F327156

General Info

Members Datasets Scaffolds Average Seq Length
216 150 432 264

Family's Representative Sequence

Representative Sequence 3300003373|JGI25407J50210_10014169|JGI25407J50210_100141692
Length 289
Sequence MTAGLHLDRMWVGPGRLLPMATLVAFHAHPDDECLLQSGSLAKAVHEGHRVVVVYATRGEVGEAPDGLLEPGESLVERRMAEAMRSAEALGVHRVAWLGYRDSGMMGTPDNDDPRCFWRADVEVAAAMVAEILREESADVLTIYDENGNYGHPDHIQVHRVGSRAAELAGTPHVLEATISREHVKALIANAAAAGQRIGDAPDLEDESVVFGVPDDAITTVVDVGDFLDRKRAAIAAHASQVHDTGLFLAMPPDVFRVAMGTEFYIRRGAPAGHRDHDVFAGVETAASG

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
26 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
34 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
35 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
38 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
39 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
50 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
52 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
53 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
54 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
55 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
56 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
57 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
58 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
59 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
60 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
61 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
62 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
63 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
64 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
65 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
66 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
67 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
68 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
69 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
70 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
71 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
72 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
73 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
74 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
75 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
76 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
77 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
78 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
79 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
80 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
81 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
82 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
83 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
84 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
85 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
86 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
87 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
88 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
89 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
90 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
91 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
92 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
93 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
94 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
95 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
96 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
97 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
98 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
99 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
100 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
101 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
102 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
103 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
104 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
105 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
106 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
118 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
119 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
120 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
