F327148

General Info

Members Datasets Scaffolds Average Seq Length
216 135 432 156

Family's Representative Sequence

Representative Sequence 3300003214|JGI25165J46597_1002712|JGI25165J46597_10027122
Length 161
Sequence MGQMLKFRYLATAALSGLLFGAGLYVSQMVDPLKVLRFLDFGAIPSGGWDPSLAFVIAPAIVVMFIAVRIARPRPSPLFDTAFHGPTFTRIDAPLVAGAALFGLGWGMSGICPGPAIALVAFLPSNLWIFLVAVFVGSYLGGLTMARTNPEPAEIQAXPAE

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
8 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
20 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
22 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
25 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
29 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
40 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
68 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
69 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
70 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
71 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
72 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
73 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
74 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
75 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
76 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
77 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
78 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
79 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
80 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
81 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
82 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
87 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
88 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
89 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
90 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
91 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
92 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
93 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
94 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
95 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
96 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
97 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
98 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
99 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
112 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
113 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
114 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
115 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
116 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
117 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
119 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
120 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
121 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
122 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
123 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
124 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
125 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
126 2643221580 Devosia sp. Root635 Isolate Unclassified
127 2643221591 Devosia sp. Root685 Isolate Unclassified
128 2643221629 Devosia sp. Root105 Isolate Unclassified
129 2643221662 Devosia sp. Root413D1 Isolate Unclassified
130 2643221674 Devosia sp. Root436 Isolate Unclassified
131 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
132 2887630918 Psychrosphaera haliotis UCD-MCMsp1aY Isolate Unclassified
133 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
134 2932401849 Devosia sp. 2618 Isolate Rhizosphere
135 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.52
Metatranscriptomes 1.39
Isolates 5.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.56
