F327799

General Info

Members Datasets Scaffolds Average Seq Length
216 107 216 330

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0024385|Ga0373937_0024385_370_1440
Length 356
Sequence MTEITMPMGRHLREHPALKYLFFGGKGGVGKTVFAAASAIGLARQGRRTLLASTNPVHSLTTLLGQDVLGKHVPVEGVPNLWAYEIETKETIERSKLQIREKIRWFLKFADITTKADDFVETATMNPAFEESAMFENMIDLMFKDEYDVYVFDTAPTANARRLLGMSKVYALWVNKMMKSREEAKTLREMLSFTKKKEADPLMEYLVSFRDRMEHARVLLTDPKLTAFYFVTLPEALPIAVVTRFIQWFKDFGIPVGGVLVNMVIDPASLGPDSAEFVKNRVAMQQEHMRTIWREFDDSVRAIVPLFETEVRGVPMLLRLCDAIFAADGAKPARADRASPPISAKTSSEPAQTAIR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
5 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
15 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
17 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
18 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
19 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
20 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
21 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
22 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
23 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
24 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
27 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
31 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
32 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
33 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
34 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
35 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
36 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
37 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
38 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
39 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
40 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
41 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
42 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
43 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
44 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
45 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
46 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
47 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
48 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
49 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
50 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
51 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
52 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
53 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
54 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
55 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
56 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
57 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
58 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
59 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
60 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
61 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
62 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
63 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
64 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
65 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
66 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
67 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
68 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
69 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
70 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
71 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
72 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
73 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
74 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
75 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
76 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
77 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
78 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
89 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
90 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
91 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
92 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
93 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
94 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
95 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
96 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
97 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
99 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
100 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
101 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
102 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
103 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
104 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
105 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
106 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
107 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 97.69
Stem 0
Stem Tuber 0
Unclassified 2.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3911405 2162886007 Bacteria 9093
2 Ga0065704_10070289 3300005289 Bacteria 38686