121 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
122 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
123 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
124 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
125 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
126 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
127 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
130 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
133 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
134 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
135 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
136 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
137 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
138 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
139 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
140 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
141 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
142 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
143 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
144 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
145 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
146 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
147 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
148 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
149 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
150 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.61
Metatranscriptomes 0
Isolates 1.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.39
Nodule 0
Rhizoplane 2.78
Rhizosphere 91.2
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10014169 3300003373 Bacteria 2054
2 Ga0070683_100005629 3300005329 Bacteria 10472
3 Ga0070683_100688541 3300005329 Bacteria 979
4 Ga0070690_100278491 3300005330 Bacteria 1192
5 Ga0068868_100326255 3300005338 Bacteria 1309
6 Ga0068868_100600184 3300005338 Bacteria 975
7 Ga0070661_100006173 3300005344 Bacteria 8259
8 Ga0070668_100002419 3300005347 Bacteria 13740
9 Ga0070705_100013905 3300005440 Bacteria 4128
10 Ga0070705_100015754 3300005440 Bacteria 3914
11 Ga0070708_100140182 3300005445 Bacteria 2242
12 Ga0070663_100371914 3300005455 Bacteria 1162
13 Ga0070681_10006357 3300005458 Bacteria 11487
14 Ga0070681_10051394 3300005458 Bacteria 4111
15 Ga0070681_10160442 3300005458 Bacteria 2172
16 Ga0070706_100003339 3300005467 Bacteria 15831
17 Ga0070706_100062513 3300005467 Bacteria 3441
18 Ga0070706_100406170 3300005467 Bacteria 1268
19 Ga0070698_100000926 3300005471 Bacteria 32043
20 Ga0070686_100093646 3300005544 Bacteria 2015
21 Ga0070696_100067867 3300005546 Bacteria 2503
22 Ga0070704_100016797 3300005549 Bacteria 4635
23 Ga0070704_100157962 3300005549 Bacteria 1790
24 Ga0068851_10274463 3300005834 Bacteria 962
25 Ga0068858_100025445 3300005842 Bacteria 5506
26 Ga0081455_10001209 3300005937 Bacteria 32327
27 Ga0081455_10011606 3300005937 Bacteria 8841
28 Ga0081538_10002881 3300005981 Bacteria 16432
29 Ga0081538_10003399 3300005981 Bacteria 15066
30 Ga0081538_10040266 3300005981 Bacteria 2983
31 Ga0075365_10284836 3300006038 Bacteria 1163
32 Ga0075428_100002780 3300006844 Bacteria 19064
33 Ga0075428_100187807 3300006844 Bacteria 2235
34 Ga0075428_100814476 3300006844 Bacteria 992
35 Ga0075430_100001960 3300006846 Bacteria 16918
36 Ga0075430_100132104 3300006846 Bacteria 2081
37 Ga0075430_100135653 3300006846 Bacteria 2051
38 Ga0075430_100263690 3300006846 Bacteria 1426
39 Ga0075431_100001796 3300006847 Bacteria 20241
40 Ga0075431_100088763 3300006847 Bacteria 3191
41 Ga0075434_100349839 3300006871 Bacteria 1499
42 Ga0075434_100659174 3300006871 Bacteria 1065
43 Ga0075429_100000197 3300006880 Bacteria 40093
44 Ga0075429_100158248 3300006880 Bacteria 1984
45 Ga0075429_100186102 3300006880 Bacteria 1820
46 Ga0075429_100620194 3300006880 Bacteria 948
47 Ga0068865_100387777 3300006881 Bacteria 1141
48 Ga0111539_10278838 3300009094 Bacteria 1945
49 Ga0111539_10360362 3300009094 Bacteria 1692
50 Ga0111539_10605016 3300009094 Bacteria 1277
51 Ga0105245_10006917 3300009098 Bacteria 9944
52 Ga0105245_10038229 3300009098 Bacteria 4270
53 Ga0105245_10136884 3300009098 Bacteria 2302