Nodule 0
Rhizoplane 1.39
Rhizosphere 82.41
Stem 0
Stem Tuber 0
Unclassified 1.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1002712 3300003214 Bacteria 5252
2 Ga0070658_10013399 3300005327 Bacteria 6578
3 Ga0070658_10073850 3300005327 Bacteria 2797
4 Ga0070658_10484746 3300005327 Bacteria 1067
5 Ga0068868_100338712 3300005338 Bacteria 1285
6 Ga0070660_100006116 3300005339 Bacteria 8324
7 Ga0070660_100043471 3300005339 Bacteria 3433
8 Ga0070661_100024508 3300005344 Bacteria 4328
9 Ga0070661_100025444 3300005344 Bacteria 4253
10 Ga0070661_100047172 3300005344 Bacteria 3153
11 Ga0070661_100621204 3300005344 Bacteria 875
12 Ga0070659_100067883 3300005366 Bacteria 2828
13 Ga0070659_100083615 3300005366 Bacteria 2552
14 Ga0070659_100424167 3300005366 Bacteria 1125
15 Ga0070659_100828818 3300005366 Bacteria 806
16 Ga0070663_101324488 3300005455 Bacteria 636
17 Ga0070662_100328642 3300005457 Bacteria 1249
18 Ga0070681_11350162 3300005458 Bacteria 636
19 Ga0070679_100071081 3300005530 Bacteria 3471
20 Ga0068853_100013217 3300005539 Bacteria 6737
21 Ga0068853_100052062 3300005539 Bacteria 3526
22 Ga0068853_100062881 3300005539 Bacteria 3213
23 Ga0070672_100492053 3300005543 Bacteria 1060
24 Ga0070665_100103231 3300005548 Bacteria 2854
25 Ga0070665_100404037 3300005548 Bacteria 1374
26 Ga0068855_100058763 3300005563 Bacteria 4502
27 Ga0068855_100182254 3300005563 Bacteria 2374
28 Ga0068855_100843498 3300005563 Bacteria 971
29 Ga0068855_101367035 3300005563 Bacteria 731
30 Ga0068857_100013461 3300005577 Bacteria 7125
31 Ga0068857_101112724 3300005577 Bacteria 763
32 Ga0068854_100010975 3300005578 Bacteria 5879
33 Ga0068854_100854320 3300005578 Bacteria 797
34 Ga0068856_100204485 3300005614 Bacteria 1989
35 Ga0068856_100432919 3300005614 Bacteria 1335
36 Ga0068852_100006649 3300005616 Bacteria 8378
37 Ga0068852_100024276 3300005616 Bacteria 4897
38 Ga0068852_100041420 3300005616 Bacteria 3892
39 Ga0068852_101522360 3300005616 Bacteria 691
40 Ga0075368_10263404 3300006042 Bacteria 738
41 Ga0097621_100295351 3300006237 Bacteria 1430
42 Ga0075370_10207381 3300006353 Bacteria 1157
43 Ga0075370_10953300 3300006353 Unclassified 525
44 Ga0068865_100189217 3300006881 Bacteria 1590
45 Ga0105240_10071843 3300009093 Bacteria 4279
46 Ga0105241_10193867 3300009174 Bacteria 1693
47 Ga0105237_10000449 3300009545 Bacteria 58586
48 Ga0105237_11910619 3300009545 Bacteria 602
49 Ga0105238_10099565 3300009551 Bacteria 2890
50 Ga0105238_10177639 3300009551 Bacteria 2106
51 Ga0105239_10009975 3300010375 Bacteria 10658
52 Ga0105239_10234949 3300010375 Bacteria 2057
53 Ga0105239_10276985 3300010375 Bacteria 1888
54 Ga0105239_11490158 3300010375 Bacteria 782
55 Ga0157373_10037282 3300013100 Bacteria 3486
56 Ga0157373_10173691 3300013100 Bacteria 1516
57 Ga0157371_10008162 3300013102 Bacteria 8371
58 Ga0157371_10199899 3300013102 Bacteria 1432
59 Ga0157370_10034029 3300013104 Bacteria 4965
60 Ga0157370_10080570 3300013104 Bacteria 3065
61 Ga0157370_10160762 3300013104 Bacteria 2090
62 Ga0157370_11198888 3300013104 Bacteria 685
63 Ga0157369_10066777 3300013105 Bacteria 3869
64 Ga0157369_10122701 3300013105 Bacteria 2756
65 Ga0157369_10226797 3300013105 Bacteria 1954
66 Ga0157369_10517663 3300013105 Bacteria 1234
67 Ga0157374_10015333 3300013296 Bacteria 6722
68 Ga0157378_10397146 3300013297 Bacteria 1358
69 Ga0157372_10110687 3300013307 Bacteria 3146
70 Ga0157372_11132281 3300013307 Bacteria 905
71 Ga0163163_12096180 3300014325 Bacteria 625
72 Ga0197907_10579377 3300020069 Bacteria 1244
73 Ga0206356_10051688 3300020070 Bacteria 715
74 Ga0206353_11133977 3300020082 Bacteria 1752
75 Ga0209233_1004974 3300025261 Bacteria 4467
76 Ga0207647_10106596 3300025904 Bacteria 1659
77 Ga0207645_10385846 3300025907 Bacteria 941
