F327383

General Info

Members Datasets Scaffolds Average Seq Length
216 148 432 160

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100439715|Ga0068855_1004397153
Length 194
Sequence MSKALAIRNVNVVHRSICSKYILTNDNKQAKMTAMRKTSTIFLQVVVVLMGIGSLALMLWEPHLEGRNAHATLFQIYFNDPFLAYAYTASIAFFIALYQAFKLLGYAGRGEVFSQRSVKALRTIKYCGMSLVGFLLGAEAYFFIVQRGKDDIAGGVMMGLXXXFVSAVIATAAAVFERTLQSAVELKSENDLTV

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
69 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
115 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
121 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
124 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
125 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
126 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
129 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
135 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
136 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
139 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
140 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
141 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
142 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
143 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
144 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
145 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
146 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
147 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
148 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.17
Nodule 0
Rhizoplane 0.46
Rhizosphere 93.52
Stem 0
Stem Tuber 0
Unclassified 13.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100439715 3300005563 Bacteria 1424
2 JGI24740J21852_10027744 3300001979 Bacteria 1880
3 rootH2_10089462 3300003320 Bacteria 2213
4 JGI25405J52794_10046876 3300003911 Bacteria 921
5 JGI25405J52794_10047249 3300003911 Bacteria 918
6 Ga0065717_1003713 3300005276 Bacteria 1196
7 Ga0065715_10244254 3300005293 Bacteria 1189
8 Ga0065707_10114711 3300005295 Bacteria 2289
9 Ga0070658_10026410 3300005327 Bacteria 4658
10 Ga0070658_10199276 3300005327 Bacteria 1689
11 Ga0070658_10343323 3300005327 Bacteria 1277
12 Ga0070690_100132702 3300005330 Bacteria 1683
13 Ga0070677_10168813 3300005333 Bacteria 1032
14 Ga0068869_101742912 3300005334 Bacteria 556
15 Ga0070689_100068662 3300005340 Bacteria 2764
16 Ga0070689_100110802 3300005340 Unclassified 2183
17 Ga0070689_100442399 3300005340 Bacteria 1105
18 Ga0070687_100255281 3300005343 Bacteria 1091
19 Ga0070661_100162460 3300005344 Bacteria 1692
20 Ga0070668_101637071 3300005347 Unclassified 590
21 Ga0070669_100549910 3300005353 Unclassified 962
22 Ga0070675_100070007 3300005354 Bacteria 2907
23 Ga0070674_100028139 3300005356 Bacteria 3690
24 Ga0070674_100750815 3300005356 Bacteria 838
25 Ga0070673_100881596 3300005364 Unclassified 829
26 Ga0070688_100179133 3300005365 Bacteria 1469
27 Ga0070659_100416823 3300005366 Bacteria 1135
28 Ga0070667_100185822 3300005367 Bacteria 1839
29 Ga0070701_10067630 3300005438 Bacteria 1901
30 Ga0070700_100000098 3300005441 Bacteria 56917
31 Ga0070663_101399698 3300005455 Bacteria 619
32 Ga0070678_101115520 3300005456 Bacteria 729
33 Ga0070681_10818022 3300005458 Bacteria 849
34 Ga0068867_101229364 3300005459 Bacteria 689
35 Ga0070685_10095113 3300005466 Bacteria 1810
36 Ga0070685_10303030 3300005466 Bacteria 1077
37 Ga0070698_100303691 3300005471 Bacteria 1527
