F327178

General Info

Members Datasets Scaffolds Average Seq Length
216 132 216 527

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10008048|Ga0065712_100080481
Length 559
Sequence MILSMSKFFIRLSNYIYDHILKIRAMKNLYKFVLMVVMLSGTLITSAQITNLNSYPTATSVIFLDFDGHDVSGTMWNVNGPFTCNSSGLSDAAITEVFDRVAEDYRPFNINVTTNETKYNSAPYNKRMRVVITTSNEWYGTGAGGVAYVNSFTWGDNSPCFVFSALLGYSVKNVAEAASHEAGHTLGLRHQSSYNAACAKLSDYNWGQGTGEIGWAPIMGASYNQNMTLWNSGPNSLGCGVIQDDLSVITNATNGFGYRTDDNTNTYATATPVTFNSSGQGIISGVIEKTDDKDLFKITVPKFSRLQLNAIPYNVGTGXSGSDLDLQVDFLDGSYASIGTYNPGNLLSSVIDTFINAGTYYMRIDGKGNIFAPEYGSLGSYSLQVNYSDASVLDIRRLELRGRLNGDMHTLSWLIETDEQVKKQVIEVSNNGINFISLDQPNNTLRNYSYHPLDNRPLLYRLHITLDNLKEYYSNVIAIRQGKALKPQLVGNTISGNSITINCPANYHYQIIDQSGRLLSKGAVEKGYSSLGLGSINTGIYIIRFTDGEQQWSEKFIKR

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
105 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
106 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
107 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
108 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
118 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
119 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
120 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
121 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
122 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
123 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
124 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
128 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
131 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
132 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.39
Nodule 0
Rhizoplane 0
Rhizosphere 97.69
Stem 0
Stem Tuber 0
Unclassified 0.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10200952 3300003322 Bacteria 4645
2 rootH1_10301502 3300003323 Bacteria 3728
3 Ga0065704_10106408 3300005289 Bacteria 2084
4 Ga0065712_10002222 3300005290 Bacteria 8378
5 Ga0065712_10008048 3300005290 Bacteria 2874
6 Ga0065715_10005986 3300005293 Bacteria 5971
7 Ga0070683_100058506 3300005329 Bacteria 3580
8 Ga0070683_100068121 3300005329 Bacteria 3315
9 Ga0070670_100041225 3300005331 Bacteria 3968
10 Ga0070670_100054761 3300005331 Bacteria 3425
11 Ga0070670_100078050 3300005331 Bacteria 2845
12 Ga0068869_100006019 3300005334 Bacteria 7672
13 Ga0068869_100083240 3300005334 Bacteria 2392
14 Ga0070680_100032350 3300005336 Bacteria 4210
15 Ga0070682_100008811 3300005337 Bacteria 5695
16 Ga0068868_100120449 3300005338 Bacteria 2140
17 Ga0070660_100001959 3300005339 Bacteria 14198
18 Ga0070689_100018385 3300005340 Bacteria 5147
19 Ga0070687_100032547 3300005343 Bacteria 2566
20 Ga0070673_100020821 3300005364 Bacteria 4738
21 Ga0070688_100024251 3300005365 Bacteria 3576
22 Ga0070659_100029611 3300005366 Bacteria 4231
23 Ga0070678_100017833 3300005456 Bacteria 4582
24 Ga0068867_100007580 3300005459 Bacteria 7680
25 Ga0070685_10002080 3300005466 Bacteria 10351
26 Ga0070685_10004179 3300005466 Bacteria 7282
27 Ga0070698_100024064 3300005471 Bacteria 6357
28 Ga0070698_100055572 3300005471 Bacteria 4013
29 Ga0070679_100000113 3300005530 Bacteria 63640
30 Ga0070679_100001149 3300005530 Bacteria 23184
31 Ga0070679_100089428 3300005530 Bacteria 3066
32 Ga0070679_100154208 3300005530 Bacteria 2272
33 Ga0068853_100023090 3300005539 Bacteria 5205
34 Ga0070672_100030184 3300005543 Bacteria 4070
35 Ga0070672_100083068 3300005543 Bacteria 2570