78 Ga0207705_10037978 3300025909 Bacteria 3447
79 Ga0207705_10159067 3300025909 Bacteria 1696
80 Ga0207654_10077951 3300025911 Bacteria 1988
81 Ga0207707_11035933 3300025912 Bacteria 672
82 Ga0207695_10066670 3300025913 Bacteria 3696
83 Ga0207671_10000439 3300025914 Bacteria 57260
84 Ga0207671_10832326 3300025914 Bacteria 731
85 Ga0207657_10015968 3300025919 Bacteria 7252
86 Ga0207657_10018131 3300025919 Bacteria 6734
87 Ga0207649_10030843 3300025920 Bacteria 3180
88 Ga0207649_10054321 3300025920 Bacteria 2492
89 Ga0207649_10328457 3300025920 Bacteria 1126
90 Ga0207652_10823807 3300025921 Bacteria 823
91 Ga0207652_10994157 3300025921 Bacteria 738
92 Ga0207694_11350283 3300025924 Bacteria 603
93 Ga0207659_10177059 3300025926 Bacteria 1687
94 Ga0207690_10041697 3300025932 Bacteria 3010
95 Ga0207690_10119285 3300025932 Bacteria 1913
96 Ga0207690_10491664 3300025932 Bacteria 991
97 Ga0207690_10667524 3300025932 Bacteria 853
98 Ga0207690_10683798 3300025932 Bacteria 843
99 Ga0207706_10053421 3300025933 Bacteria 3566
100 Ga0207704_10542933 3300025938 Bacteria 943
101 Ga0207691_10706073 3300025940 Bacteria 850
102 Ga0207661_10475731 3300025944 Bacteria 1140
103 Ga0207667_10067980 3300025949 Bacteria 3711
104 Ga0207667_10089702 3300025949 Bacteria 3177
105 Ga0207667_11370126 3300025949 Bacteria 682
106 Ga0207640_10911697 3300025981 Bacteria 768
107 Ga0207640_11051680 3300025981 Bacteria 718
108 Ga0207658_10150951 3300025986 Bacteria 1893
109 Ga0207639_10004587 3300026041 Bacteria 9298
110 Ga0207639_10141089 3300026041 Bacteria 2007
111 Ga0207639_10388663 3300026041 Bacteria 1254
112 Ga0207678_11209257 3300026067 Bacteria 669
113 Ga0207702_10062913 3300026078 Bacteria 3171
114 Ga0207702_10605404 3300026078 Bacteria 1075
115 Ga0207702_10835289 3300026078 Bacteria 911
116 Ga0207674_10012591 3300026116 Bacteria 9454
117 Ga0207683_10861033 3300026121 Bacteria 841
118 Ga0207698_10041277 3300026142 Bacteria 3436
119 Ga0207698_10405401 3300026142 Bacteria 1304
120 Ga0268266_10000474 3300028379 Bacteria 57849
121 Ga0265318_10008026 3300028577 Bacteria 4726
122 Ga0265332_10144536 3300031238 Bacteria 996
123 Ga0265320_10028777 3300031240 Bacteria 2882
124 Ga0265340_10098326 3300031247 Bacteria 1362
125 Ga0265331_10099912 3300031250 Bacteria 1336
126 Ga0265327_10064840 3300031251 Bacteria 1850
127 Ga0265314_10036366 3300031711 Bacteria 3579
128 Ga0265342_10069704 3300031712 Bacteria 2053
129 Ga0307516_10427359 3300031730 Bacteria 982
130 Ga0307412_11616474 3300031911 Bacteria 592
131 Ga0307414_10071544 3300032004 Bacteria 2502
132 Ga0307414_10083384 3300032004 Bacteria 2347
133 Ga0373932_0134457 3300035112 Bacteria 836
134 Ga0373960_0128783 3300035121 Bacteria 847
135 Ga0373962_0300448 3300035242 Bacteria 569
136 Ga0316582_0714381 3300036647 Unclassified 688
137 Ga0395899_0035154 3300037312 Bacteria 3762
138 Ga0395899_0177782 3300037312 Bacteria 1495
139 Ga0395900_0196929 3300037418 Bacteria 2040
140 Ga0395900_0330046 3300037418 Bacteria 1504
141 Ga0395900_0368530 3300037418 Bacteria 1406
142 Ga0395898_0114778 3300037466 Bacteria 2580
143 Ga0395898_1811291 3300037466 Bacteria 531
144 Ga0395901_0316484 3300038443 Bacteria 1615
145 Ga0395901_0890643 3300038443 Bacteria 872
146 Ga0439465_0027030 3300041413 Bacteria 1816
147 Ga0451837_0548234 3300041494 Bacteria 753
148 Ga0451853_2753112 3300041512 Bacteria 789
149 Ga0439445_0106226 3300042004 Bacteria 799
150 Ga0495628_0843858 3300046516 Bacteria 639
151 Ga0496108_0863465 3300048911 Bacteria 778
152 Ga0496110_0023750 3300048913 Bacteria 5218
153 Ga0496116_0083464 3300048919 Bacteria 1972
154 Ga0496122_0000505 3300048925 Bacteria 80571
155 Ga0496122_0245416 3300048925 Bacteria 1006
156 Ga0496123_0000400 3300048926 Bacteria 80571
157 Ga0496124_0089231 3300048927 Bacteria 2518
