721
123 Ga0436360_0899253 3300039438 Bacteria 1580
124 Ga0436360_0941675 3300039438 Bacteria 1394
125 Ga0436361_0192302 3300039447 Bacteria 8591
126 Ga0436361_0228882 3300039447 Bacteria 1429
127 Ga0436361_0325771 3300039447 Bacteria 3378
128 Ga0436361_1139630 3300039447 Bacteria 1854
129 Ga0436361_1210897 3300039447 Bacteria 7624
130 Ga0436363_1164335 3300039450 Unclassified 582
131 Ga0451839_1205901 3300041496 Unclassified 561
132 Ga0466965_0076424 3300044683 Bacteria 1690
133 Ga0466960_0338002 3300044901 Bacteria 856
134 Ga0466967_2170362 3300045976 Bacteria 551
135 Ga0495631_0377202 3300046518 Bacteria 604
136 Ga0495621_0085712 3300046539 Bacteria 1181
137 Ga0496102_0195539 3300048905 Unclassified 1906
138 Ga0496107_0839952 3300048910 Bacteria 671
139 Ga0496109_0558979 3300048912 Bacteria 1079
140 Ga0496110_1565834 3300048913 Unclassified 569
141 Ga0496112_0004509 3300048915 Bacteria 11819
142 Ga0496112_0031012 3300048915 Bacteria 5180
143 Ga0496112_0340356 3300048915 Unclassified 1443
144 Ga0496113_0884898 3300048916 Bacteria 707
145 Ga0496119_0000416 3300048922 Bacteria 58592
146 Ga0496122_0001164 3300048925 Bacteria 44969
147 Ga0496123_0003355 3300048926 Bacteria 18119
148 Ga0501031_0018657 3300049568 Bacteria 4518
149 Ga0501031_0675516 3300049568 Bacteria 663
150 Ga0501033_0071013 3300049570 Bacteria 2558
151 Ga0501033_0422542 3300049570 Unclassified 928
152 Ga0501036_0097487 3300049572 Bacteria 2485
153 Ga0501036_0903042 3300049572 Unclassified 725
154 Ga0501037_0008381 3300049573 Bacteria 7580
155 Ga0501037_0489441 3300049573 Bacteria 835
156 Ga0501038_0033270 3300049574 Bacteria 4542
157 Ga0501038_0166136 3300049574 Bacteria 1790
158 Ga0501039_0051700 3300049575 Bacteria 3179
159 Ga0501039_0465988 3300049575 Bacteria 992
160 Ga0501040_0078461 3300049576 Bacteria 2285
161 Ga0501040_0122483 3300049576 Bacteria 1825
162 Ga0501041_0064466 3300049577 Bacteria 2244
163 Ga0501042_0887994 3300049578 Unclassified 649
164 Ga0501043_0204698 3300049579 Bacteria 1531
165 Ga0501043_0766968 3300049579 Bacteria 700
166 Ga0501046_0127309 3300049580 Bacteria 1934
167 Ga0501046_0535708 3300049580 Bacteria 836
168 Ga0501047_0025863 3300049581 Bacteria 5644
169 Ga0501047_0187383 3300049581 Bacteria 1934
170 Ga0501048_0083155 3300049582 Bacteria 2257
171 Ga0501048_0370019 3300049582 Bacteria 1023
172 Ga0501068_0085711 3300049584 Bacteria 1939
173 Ga0501069_0489496 3300049585 Unclassified 733
174 Ga0501069_0908811 3300049585 Bacteria 536
175 Ga0501070_0711558 3300049586 Bacteria 794
176 Ga0501071_0040712 3300049587 Bacteria 3326
177 Ga0501074_0553123 3300049590 Bacteria 815
178 Ga0501075_0022448 3300049591 Bacteria 4610
179 Ga0501076_0087955 3300049592 Bacteria 2497
180 Ga0501077_0447700 3300049593 Bacteria 827
181 Ga0501079_0031994 3300049741 Bacteria 4043
182 Ga0501079_0072519 3300049741 Bacteria 2661
183 Ga0501080_0059964 3300049742 Bacteria 3541
184 Ga0501080_0221597 3300049742 Bacteria 1731
185 Ga0501081_0107039 3300049743 Bacteria 1983
186 Ga0501081_0571630 3300049743 Unclassified 845
187 Ga0501035_0059407 3300049822 Bacteria 3405
188 Ga0501035_0924289 3300049822 Bacteria 690
189 Ga0501045_0071793 3300049824 Bacteria 2548
190 Ga0501045_0503053 3300049824 Bacteria 900
191 Ga0501045_0629815 3300049824 Bacteria 793
192 Ga0501045_0725770 3300049824 Bacteria 733
193 nmdc:mga05p37_227556_c1 3300050507 Bacteria 2248
194 nmdc:mga05p37_87082_c1 3300050507 Bacteria 3849
195 nmdc:mga09592_441261_c1 3300050508 Bacteria 1123
196 nmdc:mga09592_441419_c1 3300050508 Bacteria 1123
197 nmdc:mga0qj67_1389554_c1 3300050509 Unclassified 542
198 nmdc:mga0qj67_703360_c1 3300050509 Bacteria 804
199 nmdc:mga06r32_81725_c1 3300050510 Bacteria 3147
200 nmdc:mga08y16_450224_c1 3300050511 Bacteria 1313
201 nmdc:mga0sz30_228680_c1 3300050516 Bacteria 827
202 Ga0500610_0203717 3300053079 Bacteria 951
203 Ga0500556_0000176 3300053104 Bacteria 52698
204 Ga0500592_034120 3300053116 Bacteria 821
205 Ga0500568_0000054 3300053139 Bacteria 111105
206 Ga0500627_0028394 3300053158 Bacteria 2324
207 Ga0500645_022504 3300053730 Bacteria 1937
208 Ga0501084_0965587 3300054114 Unclassified 716
209 Ga0501082_0081843 3300060353 Bacteria 2786
210 Ga0501082_0118959 3300060353 Bacteria 2289
211 Ga0501082_0533108 3300060353 Bacteria 1027
212 Ga0530510_0082012 3300061734 Bacteria 2348
213 Ga0530510_0087612 3300061734 Bacteria 2268
214 2523104870 2522572158 Bacteria 6514390
215 2874128253 2874123672 Bacteria 7238285
216 2894775463 2894772417 Bacteria 5305674
217 Ga0501082_0940988
218 Ga0070683_100669786
219 Ga0070682_100026512
220 Ga0070660_100123015
221 Ga0070692_10001832
222 Ga0070692_11150434
223 Ga0070668_100678172
224 Ga0070673_100576910
225 Ga0070714_100000036