36 Ga0070665_100012789 3300005548 Bacteria 8456
37 Ga0068855_100007383 3300005563 Bacteria 13306
38 Ga0068855_100050147 3300005563 Bacteria 4920
39 Ga0068855_100218554 3300005563 Bacteria 2138
40 Ga0068856_100011695 3300005614 Bacteria 8514
41 Ga0068856_100033139 3300005614 Bacteria 5059
42 Ga0068852_100000848 3300005616 Bacteria 20294
43 Ga0068852_100020254 3300005616 Bacteria 5287
44 Ga0068859_100016832 3300005617 Bacteria 7339
45 Ga0068859_100061553 3300005617 Bacteria 3782
46 Ga0068859_100110483 3300005617 Bacteria 2811
47 Ga0068864_100061097 3300005618 Bacteria 3264
48 Ga0068866_10016978 3300005718 Bacteria 3266
49 Ga0068866_10021851 3300005718 Bacteria 2953
50 Ga0068861_100120787 3300005719 Bacteria 2113
51 Ga0068863_100007551 3300005841 Bacteria 10635
52 Ga0068858_100082283 3300005842 Bacteria 2992
53 Ga0068860_100014853 3300005843 Bacteria 7614
54 Ga0068860_100019177 3300005843 Bacteria 6639
55 Ga0068860_100131426 3300005843 Unclassified 2403
56 Ga0068860_100238697 3300005843 Bacteria 1768
57 Ga0068862_100041413 3300005844 Bacteria 3918
58 Ga0068862_100046545 3300005844 Bacteria 3701
59 Ga0075366_10011183 3300006195 Bacteria 5060
60 Ga0097621_100012447 3300006237 Bacteria 6308
61 Ga0068871_100010690 3300006358 Bacteria 6711
62 Ga0075428_100052960 3300006844 Bacteria 4446
63 Ga0075430_100016016 3300006846 Bacteria 6384
64 Ga0075429_100033899 3300006880 Bacteria 4436
65 Ga0068865_100001928 3300006881 Bacteria 12208
66 Ga0097620_100016833 3300006931 Bacteria 7339
67 Ga0097620_100061543 3300006931 Bacteria 3782
68 Ga0097620_100110487 3300006931 Bacteria 2811
69 Ga0105240_10051078 3300009093 Bacteria 5206
70 Ga0111539_10006668 3300009094 Bacteria 14871
71 Ga0105247_10068267 3300009101 Bacteria 2216
72 Ga0114129_10005331 3300009147 Bacteria 18156
73 Ga0105241_10008820 3300009174 Bacteria 7410
74 Ga0105242_10018508 3300009176 Bacteria 5447
75 Ga0105242_10044054 3300009176 Bacteria 3612
76 Ga0105248_10055826 3300009177 Bacteria 4431
77 Ga0105237_10081203 3300009545 Bacteria 3233
78 Ga0105249_10037534 3300009553 Bacteria 4397
79 Ga0105249_10255160 3300009553 Unclassified 1740
80 Ga0105239_10034503 3300010375 Bacteria 5556
81 Ga0157373_10000699 3300013100 Bacteria 26275
82 Ga0157373_10009099 3300013100 Bacteria 7347
83 Ga0157373_10037509 3300013100 Bacteria 3474
84 Ga0157373_10073447 3300013100 Bacteria 2413
85 Ga0157371_10000284 3300013102 Bacteria 68549
86 Ga0157371_10000725 3300013102 Bacteria 38633
87 Ga0157371_10002541 3300013102 Bacteria 17330
88 Ga0157371_10007132 3300013102 Bacteria 9077
89 Ga0157371_10013022 3300013102 Bacteria 6332
90 Ga0157371_10015704 3300013102 Bacteria 5669
91 Ga0157371_10015828 3300013102 Bacteria 5642
92 Ga0157371_10016428 3300013102 Bacteria 5525
93 Ga0157371_10018851 3300013102 Bacteria 5097
94 Ga0157371_10019293 3300013102 Bacteria 5030
95 Ga0157371_10024358 3300013102 Bacteria 4421
96 Ga0157370_10001924 3300013104 Bacteria 25541
97 Ga0157370_10003783 3300013104 Bacteria 17662
98 Ga0157370_10025275 3300013104 Bacteria 5879
99 Ga0157369_10020421 3300013105 Bacteria 7403
100 Ga0157369_10035353 3300013105 Bacteria 5479
101 Ga0157378_10060956 3300013297 Unclassified 3366
102 Ga0163162_10113206 3300013306 Unclassified 2812
103 Ga0157372_10004075 3300013307 Bacteria 15665
104 Ga0157372_10034921 3300013307 Bacteria 5533
105 Ga0157372_10093088 3300013307 Bacteria 3429