54 Ga0105245_10715519 3300009098 Bacteria 1035
55 Ga0114129_10009996 3300009147 Bacteria 13522
56 Ga0114129_10170064 3300009147 Bacteria 2972
57 Ga0114129_10346836 3300009147 Bacteria 1968
58 Ga0105243_10064612 3300009148 Bacteria 2937
59 Ga0105249_11172817 3300009553 Bacteria 839
60 Ga0157374_10504738 3300013296 Bacteria 1214
61 Ga0157378_10423963 3300013297 Bacteria 1315
62 Ga0163162_10435819 3300013306 Bacteria 1443
63 Ga0157375_10739920 3300013308 Bacteria 1135
64 Ga0157376_10184398 3300014969 Bacteria 1910
65 Ga0213873_10020467 3300021358 Bacteria 1546
66 Ga0213876_10062403 3300021384 Bacteria 1967
67 Ga0207684_10402058 3300025910 Bacteria 1177
68 Ga0207707_10013533 3300025912 Bacteria 7110
69 Ga0207687_10085501 3300025927 Bacteria 2288
70 Ga0207687_10085672 3300025927 Bacteria 2286
71 Ga0207664_10138492 3300025929 Bacteria 2056
72 Ga0207644_10084300 3300025931 Bacteria 2355
73 Ga0207661_10001355 3300025944 Bacteria 16428
74 Ga0207668_10234402 3300025972 Bacteria 1481
75 Ga0207677_10472150 3300026023 Bacteria 1079
76 Ga0207703_10006538 3300026035 Bacteria 9299
77 Ga0207678_10259041 3300026067 Bacteria 1491
78 Ga0207428_10041443 3300027907 Bacteria 3727
79 Ga0268264_10014416 3300028381 Bacteria 6495
80 Ga0265336_10018334 3300028666 Bacteria 2269
81 Ga0265338_10001109 3300028800 Bacteria 44693
82 Ga0265338_10171298 3300028800 Bacteria 1664
83 Ga0307511_10023261 3300030521 Bacteria 5781
84 Ga0265325_10005951 3300031241 Bacteria 7473
85 Ga0265339_10013777 3300031249 Bacteria 4894
86 Ga0265331_10015651 3300031250 Bacteria 4000
87 Ga0265316_10012241 3300031344 Bacteria 7698
88 Ga0307408_100276572 3300031548 Bacteria 1396
89 Ga0265313_10000462 3300031595 Bacteria 42851
90 Ga0307413_10609479 3300031824 Bacteria 895
91 Ga0307507_10020812 3300033179 Bacteria 7327
92 Ga0307510_10102589 3300033180 Bacteria 2642
93 Ga0373948_0004730 3300034817 Bacteria 2170
94 Ga0373928_0001137 3300035084 Bacteria 5268
95 Ga0373928_0078042 3300035084 Bacteria 830
96 Ga0373929_0002830 3300035085 Bacteria 3168
97 Ga0373934_0091424 3300035086 Bacteria 1227
98 Ga0373932_0000282 3300035112 Bacteria 15315
99 Ga0373932_0005384 3300035112 Bacteria 3012
100 Ga0373955_0126279 3300035172 Bacteria 1491
101 Ga0373931_0000005 3300035691 Bacteria 480485
102 Ga0373931_0000027 3300035691 Bacteria 123672
103 Ga0373933_0126505 3300035724 Bacteria 1604
104 Ga0400483_070602 3300039062 Bacteria 3681
105 Ga0436365_1168575 3300039437 Bacteria 2142
106 Ga0436365_1324952 3300039437 Bacteria 1925
107 Ga0436362_0236779 3300039453 Bacteria 1547
108 Ga0439461_0049946 3300041410 Bacteria 925
109 Ga0439466_0036521 3300041411 Bacteria 1659
110 Ga0451837_1206125 3300041494 Bacteria 1503
111 Ga0439448_0074089 3300042005 Bacteria 1136
112 Ga0439450_006560 3300042008 Bacteria 2100
113 Ga0439452_014871 3300042010 Bacteria 2150
114 Ga0439457_032445 3300042014 Bacteria 1159
115 Ga0439434_0021515 3300042435 Bacteria 1938
116 Ga0439464_0089630 3300042439 Bacteria 926
117 Ga0439460_0001300 3300042461 Bacteria 5864
118 Ga0439440_0001288 3300042993 Bacteria 4549
119 Ga0466966_0412683 3300044684 Bacteria 811
120 Ga0466961_0127720 3300044693 Bacteria 1594
121 Ga0466960_0403817 3300044901 Bacteria 787
122 Ga0466959_0036823 3300045049 Bacteria 3615
123 Ga0466958_0121824 3300045836 Bacteria 1633
124 Ga0466967_0004991 3300045976 Bacteria 9085
125 Ga0495629_0107150 3300046459 Bacteria 1950
126 Ga0495639_0094135 3300046475 Bacteria 1409
127 Ga0495584_0098595 3300046491 Bacteria 1477
128 Ga0495628_0268875 3300046516 Bacteria 1269
129 Ga0495630_0085935 3300046517 Bacteria 2375
130 Ga0495666_0148279 3300046526 Bacteria 1092
131 Ga0495667_0077683 3300046559 Bacteria 2159
132 Ga0495634_0218584 3300046642 Bacteria 1177
133 Ga0495658_0037509 3300046683 Bacteria 2680
134 Ga0495600_0280132 3300046809 Bacteria 1056
135 Ga0496102_0313280 3300048905 Bacteria 1479
136 Ga0496105_0470285 3300048908 Bacteria 990
137 Ga0496108_0092484 3300048911 Bacteria 2572
138 Ga0496109_0188023 3300048912 Bacteria 1940
139 Ga0496109_0596431 3300048912 Bacteria 1041
140 Ga0496112_0002365 3300048915 Bacteria 15156
141 Ga0501033_0000279 3300049570 Bacteria 49249
142 Ga0501033_0010073 3300049570 Bacteria 7253
143 Ga0501034_0186427 3300049571 Bacteria 2038