226 Ga0070705_100186498
227 Ga0070708_101036541
228 Ga0070708_101148294
229 Ga0070663_100546099
230 Ga0070681_10116269
231 Ga0068867_100980797
232 Ga0070679_101045339
233 Ga0070697_100278027
234 Ga0070704_101405838
235 Ga0068855_101546448
236 Ga0070664_101651701
237 Ga0068856_100184444
238 Ga0068864_100538655
239 Ga0068861_102083245
240 Ga0068870_10764608
241 Ga0081455_10979054
242 Ga0081538_10011883
243 Ga0081538_10148692
244 Ga0075428_100156576
245 Ga0075430_100055738
246 Ga0075430_100152098
247 Ga0075431_100029132
248 Ga0075433_10622223
249 Ga0075429_100189355
250 Ga0111539_10845347
251 Ga0111539_11142878
252 Ga0105245_10291775
253 Ga0105247_10570191
254 Ga0114129_10043742
255 Ga0114129_10176288
256 Ga0114129_11847821
257 Ga0105243_10175570
258 Ga0105243_10585164
259 Ga0105243_11063044
260 Ga0105242_10511479
261 Ga0105248_11334675
262 Ga0105238_10846771
263 Ga0105238_12707871
264 Ga0105249_12205042
265 Ga0105239_10833172
266 Ga0105246_10704723
267 Ga0157369_10002142
268 Ga0157374_12034500
269 Ga0157378_11411221
270 Ga0157372_10791045
271 Ga0157375_12356924
272 Ga0157380_12041883
273 Ga0182008_10119660
274 Ga0182008_10522501
275 Ga0157379_10852871
276 Ga0163161_12019194
277 Ga0197907_10492529
278 Ga0206356_11574989
279 Ga0206350_11185107
280 Ga0206354_10629611
281 Ga0206353_10495701
282 Ga0213872_10001414
283 Ga0213872_10080386
284 Ga0213872_10106915
285 Ga0213875_10009574
286 Ga0213871_10319333
287 Ga0207688_10531126
288 Ga0207643_10535365
289 Ga0207707_10678774
290 Ga0207695_11749481
291 Ga0207657_10101424
292 Ga0207694_11215015
293 Ga0207700_10619570
294 Ga0207664_10000025
295 Ga0207664_11159794
296 Ga0207690_11154825
297 Ga0207706_10787637
298 Ga0207709_10323967
299 Ga0207669_10028372
300 Ga0207704_11113818
301 Ga0207711_11650756
302 Ga0207661_10365442
303 Ga0207661_10839356
304 Ga0207667_11582499
305 Ga0207668_12100912
306 Ga0207677_10139076
307 Ga0207678_10239745
308 Ga0207678_11547111
309 Ga0207676_10320556
310 Ga0268265_12067132
311 Ga0265319_1027424
312 Ga0265319_1034801
313 Ga0265330_10030885
314 Ga0265328_10023712
315 Ga0265320_10041151
316 Ga0265325_10100504
317 Ga0265340_10290997
318 Ga0265340_10402185
319 Ga0265339_10004217
320 Ga0265339_10422865
321 Ga0265313_10103501
322 Ga0265314_10089398
323 Ga0265342_10067661
324 Ga0307413_11832842
325 Ga0373948_0221651
326 Ga0316574_0404463
327 Ga0373931_0141147
328 Ga0395899_0506240
329 Ga0436364_0829074
330 Ga0436364_1074949
331 Ga0436364_1106604
332 Ga0436364_1462168
333 Ga0436364_1550406
334 Ga0436365_1555885
335 Ga0436365_1876975
336 Ga0436360_0542702
337 Ga0436360_0809820
338 Ga0436360_0879708
339 Ga0436360_0899253
340 Ga0436360_0941675
341 Ga0436361_0192302
342 Ga0436361_0228882
343 Ga0436361_0325771
344 Ga0436361_1139630
345 Ga0436361_1210897
346 Ga0436363_1164335
347 Ga0451839_1205901
348 Ga0466965_0076424
349 Ga0466960_0338002
350 Ga0466967_2170362
351 Ga0495631_0377202
352 Ga0495621_0085712
353 Ga0496102_0195539
354 Ga0496107_0839952
355 Ga0496109_0558979
356 Ga0496110_1565834
357 Ga0496112_0004509
358 Ga0496112_0031012
359 Ga0496112_0340356
360 Ga0496113_0884898
361 Ga0496119_0000416
362 Ga0496122_0001164
363 Ga0496123_0003355
364 Ga0501031_0018657
365 Ga0501031_0675516
366 Ga0501033_0071013
367 Ga0501033_0422542
368 Ga0501036_0097487
369 Ga0501036_0903042
370 Ga0501037_0008381
371 Ga0501037_0489441
372 Ga0501038_0033270
373 Ga0501038_0166136
374 Ga0501039_0051700
375 Ga0501039_0465988
376 Ga0501040_0078461
377 Ga0501040_0122483
378 Ga0501041_0064466
379 Ga0501042_0887994
380 Ga0501043_0204698
381 Ga0501043_0766968
382 Ga0501046_0127309
383 Ga0501046_0535708
384 Ga0501047_0025863
385 Ga0501047_0187383
386 Ga0501048_0083155
387 Ga0501048_0370019
388 Ga0501068_0085711
389 Ga0501069_0489496
390 Ga0501069_0908811
391 Ga0501070_0711558
392 Ga0501071_0040712
393 Ga0501074_0553123
394 Ga0501075_0022448
395 Ga0501076_0087955
396 Ga0501077_0447700
397 Ga0501079_0031994
398 Ga0501079_0072519
399 Ga0501080_0059964
400 Ga0501080_0221597
401 Ga0501081_0107039
402 Ga0501081_0571630
403 Ga0501035_0059407
404 Ga0501035_0924289
405 Ga0501045_0071793
406 Ga0501045_0503053
407 Ga0501045_0629815
408 Ga0501045_0725770
409 nmdc:mga05p37_227556_c1
410 nmdc:mga05p37_87082_c1
411 nmdc:mga09592_441261_c1
412 nmdc:mga09592_441419_c1
413 nmdc:mga0qj67_1389554_c1
414 nmdc:mga0qj67_703360_c1
415 nmdc:mga06r32_81725_c1
416 nmdc:mga08y16_450224_c1
417 nmdc:mga0sz30_228680_c1
418 Ga0500610_0203717
419 Ga0500556_0000176
420 Ga0500592_034120
421 Ga0500568_0000054
422 Ga0500627_0028394
423 Ga0500645_022504
424 Ga0501084_0965587
425 Ga0501082_0081843
426 Ga0501082_0118959
427 Ga0501082_0533108
428 Ga0530510_0082012
429 Ga0530510_0087612
430 2523104870
431 2874128253
432 2894775463