38 Ga0068853_100359962 3300005539 Bacteria 1355
39 Ga0070672_100088327 3300005543 Bacteria 2496
40 Ga0070686_100127764 3300005544 Bacteria 1754
41 Ga0070695_100121587 3300005545 Bacteria 1787
42 Ga0070665_100013469 3300005548 Bacteria 8226
43 Ga0070704_100222627 3300005549 Bacteria 1535
44 Ga0070704_100464379 3300005549 Bacteria 1093
45 Ga0068855_100016549 3300005563 Bacteria 8870
46 Ga0068855_100032250 3300005563 Bacteria 6255
47 Ga0068857_101014519 3300005577 Bacteria 799
48 Ga0068856_100034925 3300005614 Bacteria 4926
49 Ga0068856_100081781 3300005614 Bacteria 3205
50 Ga0070702_100088213 3300005615 Bacteria 1875
51 Ga0068852_100804262 3300005616 Bacteria 954
52 Ga0068859_100158522 3300005617 Bacteria 2342
53 Ga0068859_100731524 3300005617 Bacteria 1079
54 Ga0068870_10007054 3300005840 Bacteria 4990
55 Ga0068863_100275745 3300005841 Bacteria 1628
56 Ga0068863_100474895 3300005841 Bacteria 1229
57 Ga0068858_101596109 3300005842 Unclassified 644
58 Ga0068860_100452351 3300005843 Bacteria 1277
59 Ga0068862_100391761 3300005844 Unclassified 1298
60 Ga0068862_100608565 3300005844 Unclassified 1050
61 Ga0081455_10013255 3300005937 Bacteria 8165
62 Ga0081540_1102018 3300005983 Bacteria 1233
63 Ga0075363_100109992 3300006048 Bacteria 1531
64 Ga0075363_100691853 3300006048 Bacteria 615
65 Ga0097621_100048360 3300006237 Bacteria 3450
66 Ga0097621_100344160 3300006237 Unclassified 1324
67 Ga0097621_100357639 3300006237 Unclassified 1300
68 Ga0075428_100107047 3300006844 Bacteria 3047
69 Ga0075428_100185031 3300006844 Bacteria 2254
70 Ga0075428_100534093 3300006844 Bacteria 1254
71 Ga0075431_100262729 3300006847 Bacteria 1751
72 Ga0075431_100488766 3300006847 Bacteria 1223
73 Ga0075431_100745447 3300006847 Bacteria 955
74 Ga0075433_10202162 3300006852 Bacteria 1766
75 Ga0075434_100105588 3300006871 Bacteria 2826
76 Ga0068865_100563555 3300006881 Bacteria 958
77 Ga0068865_100769514 3300006881 Bacteria 828
78 Ga0097620_100158528 3300006931 Bacteria 2342
79 Ga0097620_100731525 3300006931 Bacteria 1079
80 Ga0099794_10504201 3300007265 Bacteria 637
81 Ga0099795_10456703 3300007788 Unclassified 589
82 Ga0105240_10000001 3300009093 Bacteria 2887840
83 Ga0105240_10638124 3300009093 Bacteria 1169
84 Ga0105240_10638445 3300009093 Bacteria 1168
85 Ga0111539_10012222 3300009094 Bacteria 10767
86 Ga0111539_10043152 3300009094 Bacteria 5408
87 Ga0111539_10106359 3300009094 Bacteria 3291
88 Ga0105245_10388404 3300009098 Bacteria 1392
89 Ga0105247_10530675 3300009101 Unclassified 862
90 Ga0114129_10024842 3300009147 Bacteria 8494
91 Ga0114129_10103003 3300009147 Bacteria 3947
92 Ga0105248_11570776 3300009177 Unclassified 745
93 Ga0105249_10273438 3300009553 Bacteria 1684
94 Ga0105249_10538194 3300009553 Bacteria 1217
95 Ga0105249_10724632 3300009553 Bacteria 1056
96 Ga0105249_10743452 3300009553 Bacteria 1043
97 Ga0105249_11339387 3300009553 Bacteria 788
98 Ga0099796_10356796 3300010159 Bacteria 632
99 Ga0105246_10467243 3300011119 Bacteria 1064
100 Ga0157322_1010127 3300012490 Unclassified 754
101 Ga0157329_1002333 3300012491 Bacteria 1071
102 Ga0157369_10350564 3300013105 Bacteria 1533
103 Ga0157374_10097115 3300013296 Bacteria 2819
104 Ga0157374_10463040 3300013296 Bacteria 1270
105 Ga0157378_10611872 3300013297 Unclassified 1102
106 Ga0163162_10116778 3300013306 Bacteria 2769
107 Ga0163162_11931729 3300013306 Bacteria 676
108 Ga0157372_10042238 3300013307 Bacteria 5042
109 Ga0157372_10729911 3300013307 Bacteria 1152