3 Ga0065707_10000555 3300005295 Bacteria 20615
4 Ga0065707_10008679 3300005295 Unclassified 2356
5 Ga0070705_100035093 3300005440 Bacteria 2809
6 Ga0070708_100303417 3300005445 Bacteria 1503
7 Ga0070708_100618147 3300005445 Bacteria 1021
8 Ga0070681_10061250 3300005458 Bacteria 3739
9 Ga0070706_100013484 3300005467 Bacteria 7560
10 Ga0070706_100016638 3300005467 Bacteria 6794
11 Ga0070706_100084202 3300005467 Bacteria 2946
12 Ga0070706_100187357 3300005467 Bacteria 1933
13 Ga0070706_100382778 3300005467 Unclassified 1310
14 Ga0070707_100036710 3300005468 Bacteria 4677
15 Ga0070707_100074955 3300005468 Bacteria 3263
16 Ga0070707_100142564 3300005468 Bacteria 2332
17 Ga0070707_100493914 3300005468 Bacteria 1185
18 Ga0070699_100008124 3300005518 Bacteria 9113
19 Ga0070699_100067787 3300005518 Bacteria 3099
20 Ga0070679_100022317 3300005530 Bacteria 6186
21 Ga0070697_100018716 3300005536 Bacteria 5465
22 Ga0068855_100296851 3300005563 Bacteria 1790
23 Ga0081455_10000242 3300005937 Bacteria 70917
24 Ga0081538_10011083 3300005981 Bacteria 7330
25 Ga0081539_10000773 3300005985 Bacteria 62951
26 Ga0081539_10013558 3300005985 Bacteria 6130
27 Ga0075427_10003243 3300006194 Unclassified 2232
28 Ga0075428_100067908 3300006844 Unclassified 3901
29 Ga0075430_100035338 3300006846 Bacteria 4239
30 Ga0075430_100233005 3300006846 Unclassified 1527
31 Ga0075431_100011494 3300006847 Bacteria 8924
32 Ga0075431_100022387 3300006847 Bacteria 6459
33 Ga0075431_100213876 3300006847 Bacteria 1968
34 Ga0075431_100264788 3300006847 Unclassified 1744
35 Ga0075433_10002324 3300006852 Bacteria 14477
36 Ga0075433_10079177 3300006852 Bacteria 2896
37 Ga0075434_100004042 3300006871 Bacteria 13154
38 Ga0075434_100333123 3300006871 Bacteria 1538
39 Ga0075429_100007462 3300006880 Bacteria 9488
40 Ga0075429_100013479 3300006880 Bacteria 7091
41 Ga0075429_100029382 3300006880 Bacteria 4775
42 Ga0075429_100040255 3300006880 Bacteria 4068
43 Ga0075436_100082511 3300006914 Bacteria 2230
44 Ga0099794_10003406 3300007265 Bacteria 6057
45 Ga0114129_10000477 3300009147 Bacteria 48281
46 Ga0114129_10047500 3300009147 Bacteria 6031
47 Ga0114129_10099959 3300009147 Unclassified 4014
48 Ga0114129_10130040 3300009147 Unclassified 3459
49 Ga0114129_10215606 3300009147 Unclassified 2592
50 Ga0114129_10223032 3300009147 Bacteria 2542
51 Ga0114129_10268613 3300009147 Unclassified 2283
52 Ga0114129_10370344 3300009147 Bacteria 1894
53 Ga0105246_10022165 3300011119 Unclassified 4097
54 Ga0207684_10013558 3300025910 Bacteria 7047
55 Ga0207684_10079534 3300025910 Bacteria 2789
56 Ga0207684_10309028 3300025910 Unclassified 1363
57 Ga0207652_10042107 3300025921 Bacteria 3885
58 Ga0207646_10001400 3300025922 Bacteria 29935
59 Ga0207646_10028076 3300025922 Bacteria 5126
60 Ga0207646_10038840 3300025922 Bacteria 4285
61 Ga0207646_10138458 3300025922 Bacteria 2192
62 Ga0265338_10217646 3300028800 Bacteria 1429
63 Ga0265325_10004232 3300031241 Bacteria 9109
64 Ga0265339_10024813 3300031249 Unclassified 3450
65 Ga0265313_10001269 3300031595 Bacteria 23978
66 Ga0316575_10013932 3300031665 Bacteria 3013
67 Ga0316579_10006471 3300031691 Bacteria 4784
68 Ga0316576_10067151 3300031727 Bacteria 2640
69 Ga0316576_10126618 3300031727 Bacteria 1920
70 Ga0316577_10000137 3300031733 Bacteria 21827
71 Ga0316577_10002798 3300031733 Bacteria 8708
72 Ga0316577_10007751 3300031733 Bacteria 5735
73 Ga0316577_10012616 3300031733 Bacteria 4606
74 Ga0316577_10023603 3300031733 Bacteria 3415
75 Ga0316577_10134391 3300031733 Bacteria 1392
76 Ga0316577_10151174 3300031733 Bacteria 1309
77 Ga0307416_100067281 3300032002 Unclassified 2954
78 Ga0373934_0000839 3300035086 Bacteria 11089
79 Ga0373923_0023836 3300035111 Bacteria 2411
80 Ga0373936_0057976 3300035113 Bacteria 1576
81 Ga0373939_0059396 3300035114 Bacteria 1213
82 Ga0373953_0000258 3300035117 Bacteria 14391
83 Ga0373954_0001945 3300035118 Bacteria 8563
84 Ga0373956_0000359 3300035119 Bacteria 18534
85 Ga0373956_0005213 3300035119 Bacteria 5204
86 Ga0373955_0002553 3300035172 Bacteria 7968
87 Ga0373955_0009789 3300035172 Bacteria 4505
88 Ga0316574_0332537 3300035398 Unclassified 963
89 Ga0373924_0007395 3300035410 Bacteria 3965
90 Ga0373933_0001775 3300035724 Bacteria 12481
91 Ga0373933_0082217 3300035724 Bacteria 1976
92 Ga0373937_0005712 3300036401 Bacteria 10684
93 Ga0373937_0012533 3300036401 Bacteria 7459
94 Ga0373937_0024385 3300036401 Bacteria 5456
95 Ga0316582_0000286 3300036647 Bacteria 17365
96 Ga0316582_0000632 3300036647 Bacteria 13740
97 Ga0316582_0085307 3300036647 Bacteria 2069
98 Ga0316582_0099809 3300036647 Bacteria 1921
99 Ga0316582_0112979 3300036647 Bacteria 1810
100 Ga0316584_0000326 3300036712 Bacteria 24446
101 Ga0316584_0009541 3300036712 Bacteria 6743
102 Ga0316584_0024436 3300036712 Bacteria 4422
103 Ga0316584_0029818 3300036712 Bacteria 4028
104 Ga0316584_0032039 3300036712 Bacteria 3889
105 Ga0316584_0158599 3300036712 Bacteria 1682
106 Ga0316584_0335561 3300036712 Bacteria 1088
107 Ga0395899_0173760 3300037312 Bacteria 1516
108 Ga0395900_0017115 3300037418 Bacteria 7401
109 Ga0395905_0025584 3300037471 Bacteria 5566
110 Ga0395905_0244843 3300037471 Bacteria 1675