158 Ga0496124_0169601 3300048927 Bacteria 1692
159 Ga0496124_0171150 3300048927 Bacteria 1682
160 Ga0496124_0311418 3300048927 Bacteria 1132
161 Ga0496125_0000217 3300048928 Bacteria 117498
162 Ga0496126_0125573 3300048929 Bacteria 2221
163 Ga0496126_0149856 3300048929 Bacteria 2000
164 Ga0501031_0025780 3300049568 Bacteria 3836
165 Ga0501031_0432153 3300049568 Bacteria 851
166 Ga0501032_0017227 3300049569 Bacteria 5074
167 Ga0501032_0066765 3300049569 Bacteria 2404
168 Ga0501033_0264242 3300049570 Bacteria 1217
169 Ga0501034_0004211 3300049571 Bacteria 16059
170 Ga0501034_0151764 3300049571 Bacteria 2292
171 Ga0501034_0155814 3300049571 Bacteria 2258
172 Ga0501034_0553868 3300049571 Bacteria 1059
173 Ga0501034_0759572 3300049571 Bacteria 864
174 Ga0501034_1055830 3300049571 Bacteria 694
175 Ga0501036_0034608 3300049572 Bacteria 4273
176 Ga0501037_0119831 3300049573 Bacteria 1892
177 Ga0501037_0123419 3300049573 Bacteria 1860
178 Ga0501037_0328531 3300049573 Bacteria 1058
179 Ga0501038_0008126 3300049574 Bacteria 9659
180 Ga0501038_0113607 3300049574 Bacteria 2241
181 Ga0501039_0026711 3300049575 Bacteria 4437
182 Ga0501039_0176959 3300049575 Unclassified 1678
183 Ga0501043_0374561 3300049579 Bacteria 1079
184 Ga0501043_0961802 3300049579 Bacteria 609
185 Ga0501046_0024428 3300049580 Bacteria 4958
186 Ga0501047_0091027 3300049581 Bacteria 2928
187 Ga0501047_0797823 3300049581 Bacteria 759
188 Ga0501048_0505897 3300049582 Bacteria 866
189 Ga0501068_0175799 3300049584 Bacteria 1353
190 Ga0501069_0437396 3300049585 Bacteria 777
191 Ga0501070_0053374 3300049586 Bacteria 3353
192 Ga0501070_0113691 3300049586 Bacteria 2237
193 Ga0501071_0442410 3300049587 Bacteria 995
194 Ga0501073_0264964 3300049589 Bacteria 1186
195 Ga0501073_0760225 3300049589 Bacteria 668
196 Ga0501080_0843588 3300049742 Bacteria 801
197 Ga0501035_0650629 3300049822 Bacteria 854
198 Ga0501044_0199360 3300049823 Bacteria 1960
199 nmdc:mga07m45_144289_c1 3300050496 Bacteria 1379
200 Ga0500562_020268 3300053108 Bacteria 1726
201 Ga0500595_063071 3300053119 Bacteria 1115
202 Ga0500604_0000191 3300053151 Bacteria 17521
203 Ga0500627_0042409 3300053158 Bacteria 1959
204 Ga0500634_0006404 3300053161 Bacteria 5694
205 Ga0500634_0072909 3300053161 Bacteria 1791
206 2600375994 2600254933 Bacteria 4750527
207 2643912380 2643221580 Bacteria 3816678
208 2643963269 2643221591 Bacteria 4397626
209 2644167845 2643221629 Bacteria 5850260
210 2644349304 2643221662 Bacteria 5851492
211 2644410697 2643221674 Bacteria 3919126
212 2852395343 2852387548 Bacteria 8025568
213 2887633710 2887630918 Bacteria 3239855
214 2920827255 2920822456 Bacteria 6897201
215 2932403429 2932401849 Bacteria 4262978
216 8054003708 8054002106 Bacteria 7987183
217 JGI25165J46597_1002712
218 Ga0070658_10013399
219 Ga0070658_10073850
220 Ga0070658_10484746
221 Ga0068868_100338712
222 Ga0070660_100006116
223 Ga0070660_100043471
224 Ga0070661_100024508
225 Ga0070661_100025444
226 Ga0070661_100047172
227 Ga0070661_100621204
228 Ga0070659_100067883
229 Ga0070659_100083615
230 Ga0070659_100424167
231 Ga0070659_100828818
232 Ga0070663_101324488
233 Ga0070662_100328642
234 Ga0070681_11350162
235 Ga0070679_100071081
236 Ga0068853_100013217
237 Ga0068853_100052062
238 Ga0068853_100062881
239 Ga0070672_100492053
240 Ga0070665_100103231
241 Ga0070665_100404037
242 Ga0068855_100058763
243 Ga0068855_100182254
244 Ga0068855_100843498
245 Ga0068855_101367035
246 Ga0068857_100013461
247 Ga0068857_101112724
248 Ga0068854_100010975
249 Ga0068854_100854320
250 Ga0068856_100204485
251 Ga0068856_100432919
252 Ga0068852_100006649
253 Ga0068852_100024276
254 Ga0068852_100041420
255 Ga0068852_101522360
256 Ga0075368_10263404
257 Ga0097621_100295351
258 Ga0075370_10207381
259 Ga0075370_10953300
260 Ga0068865_100189217
261 Ga0105240_10071843