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02597

ThiS

ThiS family

24

107

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dwm-assembly2.cif.gz_B crystal structure of mycobacterium tuberculosis cyso, an antigen 0.8938 1 84
4n6e-assembly1.cif.gz_B-2 crystal structure of amycolatopsis orientalis bexx/cyso complex 0.8631 1 87
3dwm-assembly2.cif.gz_B crystal structure of mycobacterium tuberculosis cyso, an antigen 0.8558 1 84
4n6e-assembly1.cif.gz_B-2 crystal structure of amycolatopsis orientalis bexx/cyso complex 0.854 1 87
1v8c-assembly3.cif.gz_B crystal structure of moad related protein from thermus thermophilus hb8 0.8297 3 82
ID Description Score Start End Superfamily
4n6eB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8631 1 87 3.10.20.30
4n6eB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.854 1 87 3.10.20.30
1v8cB01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8297 3 82 3.10.20.30
1v8cB01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.7947 3 82 3.10.20.30
4hroA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.7743 2 84 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A529I7N5-F1-model_v4 MoaD/ThiS family protein 0.9848 2 75
AF-A0A0A0D3P6-F1-model_v4 Thiamine biosynthesis protein ThiS 0.9814 3 73
AF-A0A5S9PX83-F1-model_v4 Sulfur carrier protein CysO 0.9772 2 87
AF-A0A838BEK8-F1-model_v4 MoaD/ThiS family protein 0.976 2 87
AF-A0A429YQW8-F1-model_v4 MoaD/ThiS family protein 0.976 2 87

Map