106 Ga0157372_10209345 3300013307 Bacteria 2260
107 Ga0157372_10366686 3300013307 Unclassified 1678
108 Ga0157375_10055440 3300013308 Bacteria 3908
109 Ga0163163_10057583 3300014325 Bacteria 3843
110 Ga0157380_10011115 3300014326 Bacteria 6494
111 Ga0157380_10013625 3300014326 Bacteria 5934
112 Ga0157380_10096871 3300014326 Bacteria 2447
113 Ga0157377_10021465 3300014745 Unclassified 3397
114 Ga0157377_10086448 3300014745 Bacteria 1843
115 Ga0157379_10083477 3300014968 Bacteria 2863
116 Ga0207710_10001574 3300025900 Bacteria 11207
117 Ga0207647_10028356 3300025904 Bacteria 3637
118 Ga0207643_10004498 3300025908 Bacteria 7493
119 Ga0207705_10032484 3300025909 Bacteria 3730
120 Ga0207705_10070137 3300025909 Bacteria 2539
121 Ga0207707_10076088 3300025912 Bacteria 2929
122 Ga0207707_10207583 3300025912 Bacteria 1707
123 Ga0207695_10004070 3300025913 Bacteria 20110
124 Ga0207660_10075997 3300025917 Bacteria 2455
125 Ga0207657_10010738 3300025919 Bacteria 9119
126 Ga0207657_10022186 3300025919 Bacteria 5954
127 Ga0207657_10046054 3300025919 Bacteria 3822
128 Ga0207652_10000045 3300025921 Bacteria 125343
129 Ga0207652_10000819 3300025921 Bacteria 29643
130 Ga0207652_10012877 3300025921 Bacteria 6765
131 Ga0207652_10016143 3300025921 Bacteria 6090
132 Ga0207652_10017767 3300025921 Bacteria 5826
133 Ga0207681_10021867 3300025923 Bacteria 4072
134 Ga0207650_10030925 3300025925 Bacteria 3862
135 Ga0207644_10060086 3300025931 Bacteria 2750
136 Ga0207686_10038087 3300025934 Bacteria 2907
137 Ga0207670_10002352 3300025936 Bacteria 9907
138 Ga0207691_10001776 3300025940 Bacteria 21223
139 Ga0207689_10008992 3300025942 Bacteria 8653
140 Ga0207689_10030722 3300025942 Bacteria 4476
141 Ga0207689_10068489 3300025942 Bacteria 2917
142 Ga0207689_10111180 3300025942 Bacteria 2252
143 Ga0207667_10016855 3300025949 Bacteria 8241
144 Ga0207667_10025119 3300025949 Bacteria 6528
145 Ga0207667_10222021 3300025949 Unclassified 1936
146 Ga0207712_10006134 3300025961 Bacteria 7578
147 Ga0207712_10012082 3300025961 Bacteria 5513
148 Ga0207712_10032248 3300025961 Bacteria 3535
149 Ga0207640_10073722 3300025981 Bacteria 2307
150 Ga0207658_10088349 3300025986 Bacteria 2396
151 Ga0207703_10043718 3300026035 Bacteria 3597
152 Ga0207639_10031531 3300026041 Bacteria 3896
153 Ga0207708_10113994 3300026075 Unclassified 2101
154 Ga0207702_10176056 3300026078 Bacteria 1966
155 Ga0207641_10000549 3300026088 Bacteria 42051
156 Ga0207648_10004829 3300026089 Bacteria 13743
157 Ga0207648_10069482 3300026089 Bacteria 3069
158 Ga0207648_10141405 3300026089 Unclassified 2121
159 Ga0207676_10133383 3300026095 Bacteria 2115
160 Ga0207675_100005430 3300026118 Bacteria 12213
161 Ga0207683_10000943 3300026121 Bacteria 26669
162 Ga0207683_10038720 3300026121 Bacteria 4158
163 Ga0207683_10047913 3300026121 Bacteria 3742
164 Ga0207698_10003055 3300026142 Bacteria 10033
165 Ga0207698_10063330 3300026142 Bacteria 2893
166 Ga0268265_10009351 3300028380 Bacteria 6624
167 Ga0268265_10022623 3300028380 Bacteria 4419
168 Ga0268265_10175703 3300028380 Bacteria 1835
169 Ga0268264_10008474 3300028381 Bacteria 8550
170 Ga0268264_10014651 3300028381 Bacteria 6443
171 Ga0268264_10052751 3300028381 Bacteria 3391
172 Ga0395899_0031279 3300037312 Bacteria 4000
173 Ga0395900_0004195 3300037418 Bacteria 15298
174 Ga0395900_0034040 3300037418 Bacteria 5244
175 Ga0395900_0062544 3300037418 Bacteria 3826