144 Ga0501036_0011973 3300049572 Bacteria 7191
145 Ga0501037_0296655 3300049573 Bacteria 1123
146 Ga0501038_0332129 3300049574 Bacteria 1187
147 Ga0501039_0030076 3300049575 Bacteria 4185
148 Ga0501040_0023776 3300049576 Bacteria 4108
149 Ga0501041_0016803 3300049577 Bacteria 4355
150 Ga0501041_0024082 3300049577 Bacteria 3652
151 Ga0501042_0004180 3300049578 Bacteria 9178
152 Ga0501046_0035474 3300049580 Bacteria 4019
153 Ga0501046_0264494 3300049580 Bacteria 1263
154 Ga0501048_0010872 3300049582 Bacteria 6787
155 Ga0501068_0003286 3300049584 Bacteria 8666
156 Ga0501068_0050745 3300049584 Bacteria 2508
157 Ga0501069_0001821 3300049585 Bacteria 10630
158 Ga0501070_0357436 3300049586 Bacteria 1185
159 Ga0501071_0003489 3300049587 Bacteria 9824
160 Ga0501071_0017334 3300049587 Bacteria 4964
161 Ga0501071_0106503 3300049587 Bacteria 2070
162 Ga0501071_0145212 3300049587 Bacteria 1768
163 Ga0501072_0004529 3300049588 Bacteria 10564
164 Ga0501072_0004751 3300049588 Bacteria 10340
165 Ga0501072_0098582 3300049588 Bacteria 2323
166 Ga0501073_0002597 3300049589 Bacteria 13517
167 Ga0501074_0070182 3300049590 Bacteria 2519
168 Ga0501074_0081227 3300049590 Bacteria 2325
169 Ga0501074_0132197 3300049590 Bacteria 1785
170 Ga0501075_0013569 3300049591 Bacteria 5818
171 Ga0501075_0040796 3300049591 Bacteria 3477
172 Ga0501076_0003735 3300049592 Bacteria 10707
173 Ga0501076_0028928 3300049592 Bacteria 4307
174 Ga0501077_0005603 3300049593 Bacteria 7646
175 Ga0501079_0008799 3300049741 Bacteria 7649
176 Ga0501080_0122544 3300049742 Bacteria 2409
177 Ga0501080_0197964 3300049742 Bacteria 1845
178 Ga0501081_0020962 3300049743 Bacteria 4361
179 Ga0501081_0026578 3300049743 Bacteria 3904
180 Ga0501081_0270428 3300049743 Bacteria 1243
181 Ga0501083_0001119 3300049744 Bacteria 17959
182 Ga0501044_0001735 3300049823 Bacteria 25479
183 Ga0501045_0006517 3300049824 Bacteria 8092
184 Ga0501045_0012030 3300049824 Bacteria 6084
185 nmdc:mga0yw44_2084_c1 3300050492 Bacteria 8352
186 nmdc:mga05p37_108513_c1 3300050507 Bacteria 3414
187 nmdc:mga05p37_36273_c1 3300050507 Bacteria 6051
188 nmdc:mga05p37_941_c1 3300050507 Bacteria 32782
189 nmdc:mga09592_3806_c1 3300050508 Bacteria 12147
190 nmdc:mga0qj67_103466_c1 3300050509 Bacteria 2297
191 nmdc:mga0qj67_10582_c1 3300050509 Bacteria 6891
192 nmdc:mga0qj67_199951_c1 3300050509 Bacteria 1624
193 nmdc:mga0qj67_522352_c1 3300050509 Bacteria 953
194 nmdc:mga0qj67_71588_c1 3300050509 Bacteria 2768
195 nmdc:mga06r32_219913_c1 3300050510 Bacteria 1888
196 nmdc:mga06r32_41396_c1 3300050510 Bacteria 4378
197 nmdc:mga06r32_58349_c1 3300050510 Bacteria 3710
198 nmdc:mga06r32_6639_c1 3300050510 Bacteria 10399
199 nmdc:mga08y16_282571_c1 3300050511 Bacteria 1712
200 nmdc:mga0n895_105965_c1 3300050512 Bacteria 2824
201 Ga0495601_0317191 3300053077 Bacteria 1015
202 Ga0495595_0100716 3300053084 Bacteria 1394
203 Ga0495619_0009707 3300053085 Bacteria 6069
204 Ga0495619_0217989 3300053085 Bacteria 1322
205 Ga0495619_0403838 3300053085 Bacteria 943
206 Ga0500566_0000813 3300053094 Bacteria 17779
207 Ga0501084_0000503 3300054114 Bacteria 29987
208 Ga0501084_0001582 3300054114 Bacteria 18013
209 Ga0501084_0110126 3300054114 Bacteria 2314
210 Ga0501082_0004637 3300060353 Bacteria 11995
211 Ga0466962_0121187 3300061719 Bacteria 1262
212 Ga0530510_0006848 3300061734 Bacteria 7943
213 Ga0530510_0030038 3300061734 Bacteria 3902
214 2515855759 2515154155 Bacteria 7985436
215 2891331045 2891326441 Bacteria 6439512
216 8003324281 8003314358 Bacteria 10575343
217 JGI25407J50210_10014169
218 Ga0070683_100005629
219 Ga0070683_100688541
220 Ga0070690_100278491
221 Ga0068868_100326255
222 Ga0068868_100600184
223 Ga0070661_100006173
224 Ga0070668_100002419
225 Ga0070705_100013905
226 Ga0070705_100015754
227 Ga0070708_100140182
228 Ga0070663_100371914
229 Ga0070681_10006357
230 Ga0070681_10051394
231 Ga0070681_10160442
232 Ga0070706_100003339
233 Ga0070706_100062513
234 Ga0070706_100406170
235 Ga0070698_100000926
236 Ga0070686_100093646
237 Ga0070696_100067867
238 Ga0070704_100016797
239 Ga0070704_100157962
240 Ga0068851_10274463
241 Ga0068858_100025445
242 Ga0081455_10001209
243 Ga0081455_10011606
244 Ga0081538_10002881
245 Ga0081538_10003399
246 Ga0081538_10040266