110 Ga0157372_11176721 3300013307 Bacteria 886
111 Ga0157375_10015271 3300013308 Bacteria 6872
112 Ga0163163_10083163 3300014325 Bacteria 3206
113 Ga0163163_11026752 3300014325 Unclassified 888
114 Ga0163163_12353661 3300014325 Bacteria 591
115 Ga0157380_10009752 3300014326 Bacteria 6891
116 Ga0157380_10121809 3300014326 Bacteria 2211
117 Ga0157377_10000041 3300014745 Bacteria 110626
118 Ga0157377_10203882 3300014745 Bacteria 1257
119 Ga0157377_10434000 3300014745 Bacteria 903
120 Ga0157376_10096279 3300014969 Unclassified 2576
121 Ga0157376_10404802 3300014969 Bacteria 1320
122 Ga0157376_11779363 3300014969 Unclassified 652
123 Ga0207647_10329776 3300025904 Bacteria 866
124 Ga0207645_10039884 3300025907 Bacteria 3008
125 Ga0207643_10032408 3300025908 Bacteria 2918
126 Ga0207705_10031521 3300025909 Bacteria 3785
127 Ga0207684_10211311 3300025910 Unclassified 1674
128 Ga0207695_10000001 3300025913 Bacteria 2888630
129 Ga0207657_10060644 3300025919 Bacteria 3246
130 Ga0207650_10053616 3300025925 Bacteria 2989
131 Ga0207650_10125051 3300025925 Bacteria 2006
132 Ga0207659_10022196 3300025926 Bacteria 4224
133 Ga0207644_10785912 3300025931 Bacteria 796
134 Ga0207690_10952001 3300025932 Bacteria 713
135 Ga0207686_10004151 3300025934 Bacteria 7773
136 Ga0207686_10532651 3300025934 Bacteria 916
137 Ga0207670_10027676 3300025936 Unclassified 3588
138 Ga0207670_10666287 3300025936 Unclassified 859
139 Ga0207669_10084834 3300025937 Bacteria 2042
140 Ga0207669_10619822 3300025937 Bacteria 881
141 Ga0207704_10697836 3300025938 Bacteria 840
142 Ga0207691_10081902 3300025940 Bacteria 2900
143 Ga0207691_10339615 3300025940 Bacteria 1286
144 Ga0207691_10391027 3300025940 Bacteria 1186
145 Ga0207689_11557951 3300025942 Bacteria 551
146 Ga0207667_10019837 3300025949 Bacteria 7492
147 Ga0207667_10040393 3300025949 Bacteria 4968
148 Ga0207667_10238746 3300025949 Bacteria 1860
149 Ga0207667_11394625 3300025949 Bacteria 674
150 Ga0207651_10071111 3300025960 Bacteria 2465
151 Ga0207651_11493813 3300025960 Bacteria 608
152 Ga0207712_10314705 3300025961 Bacteria 1289
153 Ga0207712_10986091 3300025961 Bacteria 747
154 Ga0207668_11159655 3300025972 Unclassified 694
155 Ga0207658_10166930 3300025986 Unclassified 1809
156 Ga0207658_10694503 3300025986 Bacteria 919
157 Ga0207708_10000027 3300026075 Bacteria 166457
158 Ga0207708_10146210 3300026075 Bacteria 1858
159 Ga0207702_10051401 3300026078 Bacteria 3482
160 Ga0207641_10275143 3300026088 Bacteria 1581
161 Ga0207641_10399043 3300026088 Bacteria 1320
162 Ga0207648_10739080 3300026089 Bacteria 913
163 Ga0207648_10826280 3300026089 Bacteria 863
164 Ga0207648_10866876 3300026089 Unclassified 842
165 Ga0207674_10706891 3300026116 Bacteria 973
166 Ga0207675_100396961 3300026118 Bacteria 1358
167 Ga0207698_10478142 3300026142 Bacteria 1208
168 Ga0207428_10032983 3300027907 Bacteria 4257
169 Ga0207428_10068273 3300027907 Bacteria 2797
170 Ga0207428_10415056 3300027907 Unclassified 984
171 Ga0268265_11187161 3300028380 Bacteria 760
172 Ga0268264_10328144 3300028381 Bacteria 1449
173 Ga0307409_101644861 3300031995 Unclassified 671
174 Ga0307416_101499232 3300032002 Bacteria 780
175 Ga0373940_0227198 3300035088 Bacteria 622
176 Ga0373942_0038446 3300035207 Bacteria 1298
177 Ga0373925_1099597 3300037068 Bacteria 654
178 Ga0395899_0530359 3300037312 Bacteria 760
179 Ga0395898_0536127 3300037466 Bacteria 1112
180 Ga0436365_1167347 3300039437 Bacteria 34325