262 Ga0105241_10193867
263 Ga0105237_10000449
264 Ga0105237_11910619
265 Ga0105238_10099565
266 Ga0105238_10177639
267 Ga0105239_10009975
268 Ga0105239_10234949
269 Ga0105239_10276985
270 Ga0105239_11490158
271 Ga0157373_10037282
272 Ga0157373_10173691
273 Ga0157371_10008162
274 Ga0157371_10199899
275 Ga0157370_10034029
276 Ga0157370_10080570
277 Ga0157370_10160762
278 Ga0157370_11198888
279 Ga0157369_10066777
280 Ga0157369_10122701
281 Ga0157369_10226797
282 Ga0157369_10517663
283 Ga0157374_10015333
284 Ga0157378_10397146
285 Ga0157372_10110687
286 Ga0157372_11132281
287 Ga0163163_12096180
288 Ga0197907_10579377
289 Ga0206356_10051688
290 Ga0206353_11133977
291 Ga0209233_1004974
292 Ga0207647_10106596
293 Ga0207645_10385846
294 Ga0207705_10037978
295 Ga0207705_10159067
296 Ga0207654_10077951
297 Ga0207707_11035933
298 Ga0207695_10066670
299 Ga0207671_10000439
300 Ga0207671_10832326
301 Ga0207657_10015968
302 Ga0207657_10018131
303 Ga0207649_10030843
304 Ga0207649_10054321
305 Ga0207649_10328457
306 Ga0207652_10823807
307 Ga0207652_10994157
308 Ga0207694_11350283
309 Ga0207659_10177059
310 Ga0207690_10041697
311 Ga0207690_10119285
312 Ga0207690_10491664
313 Ga0207690_10667524
314 Ga0207690_10683798
315 Ga0207706_10053421
316 Ga0207704_10542933
317 Ga0207691_10706073
318 Ga0207661_10475731
319 Ga0207667_10067980
320 Ga0207667_10089702
321 Ga0207667_11370126
322 Ga0207640_10911697
323 Ga0207640_11051680
324 Ga0207658_10150951
325 Ga0207639_10004587
326 Ga0207639_10141089
327 Ga0207639_10388663
328 Ga0207678_11209257
329 Ga0207702_10062913
330 Ga0207702_10605404
331 Ga0207702_10835289
332 Ga0207674_10012591
333 Ga0207683_10861033
334 Ga0207698_10041277
335 Ga0207698_10405401
336 Ga0268266_10000474
337 Ga0265318_10008026
338 Ga0265332_10144536
339 Ga0265320_10028777
340 Ga0265340_10098326
341 Ga0265331_10099912
342 Ga0265327_10064840
343 Ga0265314_10036366
344 Ga0265342_10069704
345 Ga0307516_10427359
346 Ga0307412_11616474
347 Ga0307414_10071544
348 Ga0307414_10083384
349 Ga0373932_0134457
350 Ga0373960_0128783
351 Ga0373962_0300448
352 Ga0316582_0714381
353 Ga0395899_0035154
354 Ga0395899_0177782
355 Ga0395900_0196929
356 Ga0395900_0330046
357 Ga0395900_0368530
358 Ga0395898_0114778
359 Ga0395898_1811291
360 Ga0395901_0316484
361 Ga0395901_0890643
362 Ga0439465_0027030
363 Ga0451837_0548234
364 Ga0451853_2753112
365 Ga0439445_0106226
366 Ga0495628_0843858
367 Ga0496108_0863465
368 Ga0496110_0023750
369 Ga0496116_0083464
370 Ga0496122_0000505
371 Ga0496122_0245416
372 Ga0496123_0000400
373 Ga0496124_0089231
374 Ga0496124_0169601
375 Ga0496124_0171150
376 Ga0496124_0311418
377 Ga0496125_0000217
378 Ga0496126_0125573
379 Ga0496126_0149856
380 Ga0501031_0025780
381 Ga0501031_0432153
382 Ga0501032_0017227
383 Ga0501032_0066765
384 Ga0501033_0264242
385 Ga0501034_0004211
386 Ga0501034_0151764
387 Ga0501034_0155814
388 Ga0501034_0553868
389 Ga0501034_0759572
390 Ga0501034_1055830
391 Ga0501036_0034608
392 Ga0501037_0119831
393 Ga0501037_0123419
394 Ga0501037_0328531
395 Ga0501038_0008126
396 Ga0501038_0113607
397 Ga0501039_0026711
398 Ga0501039_0176959
399 Ga0501043_0374561
400 Ga0501043_0961802
401 Ga0501046_0024428
402 Ga0501047_0091027
403 Ga0501047_0797823
404 Ga0501048_0505897
405 Ga0501068_0175799
406 Ga0501069_0437396
407 Ga0501070_0053374
408 Ga0501070_0113691
409 Ga0501071_0442410
410 Ga0501073_0264964
411 Ga0501073_0760225
412 Ga0501080_0843588
413 Ga0501035_0650629
414 Ga0501044_0199360
415 nmdc:mga07m45_144289_c1
416 Ga0500562_020268
417 Ga0500595_063071
418 Ga0500604_0000191
419 Ga0500627_0042409
420 Ga0500634_0006404
421 Ga0500634_0072909
422 2600375994
423 2643912380
424 2643963269
425 2644167845
426 2644349304
427 2644410697
428 2852395343
429 2887633710
430 2920827255
431 2932403429
432 8054003708