247 Ga0075365_10284836
248 Ga0075428_100002780
249 Ga0075428_100187807
250 Ga0075428_100814476
251 Ga0075430_100001960
252 Ga0075430_100132104
253 Ga0075430_100135653
254 Ga0075430_100263690
255 Ga0075431_100001796
256 Ga0075431_100088763
257 Ga0075434_100349839
258 Ga0075434_100659174
259 Ga0075429_100000197
260 Ga0075429_100158248
261 Ga0075429_100186102
262 Ga0075429_100620194
263 Ga0068865_100387777
264 Ga0111539_10278838
265 Ga0111539_10360362
266 Ga0111539_10605016
267 Ga0105245_10006917
268 Ga0105245_10038229
269 Ga0105245_10136884
270 Ga0105245_10715519
271 Ga0114129_10009996
272 Ga0114129_10170064
273 Ga0114129_10346836
274 Ga0105243_10064612
275 Ga0105249_11172817
276 Ga0157374_10504738
277 Ga0157378_10423963
278 Ga0163162_10435819
279 Ga0157375_10739920
280 Ga0157376_10184398
281 Ga0213873_10020467
282 Ga0213876_10062403
283 Ga0207684_10402058
284 Ga0207707_10013533
285 Ga0207687_10085501
286 Ga0207687_10085672
287 Ga0207664_10138492
288 Ga0207644_10084300
289 Ga0207661_10001355
290 Ga0207668_10234402
291 Ga0207677_10472150
292 Ga0207703_10006538
293 Ga0207678_10259041
294 Ga0207428_10041443
295 Ga0268264_10014416
296 Ga0265336_10018334
297 Ga0265338_10001109
298 Ga0265338_10171298
299 Ga0307511_10023261
300 Ga0265325_10005951
301 Ga0265339_10013777
302 Ga0265331_10015651
303 Ga0265316_10012241
304 Ga0307408_100276572
305 Ga0265313_10000462
306 Ga0307413_10609479
307 Ga0307507_10020812
308 Ga0307510_10102589
309 Ga0373948_0004730
310 Ga0373928_0001137
311 Ga0373928_0078042
312 Ga0373929_0002830
313 Ga0373934_0091424
314 Ga0373932_0000282
315 Ga0373932_0005384
316 Ga0373955_0126279
317 Ga0373931_0000005
318 Ga0373931_0000027
319 Ga0373933_0126505
320 Ga0400483_070602
321 Ga0436365_1168575
322 Ga0436365_1324952
323 Ga0436362_0236779
324 Ga0439461_0049946
325 Ga0439466_0036521
326 Ga0451837_1206125
327 Ga0439448_0074089
328 Ga0439450_006560
329 Ga0439452_014871
330 Ga0439457_032445
331 Ga0439434_0021515
332 Ga0439464_0089630
333 Ga0439460_0001300
334 Ga0439440_0001288
335 Ga0466966_0412683
336 Ga0466961_0127720
337 Ga0466960_0403817
338 Ga0466959_0036823
339 Ga0466958_0121824
340 Ga0466967_0004991
341 Ga0495629_0107150
342 Ga0495639_0094135
343 Ga0495584_0098595
344 Ga0495628_0268875
345 Ga0495630_0085935
346 Ga0495666_0148279
347 Ga0495667_0077683
348 Ga0495634_0218584
349 Ga0495658_0037509
350 Ga0495600_0280132
351 Ga0496102_0313280
352 Ga0496105_0470285
353 Ga0496108_0092484
354 Ga0496109_0188023
355 Ga0496109_0596431
356 Ga0496112_0002365
357 Ga0501033_0000279
358 Ga0501033_0010073
359 Ga0501034_0186427
360 Ga0501036_0011973
361 Ga0501037_0296655
362 Ga0501038_0332129
363 Ga0501039_0030076
364 Ga0501040_0023776
365 Ga0501041_0016803
366 Ga0501041_0024082
367 Ga0501042_0004180
368 Ga0501046_0035474
369 Ga0501046_0264494
370 Ga0501048_0010872
371 Ga0501068_0003286
372 Ga0501068_0050745
373 Ga0501069_0001821
374 Ga0501070_0357436
375 Ga0501071_0003489
376 Ga0501071_0017334
377 Ga0501071_0106503
378 Ga0501071_0145212
379 Ga0501072_0004529
380 Ga0501072_0004751
381 Ga0501072_0098582
382 Ga0501073_0002597
383 Ga0501074_0070182
384 Ga0501074_0081227
385 Ga0501074_0132197
386 Ga0501075_0013569
387 Ga0501075_0040796
388 Ga0501076_0003735
389 Ga0501076_0028928
390 Ga0501077_0005603
391 Ga0501079_0008799
392 Ga0501080_0122544
393 Ga0501080_0197964
394 Ga0501081_0020962
395 Ga0501081_0026578
396 Ga0501081_0270428
397 Ga0501083_0001119
398 Ga0501044_0001735
399 Ga0501045_0006517
400 Ga0501045_0012030
401 nmdc:mga0yw44_2084_c1
402 nmdc:mga05p37_108513_c1
403 nmdc:mga05p37_36273_c1
404 nmdc:mga05p37_941_c1
405 nmdc:mga09592_3806_c1
406 nmdc:mga0qj67_103466_c1
407 nmdc:mga0qj67_10582_c1
408 nmdc:mga0qj67_199951_c1
409 nmdc:mga0qj67_522352_c1
410 nmdc:mga0qj67_71588_c1
411 nmdc:mga06r32_219913_c1
412 nmdc:mga06r32_41396_c1
413 nmdc:mga06r32_58349_c1
414 nmdc:mga06r32_6639_c1
415 nmdc:mga08y16_282571_c1
416 nmdc:mga0n895_105965_c1
417 Ga0495601_0317191
418 Ga0495595_0100716
419 Ga0495619_0009707
420 Ga0495619_0217989
421 Ga0495619_0403838
422 Ga0500566_0000813
423 Ga0501084_0000503
424 Ga0501084_0001582
425 Ga0501084_0110126
426 Ga0501082_0004637
427 Ga0466962_0121187
428 Ga0530510_0006848
429 Ga0530510_0030038
430 2515855759
431 2891331045
432 8003324281