181 Ga0436362_0518943 3300039453 Bacteria 12866
182 Ga0451577_0468437 3300042876 Bacteria 1144
183 Ga0453684_1736673 3300044712 Unclassified 636
184 Ga0495583_0079957 3300046506 Unclassified 1421
185 Ga0495599_0142013 3300046678 Bacteria 1489
186 Ga0495636_0000041 3300047318 Bacteria 55282
187 Ga0495672_0000790 3300047320 Bacteria 34354
188 Ga0496109_0000187 3300048912 Bacteria 61841
189 Ga0496120_0077948 3300048923 Bacteria 1803
190 Ga0496126_0000147 3300048929 Bacteria 163338
191 Ga0501034_0024951 3300049571 Bacteria 6082
192 Ga0501037_0802490 3300049573 Bacteria 621
193 Ga0501038_1057668 3300049574 Bacteria 594
194 Ga0501070_0331359 3300049586 Bacteria 1237
195 Ga0501044_0000381 3300049823 Bacteria 55140
196 nmdc:mga03683_340058_c1 3300050489 Unclassified 709
197 nmdc:mga03n38_244845_c1 3300050490 Bacteria 945
198 nmdc:mga03n38_89906_c1 3300050490 Bacteria 1459
199 nmdc:mga05p37_1036763_c1 3300050507 Unclassified 867
200 nmdc:mga09592_1166969_c1 3300050508 Bacteria 638
201 nmdc:mga09592_333716_c1 3300050508 Bacteria 1313
202 nmdc:mga06r32_542287_c1 3300050510 Bacteria 1138
203 nmdc:mga08y16_102754_c1 3300050511 Bacteria 2976
204 nmdc:mga08y16_143927_c1 3300050511 Bacteria 2478
205 nmdc:mga08y16_66706_c1 3300050511 Bacteria 3756
206 nmdc:mga0n895_404673_c1 3300050512 Bacteria 1380
207 nmdc:mga0n895_604330_c1 3300050512 Bacteria 1099
208 nmdc:mga0n895_691012_c1 3300050512 Bacteria 1017
209 nmdc:mga0rr50_26744_c1 3300050513 Bacteria 4031
210 nmdc:mga0a205_247950_c1 3300050515 Bacteria 1661
211 Ga0495595_0125352 3300053084 Bacteria 1253
212 Ga0500641_0114257 3300053096 Unclassified 1163
213 Ga0500641_0156761 3300053096 Bacteria 982
214 Ga0500555_079673 3300053103 Bacteria 853
215 Ga0500616_0004598 3300053153 Bacteria 9757
216 Ga0501084_0055634 3300054114 Bacteria 3310
217 Ga0068855_100439715
218 JGI24740J21852_10027744
219 rootH2_10089462
220 JGI25405J52794_10046876
221 JGI25405J52794_10047249
222 Ga0065717_1003713
223 Ga0065715_10244254
224 Ga0065707_10114711
225 Ga0070658_10026410
226 Ga0070658_10199276
227 Ga0070658_10343323
228 Ga0070690_100132702
229 Ga0070677_10168813
230 Ga0068869_101742912
231 Ga0070689_100068662
232 Ga0070689_100110802
233 Ga0070689_100442399
234 Ga0070687_100255281
235 Ga0070661_100162460
236 Ga0070668_101637071
237 Ga0070669_100549910
238 Ga0070675_100070007
239 Ga0070674_100028139
240 Ga0070674_100750815
241 Ga0070673_100881596
242 Ga0070688_100179133
243 Ga0070659_100416823
244 Ga0070667_100185822
245 Ga0070701_10067630
246 Ga0070700_100000098
247 Ga0070663_101399698
248 Ga0070678_101115520
249 Ga0070681_10818022
250 Ga0068867_101229364
251 Ga0070685_10095113
252 Ga0070685_10303030
253 Ga0070698_100303691
254 Ga0068853_100359962
255 Ga0070672_100088327
256 Ga0070686_100127764
257 Ga0070695_100121587
258 Ga0070665_100013469
259 Ga0070704_100222627
260 Ga0070704_100464379
261 Ga0068855_100016549
262 Ga0068855_100032250
263 Ga0068857_101014519
264 Ga0068856_100034925
265 Ga0068856_100081781
266 Ga0070702_100088213
267 Ga0068852_100804262
268 Ga0068859_100158522
269 Ga0068859_100731524
270 Ga0068870_10007054
271 Ga0068863_100275745
272 Ga0068863_100474895
273 Ga0068858_101596109
274 Ga0068860_100452351
275 Ga0068862_100391761
276 Ga0068862_100608565
277 Ga0081455_10013255
278 Ga0081540_1102018
279 Ga0075363_100109992
280 Ga0075363_100691853
281 Ga0097621_100048360
282 Ga0097621_100344160
283 Ga0097621_100357639
284 Ga0075428_100107047
285 Ga0075428_100185031