111 Ga0316581_0007093 3300037588 Bacteria 2991
112 Ga0395901_0019976 3300038443 Bacteria 6854
113 Ga0395901_0200331 3300038443 Bacteria 2093
114 Ga0395901_0300182 3300038443 Bacteria 1665
115 Ga0400489_19263 3300039093 Bacteria 1868
116 Ga0400489_40883 3300039093 Bacteria 59595
117 Ga0400489_54119 3300039093 Bacteria 13306
118 Ga0400489_82935 3300039093 Bacteria 1892
119 Ga0400489_88261 3300039093 Bacteria 2585
120 Ga0436360_1222303 3300039438 Bacteria 1357
121 Ga0436362_0847214 3300039453 Bacteria 1722
122 Ga0439431_0048501 3300041997 Bacteria 1097
123 Ga0451577_0168306 3300042876 Unclassified 1975
124 Ga0453683_0013367 3300044673 Bacteria 5362
125 Ga0453683_0289266 3300044673 Bacteria 1047
126 Ga0453684_0000003 3300044712 Bacteria 1481694
127 Ga0453684_0002081 3300044712 Bacteria 50801
128 Ga0453684_0004826 3300044712 Bacteria 27696
129 Ga0453684_0007920 3300044712 Bacteria 19275
130 Ga0453684_0015260 3300044712 Bacteria 12181
131 Ga0453684_0045648 3300044712 Bacteria 5840
132 Ga0451576_0000230 3300045051 Bacteria 136200
133 Ga0451576_0002433 3300045051 Bacteria 27823
134 Ga0451576_0097845 3300045051 Bacteria 3051
135 Ga0451576_0160449 3300045051 Bacteria 2346
136 Ga0495592_0229022 3300046454 Bacteria 1238
137 Ga0495651_0003245 3300046462 Bacteria 12475
138 Ga0495580_0069302 3300046472 Unclassified 2465
139 Ga0495608_0007088 3300046511 Bacteria 7931
140 Ga0495618_0001773 3300046514 Bacteria 14300
141 Ga0495630_0001920 3300046517 Bacteria 14488
142 Ga0495640_0041609 3300046533 Bacteria 3210
143 Ga0495667_0003968 3300046559 Bacteria 9932
144 Ga0495657_0095060 3300046675 Bacteria 1905
145 Ga0495613_0044798 3300046689 Bacteria 3272
146 Ga0495604_0002129 3300047317 Bacteria 15923
147 Ga0495684_0004274 3300047471 Bacteria 11145
148 Ga0501037_0067354 3300049573 Bacteria 2607
149 Ga0501038_0020092 3300049574 Bacteria 6010
150 Ga0501039_0003993 3300049575 Bacteria 11095
151 Ga0501040_0012324 3300049576 Bacteria 5601
152 Ga0501040_0024649 3300049576 Bacteria 4039
153 Ga0501040_0045850 3300049576 Bacteria 2983
154 Ga0501040_0058653 3300049576 Bacteria 2643
155 Ga0501041_0005239 3300049577 Bacteria 7574
156 Ga0501041_0024982 3300049577 Bacteria 3589
157 Ga0501042_0283787 3300049578 Bacteria 1196
158 Ga0501043_0025452 3300049579 Bacteria 4644
159 Ga0501046_0038950 3300049580 Bacteria 3810
160 Ga0501046_0064775 3300049580 Bacteria 2852
161 Ga0501046_0072312 3300049580 Bacteria 2678
162 Ga0501047_0264836 3300049581 Bacteria 1566
163 Ga0501048_0054306 3300049582 Bacteria 2846
164 Ga0501071_0142671 3300049587 Bacteria 1784
165 Ga0501071_0196859 3300049587 Bacteria 1513
166 Ga0501071_0270030 3300049587 Bacteria 1286
167 Ga0501072_0120490 3300049588 Bacteria 2090
168 Ga0501072_0203173 3300049588 Bacteria 1580
169 Ga0501074_0139701 3300049590 Bacteria 1733
170 Ga0501075_0004155 3300049591 Bacteria 9774
171 Ga0501075_0253154 3300049591 Bacteria 1342
172 Ga0501075_0302051 3300049591 Bacteria 1220
173 Ga0501076_0004768 3300049592 Bacteria 9679
174 Ga0501076_0180569 3300049592 Bacteria 1720
175 Ga0501077_0015777 3300049593 Bacteria 4758
176 Ga0501077_0080788 3300049593 Bacteria 2059
177 Ga0501079_0015619 3300049741 Bacteria 5798
178 Ga0501080_0045756 3300049742 Bacteria 4074
179 Ga0501081_0001098 3300049743 Bacteria 16263
180 Ga0501081_0007000 3300049743 Bacteria 7334
181 Ga0501081_0091085 3300049743 Bacteria 2144
182 Ga0501081_0189081 3300049743 Bacteria 1491
183 Ga0501035_0261517 3300049822 Bacteria 1467
184 Ga0501045_0015050 3300049824 Bacteria 5490
185 Ga0501045_0017257 3300049824 Bacteria 5124
186 Ga0501045_0020907 3300049824 Bacteria 4679
187 Ga0501045_0093687 3300049824 Bacteria 2221
188 Ga0501045_0178833 3300049824 Bacteria 1581
189 Ga0501045_0321678 3300049824 Bacteria 1151
190 nmdc:mga05p37_145060_c1 3300050507 Unclassified 2907
191 nmdc:mga05p37_148_c1 3300050507 Bacteria 66254
192 nmdc:mga05p37_173909_c1 3300050507 Unclassified 1752
193 nmdc:mga05p37_233532_c1 3300050507 Unclassified 2215
194 nmdc:mga05p37_241918_c1 3300050507 Bacteria 2169
195 nmdc:mga05p37_34083_c1 3300050507 Bacteria 6236
196 nmdc:mga05p37_480641_c1 3300050507 Unclassified 1431
197 nmdc:mga09592_2103_c1 3300050508 Bacteria 16080
198 nmdc:mga09592_261787_c1 3300050508 Bacteria 1500
199 nmdc:mga09592_28178_c1 3300050508 Bacteria 4666
200 nmdc:mga09592_29526_c1 3300050508 Bacteria 4559
201 nmdc:mga09592_69408_c1 3300050508 Unclassified 2990
202 nmdc:mga0qj67_15348_c1 3300050509 Bacteria 5800
203 nmdc:mga0qj67_319399_c1 3300050509 Bacteria 1257
204 nmdc:mga06r32_176528_c1 3300050510 Bacteria 2121
205 nmdc:mga06r32_290375_c1 3300050510 Bacteria 1622
206 nmdc:mga06r32_67374_c1 3300050510 Bacteria 3456
207 nmdc:mga0n895_389759_c1 3300050512 Bacteria 1409
208 nmdc:mga08x19_130737_c1 3300050514 Bacteria 1688
209 nmdc:mga08x19_69522_c1 3300050514 Bacteria 2293
210 Ga0495619_0088914 3300053085 Bacteria 2089
211 Ga0501082_0078613 3300060353 Bacteria 2845
212 Ga0501082_0235570 3300060353 Bacteria 1593
213 Ga0530510_0025789 3300061734 Bacteria 4204
214 Ga0530510_0047246 3300061734 Bacteria 3110
215 Ga0530510_0048695 3300061734 Bacteria 3063
216 Ga0530510_0151784 3300061734 Bacteria 1711