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20398

DUF6691

Family of unknown function (DUF6691)

8

150

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ib0-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein, rv2844, from mycobacterium tuberculosis 0.2839 21 151
2ib0-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein, rv2844, from mycobacterium tuberculosis 0.2667 21 151
5vkv-assembly1.cif.gz_A solution nmr structure of the membrane electron transporter ccda 0.2308 8 146
6k01-assembly1.cif.gz_D crystal structure of xh2a-h2b 0.2147 60 140
5vkv-assembly1.cif.gz_A solution nmr structure of the membrane electron transporter ccda 0.2097 8 146
ID Description Score Start End Superfamily
af_Q566D0_1_116_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.2933 54 151 1.20.140.150
2ib0A01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.2608 21 148 1.20.1260.10
2ib0A01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.26 21 148 1.20.1260.10
af_Q566D0_1_116_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.2596 54 151 1.20.140.150
ID Description Score Start End GO Terms
AF-T0SLZ2-F1-model_v4 Sulfur transport 0.8881 9 148 GO:0016020
AF-A0A2H0Q5T5-F1-model_v4 YeeE/YedE family protein 0.8816 9 144 GO:0016020
AF-A0A0F3IX02-F1-model_v4 Uncharacterized protein 0.8813 8 143 GO:0016020
AF-A0A2D9F325-F1-model_v4 YeeE/YedE family protein 0.8762 9 144 GO:0016020
AF-A0A0H4XEQ6-F1-model_v4 GENE II AND X protein 0.8754 9 151 GO:0016020

Map