176 Ga0395900_0070024 3300037418 Bacteria 3606
177 Ga0395898_0003718 3300037466 Bacteria 16922
178 Ga0395898_0024286 3300037466 Bacteria 6113
179 Ga0395898_0078390 3300037466 Bacteria 3187
180 Ga0395905_0037498 3300037471 Bacteria 4550
181 Ga0395905_0228250 3300037471 Bacteria 1741
182 Ga0395901_0012431 3300038443 Bacteria 8638
183 Ga0439441_002348 3300042001 Bacteria 2657
184 Ga0439449_0043762 3300042007 Unclassified 1662
185 Ga0495668_0000242 3300046616 Bacteria 78022
186 Ga0495686_0107284 3300047472 Bacteria 1678
187 Ga0501031_0005353 3300049568 Bacteria 8357
188 Ga0501032_0067862 3300049569 Bacteria 2382
189 Ga0501032_0129291 3300049569 Bacteria 1667
190 Ga0501034_0050032 3300049571 Bacteria 4216
191 Ga0501034_0099303 3300049571 Bacteria 2906
192 Ga0501036_0030139 3300049572 Bacteria 4583
193 Ga0501037_0024253 3300049573 Bacteria 4486
194 Ga0501038_0049346 3300049574 Bacteria 3639
195 Ga0501039_0137950 3300049575 Unclassified 1915
196 Ga0501043_0024351 3300049579 Bacteria 4750
197 Ga0501046_0054413 3300049580 Bacteria 3148
198 Ga0501070_0031992 3300049586 Bacteria 4405
199 Ga0501198_001890 3300049649 Bacteria 2768
200 Ga0501207_005932 3300049654 Unclassified 1703
201 Ga0501223_001821 3300049663 Bacteria 4814
202 Ga0501252_001037 3300049682 Unclassified 2443
203 Ga0501261_000732 3300049690 Bacteria 4112
204 Ga0501221_000086 3300049704 Bacteria 10739
205 Ga0501080_0116348 3300049742 Bacteria 2478
206 Ga0501035_0011438 3300049822 Bacteria 8229
207 Ga0501035_0051089 3300049822 Unclassified 3703
208 Ga0501044_0019756 3300049823 Bacteria 7198
209 Ga0501044_0134680 3300049823 Bacteria 2463
210 Ga0501044_0181869 3300049823 Bacteria 2069
211 Ga0501212_000717 3300049851 Bacteria 3381
212 nmdc:mga0k408_24124_c1 3300050493 Bacteria 3436
213 nmdc:mga05p37_102184_c1 3300050507 Bacteria 3530
214 nmdc:mga09592_24712_c1 3300050508 Bacteria 4969
215 nmdc:mga08y16_20692_c1 3300050511 Bacteria 6944
216 Ga0500611_000021 3300053727 Bacteria 102395

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049654 Ga0501207_005932 Ga0501207_005932_352_1656 431
2 3300037466 Ga0395898_0078390 Ga0395898_0078390_1832_3148 436
3 3300026089 Ga0207648_10069482 Ga0207648_100694822 457
4 3300025934 Ga0207686_10038087 Ga0207686_100380874 474
5 3300009174 Ga0105241_10008820 Ga0105241_100088206 485
6 3300009545 Ga0105237_10081203 Ga0105237_100812032 485
7 3300013102 Ga0157371_10018851 Ga0157371_100188512 485
8 3300013105 Ga0157369_10020421 Ga0157369_100204216 485
9 3300013307 Ga0157372_10034921 Ga0157372_100349215 485
10 3300009093 Ga0105240_10051078 Ga0105240_100510785 486
11 3300010375 Ga0105239_10034503 Ga0105239_100345035 486
12 3300013100 Ga0157373_10009099 Ga0157373_100090995 486
13 3300049575 Ga0501039_0137950 Ga0501039_0137950_382_1878 495
14 3300005539 Ga0068853_100023090 Ga0068853_1000230906 501
15 3300005563 Ga0068855_100050147 Ga0068855_1000501476 501
16 3300005616 Ga0068852_100020254 Ga0068852_1000202546 501
17 3300025913 Ga0207695_10004070 Ga0207695_100040707 501
18 3300025925 Ga0207650_10030925 Ga0207650_100309253 501
19 3300026041 Ga0207639_10031531 Ga0207639_100315313 501
20 3300026142 Ga0207698_10003055 Ga0207698_100030558 501
21 3300005337 Ga0070682_100008811 Ga0070682_1000088113 502
22 3300005530 Ga0070679_100154208 Ga0070679_1001542081 502
23 3300005614 Ga0068856_100011695 Ga0068856_1000116957 502