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005445 Ga0070708_100618147 Ga0070708_1006181471 261
2 3300035398 Ga0316574_0332537 Ga0316574_0332537_30_824 263
3 3300039093 Ga0400489_88261 Ga0400489_88261_1729_2523 263
4 3300049592 Ga0501076_0180569 Ga0501076_0180569_811_1683 270
5 3300036712 Ga0316584_0335561 Ga0316584_0335561_196_1062 288
6 3300025910 Ga0207684_10309028 Ga0207684_103090281 289
7 3300044673 Ga0453683_0289266 Ga0453683_0289266_22_903 293
8 3300037312 Ga0395899_0173760 Ga0395899_0173760_527_1483 299
9 3300009147 Ga0114129_10223032 Ga0114129_102230322 300
10 3300005981 Ga0081538_10011083 Ga0081538_100110836 301
11 3300049824 Ga0501045_0178833 Ga0501045_0178833_268_1206 303
12 3300028800 Ga0265338_10217646 Ga0265338_102176461 305
13 3300037418 Ga0395900_0017115 Ga0395900_0017115_1223_2197 305
14 3300037471 Ga0395905_0025584 Ga0395905_0025584_3742_4716 305
15 3300038443 Ga0395901_0019976 Ga0395901_0019976_475_1449 305
16 3300006852 Ga0075433_10079177 Ga0075433_100791771 306
17 3300039093 Ga0400489_82935 Ga0400489_82935_307_1233 308
18 3300044712 Ga0453684_0002081 Ga0453684_0002081_3840_4823 308
19 3300006914 Ga0075436_100082511 Ga0075436_1000825113 309
20 3300050514 nmdc:mga08x19_69522_c1 nmdc:mga08x19_69522_c1_998_1999 309
21 3300005467 Ga0070706_100013484 Ga0070706_1000134844 310
22 3300005468 Ga0070707_100142564 Ga0070707_1001425642 310
23 3300005536 Ga0070697_100018716 Ga0070697_1000187163 310
24 3300025910 Ga0207684_10013558 Ga0207684_100135583 310
25 3300025922 Ga0207646_10138458 Ga0207646_101384582 310
26 3300044712 Ga0453684_0007920 Ga0453684_0007920_2707_3687 310
27 3300031241 Ga0265325_10004232 Ga0265325_100042326 313
28 3300031595 Ga0265313_10001269 Ga0265313_100012696 313
29 3300039453 Ga0436362_0847214 Ga0436362_0847214_456_1442 313
30 3300036647 Ga0316582_0099809 Ga0316582_0099809_22_969 314
31 3300036712 Ga0316584_0029818 Ga0316584_0029818_1421_2368 314
32 3300037588 Ga0316581_0007093 Ga0316581_0007093_1856_2803 314
33 3300044712 Ga0453684_0004826 Ga0453684_0004826_21377_22375 314
34 3300036712 Ga0316584_0158599 Ga0316584_0158599_26_979 315
35 3300032002 Ga0307416_100067281 Ga0307416_1000672811 317
36 3300038443 Ga0395901_0200331 Ga0395901_0200331_68_1024 318
37 3300039093 Ga0400489_19263 Ga0400489_19263_699_1658 318
38 3300039093 Ga0400489_40883 Ga0400489_40883_36521_37480 318
39 3300005467 Ga0070706_100187357 Ga0070706_1001873572 319
40 3300035113 Ga0373936_0057976 Ga0373936_0057976_112_1137 319
41 3300039438 Ga0436360_1222303 Ga0436360_1222303_259_1218 319
42 3300049576 Ga0501040_0024649 Ga0501040_0024649_1919_2902 319
43 3300049580 Ga0501046_0072312 Ga0501046_0072312_369_1352 319
44 3300049587 Ga0501071_0142671 Ga0501071_0142671_390_1373 319
45 3300049822 Ga0501035_0261517 Ga0501035_0261517_262_1245 319
46 3300049824 Ga0501045_0020907 Ga0501045_0020907_3381_4364 319
47 3300005467 Ga0070706_100016638 Ga0070706_1000166386 321
48 3300025910 Ga0207684_10079534 Ga0207684_100795342 321
49 3300039093 Ga0400489_54119 Ga0400489_54119_9817_10797 321
50 3300049824 Ga0501045_0015050 Ga0501045_0015050_4068_5075 321
51 3300031733 Ga0316577_10151174 Ga0316577_101511742 322
52 3300031665 Ga0316575_10013932 Ga0316575_100139322 323
53 3300031691 Ga0316579_10006471 Ga0316579_100064717 323
54 3300031727 Ga0316576_10067151 Ga0316576_100671512 323
55 3300031727 Ga0316576_10126618 Ga0316576_101266182 323
56 3300031733 Ga0316577_10000137 Ga0316577_1000013717 323