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02585

PIG-L

GlcNAc-PI de-N-acetylase

24

166

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ewl-assembly2.cif.gz_B crystal structure of mshb with glycerol and acetate bound in the active site 0.7841 20 284
1q7t-assembly2.cif.gz_B rv1170 (mshb) from mycobacterium tuberculosis 0.7808 20 282
4ewl-assembly2.cif.gz_A crystal structure of mshb with glycerol and acetate bound in the active site 0.7786 17 285
1q7t-assembly1.cif.gz_A rv1170 (mshb) from mycobacterium tuberculosis 0.7786 20 282
1q74-assembly1.cif.gz_A the crystal structure of 1d-myo-inositol 2-acetamido-2-deoxy-alpha-d-glucopyranoside deacetylase (mshb) 0.7532 20 282
ID Description Score Start End Superfamily
af_P9WJN1_3_287_3.40.50.10320 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8521 21 284 3.40.50.10320
af_L0T643_2_220_3.40.50.10320 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8385 16 268 3.40.50.10320
af_Q2G0L0_1_219_3.40.50.10320 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8147 22 270 3.40.50.10320
af_C6KT83_16_229_3.40.50.10320 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8139 21 171 3.40.50.10320
af_L0T643_2_220_3.40.50.10320 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8131 16 268 3.40.50.10320
ID Description Score Start End GO Terms
AF-A0A7W1PZ61-F1-model_v4 PIG-L family deacetylase 0.9907 20 163 GO:0016137
GO:0016811
AF-A0A7W1PZ61-F1-model_v4 PIG-L family deacetylase 0.9773 20 163 GO:0016137
GO:0016811
AF-A0A7X9QD53-F1-model_v4 GlcNAc-PI de-N-acetylase 0.9759 20 149 GO:0016137
GO:0016811
AF-A0A7V8YL22-F1-model_v4 PIG-L family deacetylase 0.9746 21 162 GO:0016137
GO:0016811
AF-A0A3D5GJW4-F1-model_v4 GlcNAc-PI de-N-acetylase 0.9711 20 125 GO:0016137
GO:0016811

Map