24 3300005329 Ga0070683_100058506 Ga0070683_1000585063 503
25 3300013104 Ga0157370_10003783 Ga0157370_100037835 504
26 3300025931 Ga0207644_10060086 Ga0207644_100600862 504
27 3300049569 Ga0501032_0129291 Ga0501032_0129291_34_1587 505
28 3300049690 Ga0501261_000732 Ga0501261_000732_1103_2722 505
29 3300049851 Ga0501212_000717 Ga0501212_000717_220_1839 505
30 3300050493 nmdc:mga0k408_24124_c1 nmdc:mga0k408_24124_c1_80_1681 511
31 3300013100 Ga0157373_10000699 Ga0157373_100006992 512
32 3300037471 Ga0395905_0228250 Ga0395905_0228250_179_1726 512
33 3300005530 Ga0070679_100000113 Ga0070679_10000011317 513
34 3300005530 Ga0070679_100089428 Ga0070679_1000894282 513
35 3300005563 Ga0068855_100007383 Ga0068855_1000073831 513
36 3300005617 Ga0068859_100016832 Ga0068859_1000168329 513
37 3300005618 Ga0068864_100061097 Ga0068864_1000610972 513
38 3300005843 Ga0068860_100014853 Ga0068860_1000148539 513
39 3300006931 Ga0097620_100016833 Ga0097620_1000168332 513
40 3300025909 Ga0207705_10032484 Ga0207705_100324841 513
41 3300025919 Ga0207657_10046054 Ga0207657_100460541 513
42 3300025921 Ga0207652_10000045 Ga0207652_1000004544 513
43 3300025949 Ga0207667_10016855 Ga0207667_100168558 513
44 3300025961 Ga0207712_10032248 Ga0207712_100322481 513
45 3300028381 Ga0268264_10052751 Ga0268264_100527512 513
46 3300047472 Ga0495686_0107284 Ga0495686_0107284_118_1665 513
47 3300005563 Ga0068855_100218554 Ga0068855_1002185542 514
48 3300013307 Ga0157372_10366686 Ga0157372_103666861 514
49 3300037418 Ga0395900_0004195 Ga0395900_0004195_4100_5689 514
50 3300037466 Ga0395898_0003718 Ga0395898_0003718_7254_8843 514
51 3300005339 Ga0070660_100001959 Ga0070660_1000019596 515
52 3300013102 Ga0157371_10016428 Ga0157371_100164285 516
53 3300009553 Ga0105249_10255160 Ga0105249_102551601 517
54 3300014325 Ga0163163_10057583 Ga0163163_100575835 517
55 3300053727 Ga0500611_000021 Ga0500611_000021_37108_38706 517
56 3300049571 Ga0501034_0099303 Ga0501034_0099303_584_2176 518
57 3300049823 Ga0501044_0134680 Ga0501044_0134680_780_2372 518
58 3300013297 Ga0157378_10060956 Ga0157378_100609564 519
59 3300026118 Ga0207675_100005430 Ga0207675_10000543010 519
60 3300005289 Ga0065704_10106408 Ga0065704_101064081 521
61 3300014968 Ga0157379_10083477 Ga0157379_100834773 521
62 3300005334 Ga0068869_100006019 Ga0068869_1000060195 522
63 3300025942 Ga0207689_10008992 Ga0207689_100089926 522
64 3300005334 Ga0068869_100083240 Ga0068869_1000832403 523
65 3300005343 Ga0070687_100032547 Ga0070687_1000325471 523
66 3300042007 Ga0439449_0043762 Ga0439449_0043762_29_1609 523
67 3300009553 Ga0105249_10037534 Ga0105249_100375344 524
68 3300013102 Ga0157371_10007132 Ga0157371_100071327 524
69 3300014326 Ga0157380_10096871 Ga0157380_100968712 524
70 3300014745 Ga0157377_10086448 Ga0157377_100864482 524
71 3300028380 Ga0268265_10175703 Ga0268265_101757031 524
72 3300037418 Ga0395900_0062544 Ga0395900_0062544_1575_3158 524
73 3300046616 Ga0495668_0000242 Ga0495668_0000242_1311_2897 524
74 3300013102 Ga0157371_10000284 Ga0157371_1000028436 525
75 3300037471 Ga0395905_0037498 Ga0395905_0037498_1337_2923 525
76 3300005530 Ga0070679_100001149 Ga0070679_1000011493 526
77 3300005543 Ga0070672_100083068 Ga0070672_1000830683 526
78 3300005614 Ga0068856_100033139 Ga0068856_1000331395 526
79 3300005616 Ga0068852_100000848 Ga0068852_10000084814 526
80 3300005841 Ga0068863_100007551 Ga0068863_10000755110 526