57 3300031733 Ga0316577_10002798 Ga0316577_100027989 323
58 3300031733 Ga0316577_10007751 Ga0316577_100077513 323
59 3300031733 Ga0316577_10012616 Ga0316577_100126163 323
60 3300031733 Ga0316577_10023603 Ga0316577_100236032 323
61 3300036647 Ga0316582_0000286 Ga0316582_0000286_5538_6512 323
62 3300036647 Ga0316582_0000632 Ga0316582_0000632_2314_3288 323
63 3300036647 Ga0316582_0112979 Ga0316582_0112979_616_1590 323
64 3300036712 Ga0316584_0000326 Ga0316584_0000326_18832_19806 323
65 3300036712 Ga0316584_0009541 Ga0316584_0009541_4947_5921 323
66 3300036712 Ga0316584_0024436 Ga0316584_0024436_1482_2456 323
67 3300036712 Ga0316584_0032039 Ga0316584_0032039_1410_2384 323
68 3300005937 Ga0081455_10000242 Ga0081455_1000024250 324
69 3300009147 Ga0114129_10130040 Ga0114129_101300404 324
70 3300031733 Ga0316577_10134391 Ga0316577_101343912 324
71 3300036647 Ga0316582_0085307 Ga0316582_0085307_120_1094 324
72 3300042876 Ga0451577_0168306 Ga0451577_0168306_310_1287 324
73 3300050507 nmdc:mga05p37_145060_c1 nmdc:mga05p37_145060_c1_297_1274 324
74 3300061734 Ga0530510_0047246 Ga0530510_0047246_311_1285 324
75 3300006847 Ga0075431_100011494 Ga0075431_1000114947 325
76 3300006880 Ga0075429_100013479 Ga0075429_1000134799 325
77 3300041997 Ga0439431_0048501 Ga0439431_0048501_71_1075 325
78 3300044712 Ga0453684_0015260 Ga0453684_0015260_7480_8466 325
79 3300050508 nmdc:mga09592_28178_c1 nmdc:mga09592_28178_c1_371_1372 325
80 3300050510 nmdc:mga06r32_67374_c1 nmdc:mga06r32_67374_c1_582_1583 325
81 3300005440 Ga0070705_100035093 Ga0070705_1000350932 326
82 3300005458 Ga0070681_10061250 Ga0070681_100612502 326
83 3300005467 Ga0070706_100382778 Ga0070706_1003827782 326
84 3300005530 Ga0070679_100022317 Ga0070679_1000223174 326
85 3300005563 Ga0068855_100296851 Ga0068855_1002968512 326
86 3300006847 Ga0075431_100264788 Ga0075431_1002647881 326
87 3300006852 Ga0075433_10002324 Ga0075433_100023245 326
88 3300006871 Ga0075434_100004042 Ga0075434_10000404210 326
89 3300006880 Ga0075429_100029382 Ga0075429_1000293826 326
90 3300025921 Ga0207652_10042107 Ga0207652_100421075 326
91 3300031249 Ga0265339_10024813 Ga0265339_100248134 326
92 3300035111 Ga0373923_0023836 Ga0373923_0023836_808_1854 326
93 3300035114 Ga0373939_0059396 Ga0373939_0059396_36_1082 326
94 3300035117 Ga0373953_0000258 Ga0373953_0000258_4919_5965 326
95 3300035118 Ga0373954_0001945 Ga0373954_0001945_4858_5904 326
96 3300035119 Ga0373956_0000359 Ga0373956_0000359_4963_6009 326
97 3300035172 Ga0373955_0002553 Ga0373955_0002553_4996_6042 326
98 3300035410 Ga0373924_0007395 Ga0373924_0007395_487_1533 326
99 3300035724 Ga0373933_0001775 Ga0373933_0001775_8386_9432 326
100 3300036401 Ga0373937_0005712 Ga0373937_0005712_8920_9966 326
101 3300036401 Ga0373937_0024385 Ga0373937_0024385_370_1440 326
102 3300045051 Ga0451576_0000230 Ga0451576_0000230_106688_107668 326
103 3300045051 Ga0451576_0002433 Ga0451576_0002433_17807_18832 326
104 3300045051 Ga0451576_0097845 Ga0451576_0097845_1990_2970 326
105 3300046454 Ga0495592_0229022 Ga0495592_0229022_54_1100 326
106 3300046472 Ga0495580_0069302 Ga0495580_0069302_829_1809 326
107 3300046511 Ga0495608_0007088 Ga0495608_0007088_4216_5262 326
108 3300046514 Ga0495618_0001773 Ga0495618_0001773_5138_6184 326
109 3300046517 Ga0495630_0001920 Ga0495630_0001920_165_1211 326
110 3300046533 Ga0495640_0041609 Ga0495640_0041609_886_1932 326