286 Ga0075428_100534093
287 Ga0075431_100262729
288 Ga0075431_100488766
289 Ga0075431_100745447
290 Ga0075433_10202162
291 Ga0075434_100105588
292 Ga0068865_100563555
293 Ga0068865_100769514
294 Ga0097620_100158528
295 Ga0097620_100731525
296 Ga0099794_10504201
297 Ga0099795_10456703
298 Ga0105240_10000001
299 Ga0105240_10638124
300 Ga0105240_10638445
301 Ga0111539_10012222
302 Ga0111539_10043152
303 Ga0111539_10106359
304 Ga0105245_10388404
305 Ga0105247_10530675
306 Ga0114129_10024842
307 Ga0114129_10103003
308 Ga0105248_11570776
309 Ga0105249_10273438
310 Ga0105249_10538194
311 Ga0105249_10724632
312 Ga0105249_10743452
313 Ga0105249_11339387
314 Ga0099796_10356796
315 Ga0105246_10467243
316 Ga0157322_1010127
317 Ga0157329_1002333
318 Ga0157369_10350564
319 Ga0157374_10097115
320 Ga0157374_10463040
321 Ga0157378_10611872
322 Ga0163162_10116778
323 Ga0163162_11931729
324 Ga0157372_10042238
325 Ga0157372_10729911
326 Ga0157372_11176721
327 Ga0157375_10015271
328 Ga0163163_10083163
329 Ga0163163_11026752
330 Ga0163163_12353661
331 Ga0157380_10009752
332 Ga0157380_10121809
333 Ga0157377_10000041
334 Ga0157377_10203882
335 Ga0157377_10434000
336 Ga0157376_10096279
337 Ga0157376_10404802
338 Ga0157376_11779363
339 Ga0207647_10329776
340 Ga0207645_10039884
341 Ga0207643_10032408
342 Ga0207705_10031521
343 Ga0207684_10211311
344 Ga0207695_10000001
345 Ga0207657_10060644
346 Ga0207650_10053616
347 Ga0207650_10125051
348 Ga0207659_10022196
349 Ga0207644_10785912
350 Ga0207690_10952001
351 Ga0207686_10004151
352 Ga0207686_10532651
353 Ga0207670_10027676
354 Ga0207670_10666287
355 Ga0207669_10084834
356 Ga0207669_10619822
357 Ga0207704_10697836
358 Ga0207691_10081902
359 Ga0207691_10339615
360 Ga0207691_10391027
361 Ga0207689_11557951
362 Ga0207667_10019837
363 Ga0207667_10040393
364 Ga0207667_10238746
365 Ga0207667_11394625
366 Ga0207651_10071111
367 Ga0207651_11493813
368 Ga0207712_10314705
369 Ga0207712_10986091
370 Ga0207668_11159655
371 Ga0207658_10166930
372 Ga0207658_10694503
373 Ga0207708_10000027
374 Ga0207708_10146210
375 Ga0207702_10051401
376 Ga0207641_10275143
377 Ga0207641_10399043
378 Ga0207648_10739080
379 Ga0207648_10826280
380 Ga0207648_10866876
381 Ga0207674_10706891
382 Ga0207675_100396961
383 Ga0207698_10478142
384 Ga0207428_10032983
385 Ga0207428_10068273
386 Ga0207428_10415056
387 Ga0268265_11187161
388 Ga0268264_10328144
389 Ga0307409_101644861
390 Ga0307416_101499232
391 Ga0373940_0227198
392 Ga0373942_0038446
393 Ga0373925_1099597
394 Ga0395899_0530359
395 Ga0395898_0536127
396 Ga0436365_1167347
397 Ga0436362_0518943
398 Ga0451577_0468437
399 Ga0453684_1736673
400 Ga0495583_0079957
401 Ga0495599_0142013
402 Ga0495636_0000041
403 Ga0495672_0000790
404 Ga0496109_0000187
405 Ga0496120_0077948
406 Ga0496126_0000147
407 Ga0501034_0024951
408 Ga0501037_0802490
409 Ga0501038_1057668
410 Ga0501070_0331359
411 Ga0501044_0000381
412 nmdc:mga03683_340058_c1
413 nmdc:mga03n38_244845_c1
414 nmdc:mga03n38_89906_c1
415 nmdc:mga05p37_1036763_c1
416 nmdc:mga09592_1166969_c1
417 nmdc:mga09592_333716_c1
418 nmdc:mga06r32_542287_c1
419 nmdc:mga08y16_102754_c1
420 nmdc:mga08y16_143927_c1
421 nmdc:mga08y16_66706_c1
422 nmdc:mga0n895_404673_c1
423 nmdc:mga0n895_604330_c1
424 nmdc:mga0n895_691012_c1
425 nmdc:mga0rr50_26744_c1
426 nmdc:mga0a205_247950_c1
427 Ga0495595_0125352
428 Ga0500641_0114257
429 Ga0500641_0156761
430 Ga0500555_079673
431 Ga0500616_0004598
432 Ga0501084_0055634