81 3300013100 Ga0157373_10037509 Ga0157373_100375094 526
82 3300013102 Ga0157371_10002541 Ga0157371_1000254118 526
83 3300013102 Ga0157371_10015828 Ga0157371_100158286 526
84 3300013104 Ga0157370_10001924 Ga0157370_100019249 526
85 3300013307 Ga0157372_10004075 Ga0157372_100040751 526
86 3300013307 Ga0157372_10093088 Ga0157372_100930883 526
87 3300025912 Ga0207707_10207583 Ga0207707_102075831 526
88 3300025917 Ga0207660_10075997 Ga0207660_100759972 526
89 3300025919 Ga0207657_10010738 Ga0207657_100107385 526
90 3300025921 Ga0207652_10017767 Ga0207652_100177676 526
91 3300026078 Ga0207702_10176056 Ga0207702_101760562 526
92 3300026088 Ga0207641_10000549 Ga0207641_100005497 526
93 3300026121 Ga0207683_10047913 Ga0207683_100479133 526
94 3300037312 Ga0395899_0031279 Ga0395899_0031279_1656_3245 526
95 3300037418 Ga0395900_0034040 Ga0395900_0034040_1412_3001 526
96 3300038443 Ga0395901_0012431 Ga0395901_0012431_2554_4143 526
97 3300005329 Ga0070683_100068121 Ga0070683_1000681211 527
98 3300005331 Ga0070670_100078050 Ga0070670_1000780502 527
99 3300005336 Ga0070680_100032350 Ga0070680_1000323502 527
100 3300005366 Ga0070659_100029611 Ga0070659_1000296114 527
101 3300005718 Ga0068866_10016978 Ga0068866_100169783 527
102 3300005843 Ga0068860_100019177 Ga0068860_1000191771 527
103 3300005843 Ga0068860_100238697 Ga0068860_1002386971 527
104 3300005844 Ga0068862_100046545 Ga0068862_1000465451 527
105 3300013100 Ga0157373_10073447 Ga0157373_100734471 527
106 3300013102 Ga0157371_10000725 Ga0157371_1000072512 527
107 3300013102 Ga0157371_10013022 Ga0157371_100130222 527
108 3300013102 Ga0157371_10015704 Ga0157371_100157045 527
109 3300013102 Ga0157371_10019293 Ga0157371_100192935 527
110 3300013102 Ga0157371_10024358 Ga0157371_100243582 527
111 3300013104 Ga0157370_10025275 Ga0157370_100252753 527
112 3300013105 Ga0157369_10035353 Ga0157369_100353536 527
113 3300013306 Ga0163162_10113206 Ga0163162_101132063 527
114 3300013307 Ga0157372_10209345 Ga0157372_102093452 527
115 3300025904 Ga0207647_10028356 Ga0207647_100283561 527
116 3300025909 Ga0207705_10070137 Ga0207705_100701371 527
117 3300025912 Ga0207707_10076088 Ga0207707_100760882 527
118 3300025919 Ga0207657_10022186 Ga0207657_100221865 527
119 3300025921 Ga0207652_10000819 Ga0207652_1000081910 527
120 3300025921 Ga0207652_10012877 Ga0207652_100128771 527
121 3300025921 Ga0207652_10016143 Ga0207652_100161435 527
122 3300025942 Ga0207689_10068489 Ga0207689_100684892 527
123 3300025949 Ga0207667_10025119 Ga0207667_100251196 527
124 3300025949 Ga0207667_10222021 Ga0207667_102220211 527
125 3300025981 Ga0207640_10073722 Ga0207640_100737222 527
126 3300028380 Ga0268265_10009351 Ga0268265_100093518 527
127 3300028381 Ga0268264_10008474 Ga0268264_100084742 527
128 3300028381 Ga0268264_10014651 Ga0268264_100146513 527
129 3300037418 Ga0395900_0070024 Ga0395900_0070024_325_1917 527
130 3300037466 Ga0395898_0024286 Ga0395898_0024286_239_1831 527
131 3300049571 Ga0501034_0050032 Ga0501034_0050032_834_2429 527
132 3300049586 Ga0501070_0031992 Ga0501070_0031992_1847_3442 527
133 3300049822 Ga0501035_0051089 Ga0501035_0051089_1373_2968 527
134 3300049823 Ga0501044_0181869 Ga0501044_0181869_320_1912 527
135 3300006846 Ga0075430_100016016 Ga0075430_1000160167 528
136 3300009101 Ga0105247_10068267 Ga0105247_100682672 529
137 3300025900 Ga0207710_10001574 Ga0207710_1000157410 529