111 3300046559 Ga0495667_0003968 Ga0495667_0003968_4609_5655 326
112 3300046689 Ga0495613_0044798 Ga0495613_0044798_653_1699 326
113 3300047317 Ga0495604_0002129 Ga0495604_0002129_13418_14464 326
114 3300047471 Ga0495684_0004274 Ga0495684_0004274_4979_6025 326
115 3300049573 Ga0501037_0067354 Ga0501037_0067354_1088_2134 326
116 3300049574 Ga0501038_0020092 Ga0501038_0020092_30_1052 326
117 3300049575 Ga0501039_0003993 Ga0501039_0003993_3677_4723 326
118 3300049576 Ga0501040_0012324 Ga0501040_0012324_3901_4947 326
119 3300049576 Ga0501040_0045850 Ga0501040_0045850_1082_2107 326
120 3300049576 Ga0501040_0058653 Ga0501040_0058653_432_1439 326
121 3300049577 Ga0501041_0005239 Ga0501041_0005239_5398_6423 326
122 3300049577 Ga0501041_0024982 Ga0501041_0024982_1848_2894 326
123 3300049579 Ga0501043_0025452 Ga0501043_0025452_2823_3869 326
124 3300049580 Ga0501046_0038950 Ga0501046_0038950_1706_2731 326
125 3300049580 Ga0501046_0064775 Ga0501046_0064775_451_1491 326
126 3300049581 Ga0501047_0264836 Ga0501047_0264836_495_1541 326
127 3300049582 Ga0501048_0054306 Ga0501048_0054306_1198_2205 326
128 3300049587 Ga0501071_0196859 Ga0501071_0196859_441_1481 326
129 3300049587 Ga0501071_0270030 Ga0501071_0270030_185_1210 326
130 3300049588 Ga0501072_0120490 Ga0501072_0120490_460_1500 326
131 3300049588 Ga0501072_0203173 Ga0501072_0203173_430_1437 326
132 3300049590 Ga0501074_0139701 Ga0501074_0139701_345_1376 326
133 3300049591 Ga0501075_0004155 Ga0501075_0004155_902_1927 326
134 3300049591 Ga0501075_0253154 Ga0501075_0253154_169_1173 326
135 3300049592 Ga0501076_0004768 Ga0501076_0004768_2184_3230 326
136 3300049593 Ga0501077_0015777 Ga0501077_0015777_733_1779 326
137 3300049593 Ga0501077_0080788 Ga0501077_0080788_31_1056 326
138 3300049741 Ga0501079_0015619 Ga0501079_0015619_1111_2157 326
139 3300049742 Ga0501080_0045756 Ga0501080_0045756_1305_2351 326
140 3300049743 Ga0501081_0001098 Ga0501081_0001098_3584_4630 326
141 3300049743 Ga0501081_0007000 Ga0501081_0007000_5383_6408 326
142 3300049743 Ga0501081_0091085 Ga0501081_0091085_563_1603 326
143 3300049743 Ga0501081_0189081 Ga0501081_0189081_90_1136 326
144 3300049824 Ga0501045_0017257 Ga0501045_0017257_3681_4727 326
145 3300049824 Ga0501045_0093687 Ga0501045_0093687_380_1420 326
146 3300050508 nmdc:mga09592_29526_c1 nmdc:mga09592_29526_c1_1795_2775 326
147 3300050514 nmdc:mga08x19_130737_c1 nmdc:mga08x19_130737_c1_40_1023 326
148 3300053085 Ga0495619_0088914 Ga0495619_0088914_977_2023 326
149 3300060353 Ga0501082_0078613 Ga0501082_0078613_568_1608 326
150 3300061734 Ga0530510_0025789 Ga0530510_0025789_2487_3527 326
151 3300061734 Ga0530510_0048695 Ga0530510_0048695_952_1977 326
152 3300061734 Ga0530510_0151784 Ga0530510_0151784_111_1154 326
153 3300005468 Ga0070707_100036710 Ga0070707_1000367103 327
154 3300006846 Ga0075430_100233005 Ga0075430_1002330052 327
155 3300006880 Ga0075429_100040255 Ga0075429_1000402553 327
156 3300009147 Ga0114129_10047500 Ga0114129_100475007 327
157 3300025922 Ga0207646_10001400 Ga0207646_1000140032 327
158 3300037471 Ga0395905_0244843 Ga0395905_0244843_382_1407 327
159 3300038443 Ga0395901_0300182 Ga0395901_0300182_205_1230 327
160 3300044712 Ga0453684_0000003 Ga0453684_0000003_1093638_1094621 327
161 3300050507 nmdc:mga05p37_34083_c1 nmdc:mga05p37_34083_c1_693_1676 327
162 3300050508 nmdc:mga09592_261787_c1 nmdc:mga09592_261787_c1_113_1096 327
163 2162886007 SwRhRL2b_contig_3911405 SwRhRL2b_0992.00002420 328