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11188

DUF2975

Protein of unknown function (DUF2975)

66

194

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jfl-assembly4.cif.gz_D nucleotide-free mitofusin2 (mfn2) 0.7856 69 155
7tkb-assembly1.cif.gz_2 yeast atp synthase state 1catalytic(f) with 10 mm atp backbone model 0.7843 90 150
7tk3-assembly1.cif.gz_2 yeast atp synthase state 1binding(b) with 10 mm atp backbone model 0.7764 90 151
7tkh-assembly1.cif.gz_6 yeast atp synthase state 2catalytic(b) with 10 mm atp backbone model 0.7646 90 151
4wwf-assembly2.cif.gz_B-2 high-resolution structure of two ni-bound forms of the m123c mutant of c. metallidurans cnrxs 0.7488 56 137
ID Description Score Start End Superfamily
af_Q9XV49_1_95_1.20.5.170 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.8721 90 163 1.20.5.170
af_Q06645_63_134_1.20.20.10 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.8032 90 150 1.20.20.10
af_P56383_73_144_1.20.20.10 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.8011 90 150 1.20.20.10
af_Q37315_15_88_1.20.20.10 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.7661 90 150 1.20.20.10
af_Q7SY45_1_90_1.20.58.400 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;t-snare proteins 0.7602 54 143 1.20.58.400
ID Description Score Start End GO Terms
AF-A0A352EVT5-F1-model_v4 Uncharacterized protein 0.9563 7 96 GO:0016020
AF-A0A1F5JYV6-F1-model_v4 DUF2975 domain-containing protein 0.9542 14 154 GO:0016020
AF-A0A7T9J6P1-F1-model_v4 deleted 0.9539 7 164
AF-A0A3B8XLS1-F1-model_v4 deleted 0.9517 7 164
AF-B9XKD6-F1-model_v4 DUF2975 domain-containing protein 0.9508 7 164 GO:0016020

Map