138 3300003323 rootH1_10301502 rootH1_103015022 530
139 3300005331 Ga0070670_100054761 Ga0070670_1000547612 530
140 3300005456 Ga0070678_100017833 Ga0070678_1000178332 530
141 3300005459 Ga0068867_100007580 Ga0068867_1000075809 530
142 3300005548 Ga0070665_100012789 Ga0070665_1000127898 530
143 3300005843 Ga0068860_100131426 Ga0068860_1001314262 530
144 3300006195 Ga0075366_10011183 Ga0075366_100111836 530
145 3300006881 Ga0068865_100001928 Ga0068865_1000019288 530
146 3300025986 Ga0207658_10088349 Ga0207658_100883492 530
147 3300026089 Ga0207648_10141405 Ga0207648_101414051 530
148 3300026121 Ga0207683_10000943 Ga0207683_1000094310 530
149 3300049568 Ga0501031_0005353 Ga0501031_0005353_3875_5479 530
150 3300049569 Ga0501032_0067862 Ga0501032_0067862_405_2009 530
151 3300049572 Ga0501036_0030139 Ga0501036_0030139_905_2509 530
152 3300049573 Ga0501037_0024253 Ga0501037_0024253_138_1742 530
153 3300049574 Ga0501038_0049346 Ga0501038_0049346_897_2501 530
154 3300049579 Ga0501043_0024351 Ga0501043_0024351_2224_3828 530
155 3300049580 Ga0501046_0054413 Ga0501046_0054413_602_2206 530
156 3300049742 Ga0501080_0116348 Ga0501080_0116348_381_1985 530
157 3300049822 Ga0501035_0011438 Ga0501035_0011438_1676_3280 530
158 3300049823 Ga0501044_0019756 Ga0501044_0019756_3521_5125 530
159 3300005718 Ga0068866_10021851 Ga0068866_100218514 532
160 3300009094 Ga0111539_10006668 Ga0111539_1000666812 532
161 3300009176 Ga0105242_10044054 Ga0105242_100440541 532
162 3300014326 Ga0157380_10011115 Ga0157380_100111156 532
163 3300014745 Ga0157377_10021465 Ga0157377_100214652 532
164 3300025942 Ga0207689_10030722 Ga0207689_100307224 532
165 3300026089 Ga0207648_10004829 Ga0207648_100048298 532
166 3300049649 Ga0501198_001890 Ga0501198_001890_964_2583 532
167 3300049663 Ga0501223_001821 Ga0501223_001821_1593_3212 532
168 3300049682 Ga0501252_001037 Ga0501252_001037_262_1881 532
169 3300049704 Ga0501221_000086 Ga0501221_000086_4262_5881 532
170 3300050511 nmdc:mga08y16_20692_c1 nmdc:mga08y16_20692_c1_1103_2728 532
171 3300003322 rootL2_10200952 rootL2_102009525 533
172 3300005290 Ga0065712_10002222 Ga0065712_100022229 533
173 3300005290 Ga0065712_10008048 Ga0065712_100080481 533
174 3300005293 Ga0065715_10005986 Ga0065715_100059867 533
175 3300005331 Ga0070670_100041225 Ga0070670_1000412254 533
176 3300005338 Ga0068868_100120449 Ga0068868_1001204492 533
177 3300005340 Ga0070689_100018385 Ga0070689_1000183851 533
178 3300005364 Ga0070673_100020821 Ga0070673_1000208214 533
179 3300005365 Ga0070688_100024251 Ga0070688_1000242512 533
180 3300005466 Ga0070685_10002080 Ga0070685_1000208011 533
181 3300005466 Ga0070685_10004179 Ga0070685_100041795 533
182 3300005471 Ga0070698_100024064 Ga0070698_1000240647 533
183 3300005471 Ga0070698_100055572 Ga0070698_1000555722 533
184 3300005543 Ga0070672_100030184 Ga0070672_1000301844 533
185 3300005617 Ga0068859_100061553 Ga0068859_1000615532 533
186 3300005617 Ga0068859_100110483 Ga0068859_1001104832 533
187 3300005719 Ga0068861_100120787 Ga0068861_1001207872 533
188 3300005842 Ga0068858_100082283 Ga0068858_1000822833 533
189 3300005844 Ga0068862_100041413 Ga0068862_1000414133 533
190 3300006237 Ga0097621_100012447 Ga0097621_1000124477 533
191 3300006358 Ga0068871_100010690 Ga0068871_1000106905 533
192 3300006844 Ga0075428_100052960 Ga0075428_1000529606 533
193 3300006880 Ga0075429_100033899 Ga0075429_1000338992 533