164 3300005289 Ga0065704_10070289 Ga0065704_1007028931 328
165 3300005295 Ga0065707_10000555 Ga0065707_100005557 328
166 3300005295 Ga0065707_10008679 Ga0065707_100086793 328
167 3300005445 Ga0070708_100303417 Ga0070708_1003034171 328
168 3300005467 Ga0070706_100084202 Ga0070706_1000842024 328
169 3300005468 Ga0070707_100074955 Ga0070707_1000749552 328
170 3300005468 Ga0070707_100493914 Ga0070707_1004939142 328
171 3300005518 Ga0070699_100008124 Ga0070699_10000812410 328
172 3300005518 Ga0070699_100067787 Ga0070699_1000677872 328
173 3300005985 Ga0081539_10000773 Ga0081539_1000077340 328
174 3300005985 Ga0081539_10013558 Ga0081539_100135583 328
175 3300006194 Ga0075427_10003243 Ga0075427_100032433 328
176 3300006844 Ga0075428_100067908 Ga0075428_1000679084 328
177 3300006846 Ga0075430_100035338 Ga0075430_1000353386 328
178 3300006847 Ga0075431_100022387 Ga0075431_1000223876 328
179 3300006847 Ga0075431_100213876 Ga0075431_1002138763 328
180 3300006871 Ga0075434_100333123 Ga0075434_1003331232 328
181 3300006880 Ga0075429_100007462 Ga0075429_1000074625 328
182 3300007265 Ga0099794_10003406 Ga0099794_100034062 328
183 3300009147 Ga0114129_10000477 Ga0114129_100004777 328
184 3300009147 Ga0114129_10099959 Ga0114129_100999594 328
185 3300009147 Ga0114129_10215606 Ga0114129_102156063 328
186 3300009147 Ga0114129_10268613 Ga0114129_102686132 328
187 3300009147 Ga0114129_10370344 Ga0114129_103703442 328
188 3300011119 Ga0105246_10022165 Ga0105246_100221653 328
189 3300025922 Ga0207646_10028076 Ga0207646_100280767 328
190 3300025922 Ga0207646_10038840 Ga0207646_100388401 328
191 3300035086 Ga0373934_0000839 Ga0373934_0000839_8461_9522 328
192 3300035119 Ga0373956_0005213 Ga0373956_0005213_223_1284 328
193 3300035172 Ga0373955_0009789 Ga0373955_0009789_803_1864 328
194 3300035724 Ga0373933_0082217 Ga0373933_0082217_527_1588 328
195 3300036401 Ga0373937_0012533 Ga0373937_0012533_749_1810 328
196 3300044673 Ga0453683_0013367 Ga0453683_0013367_406_1431 328
197 3300044712 Ga0453684_0045648 Ga0453684_0045648_1582_2568 328
198 3300045051 Ga0451576_0160449 Ga0451576_0160449_636_1622 328
199 3300046462 Ga0495651_0003245 Ga0495651_0003245_10714_11775 328
200 3300046675 Ga0495657_0095060 Ga0495657_0095060_329_1390 328
201 3300049578 Ga0501042_0283787 Ga0501042_0283787_151_1137 328
202 3300049591 Ga0501075_0302051 Ga0501075_0302051_211_1197 328
203 3300049824 Ga0501045_0321678 Ga0501045_0321678_124_1110 328
204 3300050507 nmdc:mga05p37_148_c1 nmdc:mga05p37_148_c1_45661_46647 328
205 3300050507 nmdc:mga05p37_173909_c1 nmdc:mga05p37_173909_c1_715_1701 328
206 3300050507 nmdc:mga05p37_233532_c1 nmdc:mga05p37_233532_c1_1163_2149 328
207 3300050507 nmdc:mga05p37_241918_c1 nmdc:mga05p37_241918_c1_37_1053 328
208 3300050507 nmdc:mga05p37_480641_c1 nmdc:mga05p37_480641_c1_378_1364 328
209 3300050508 nmdc:mga09592_2103_c1 nmdc:mga09592_2103_c1_12540_13526 328
210 3300050508 nmdc:mga09592_69408_c1 nmdc:mga09592_69408_c1_811_1797 328
211 3300050509 nmdc:mga0qj67_15348_c1 nmdc:mga0qj67_15348_c1_3476_4504 328
212 3300050509 nmdc:mga0qj67_319399_c1 nmdc:mga0qj67_319399_c1_160_1146 328
213 3300050510 nmdc:mga06r32_176528_c1 nmdc:mga06r32_176528_c1_837_1823 328
214 3300050510 nmdc:mga06r32_290375_c1 nmdc:mga06r32_290375_c1_105_1133 328
215 3300050512 nmdc:mga0n895_389759_c1 nmdc:mga0n895_389759_c1_250_1236 328
216 3300060353 Ga0501082_0235570 Ga0501082_0235570_46_1032 328

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02374

ArsA_ATPase

Anion-transporting ATPase

18

326

0.93

PF01656

CbiA

CobQ/CobB/MinD/ParA nucleotide binding domain

20

123

0.84

PF13614

AAA_31

AAA domain

21

195

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
3iqx-assembly1.cif.gz_B adp complex of c.therm. get3 in closed form 0.9077 8 327
3iqw-assembly1.cif.gz_A amppnp complex of c. therm. get3 0.9038 8 327
3io3-assembly1.cif.gz_A get3 with adp from d. hansenii in closed form 0.8865 8 327
3iqx-assembly1.cif.gz_A adp complex of c.therm. get3 in closed form 0.8846 8 327
3iqx-assembly1.cif.gz_B adp complex of c.therm. get3 in closed form 0.8809 8 327
ID Description Score Start End Superfamily
3io3A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8865 8 327 3.40.50.300
3zq6A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8512 19 324 3.40.50.300
3sjbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8417 19 326 3.40.50.300
af_A0A1D6HKA8_60_394_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8223 13 328 3.40.50.300
af_Q7JWD3_1_334_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8142 2 327 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7V5E8K6-F1-model_v4 Arsenic transporter 0.9867 224 327 GO:0005524
GO:0016887
AF-A0A3N5U8J7-F1-model_v4 Arsenic transporter 0.9856 199 328 GO:0005524
GO:0016887
AF-A0A536LTR3-F1-model_v4 ArsA family ATPase 0.9796 237 328
AF-A0A3N5U8J7-F1-model_v4 Arsenic transporter 0.9782 199 328 GO:0005524
GO:0016887
AF-A0A2E9LTP8-F1-model_v4 Arsenic-transporting ATPase 0.9611 214 328 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
84.39 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map