194 3300006931 Ga0097620_100061543 Ga0097620_1000615433 533
195 3300006931 Ga0097620_100110487 Ga0097620_1001104872 533
196 3300009147 Ga0114129_10005331 Ga0114129_100053319 533
197 3300009176 Ga0105242_10018508 Ga0105242_100185082 533
198 3300009177 Ga0105248_10055826 Ga0105248_100558264 533
199 3300013308 Ga0157375_10055440 Ga0157375_100554402 533
200 3300014326 Ga0157380_10013625 Ga0157380_100136256 533
201 3300025908 Ga0207643_10004498 Ga0207643_100044988 533
202 3300025923 Ga0207681_10021867 Ga0207681_100218674 533
203 3300025936 Ga0207670_10002352 Ga0207670_100023523 533
204 3300025940 Ga0207691_10001776 Ga0207691_100017769 533
205 3300025942 Ga0207689_10111180 Ga0207689_101111802 533
206 3300025961 Ga0207712_10006134 Ga0207712_100061347 533
207 3300025961 Ga0207712_10012082 Ga0207712_100120824 533
208 3300026035 Ga0207703_10043718 Ga0207703_100437183 533
209 3300026075 Ga0207708_10113994 Ga0207708_101139942 533
210 3300026095 Ga0207676_10133383 Ga0207676_101333831 533
211 3300026121 Ga0207683_10038720 Ga0207683_100387204 533
212 3300026142 Ga0207698_10063330 Ga0207698_100633303 533
213 3300028380 Ga0268265_10022623 Ga0268265_100226234 533
214 3300042001 Ga0439441_002348 Ga0439441_002348_445_2049 533
215 3300050507 nmdc:mga05p37_102184_c1 nmdc:mga05p37_102184_c1_243_1847 533
216 3300050508 nmdc:mga09592_24712_c1 nmdc:mga09592_24712_c1_717_2321 533

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13582

Reprolysin_3

Metallo-peptidase family M12B Reprolysin-like

91

191

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g5a-assembly1.cif.gz_B crystal structure of a putative member of duf 3244 protein family (bt_1867) from bacteroides thetaiotaomicron vpi-5482 at 1.69 a resolution 0.8571 472 531
3afg-assembly1.cif.gz_A crystal structure of pron-tk-sp from thermococcus kodakaraensis 0.8201 254 361
1v5j-assembly1.cif.gz_A solution structure of rsgi ruh-008, fn3 domain in human cdna 0.7961 372 456
3afg-assembly2.cif.gz_B crystal structure of pron-tk-sp from thermococcus kodakaraensis 0.7937 249 361
3d33-assembly1.cif.gz_A crystal structure of a duf3244 family protein with an immunoglobulin-like beta-sandwich fold (bvu_0276) from bacteroides vulgatus atcc 8482 at 1.70 a resolution 0.7807 468 533
ID Description Score Start End Superfamily
af_H2KZQ5_581_676_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8582 374 454 2.60.40.10
4u49A01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8562 372 452 2.60.40.10
af_F1QXA6_608_709_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8439 372 455 2.60.40.10
af_F1QWV3_515_612_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8403 372 455 2.60.40.10
af_F1Q4W9_1381_1472_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8264 372 453 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A7Y2J796-F1-model_v4 T9SS type A sorting domain-containing protein 0.9403 460 533 GO:0004518
AF-A0A1I3KQ54-F1-model_v4 Por secretion system C-terminal sorting domain-containing protein 0.9263 460 533 GO:0004222
GO:0006508
AF-A0A3D6BS95-F1-model_v4 Secretion system C-terminal sorting domain-containing protein 0.9257 461 533
AF-F4AZT0-F1-model_v4 Secreted protein 0.9237 461 533
AF-A0A2D9Q6B9-F1-model_v4 Secretion system C-terminal sorting domain-containing protein 0.9203 461 533

Feature Viewer

pLDDT pTM Quality
82.51 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map