F326934

General Info

Members Datasets Scaffolds Average Seq Length
215 169 430 349

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0227043|Ga0501047_0227043_524_1678
Length 384
Sequence LTCDHYVDINIIVKDDDVPLMEAEMAQKVLVLVGTRKGAFLLESETARGGWALRGPFCDAWPINHVVADPASGTIYAGGGNEWFGPAVWKSTDLGESWTHSSEGLKYEAGETPIKSVWSLAQADGSLYAGVEPAGLFRSEDGGQSWRHVAGLRNHPSREKWQPGGGGLILHSLVPHPTDRRQLWVGISAAGVFHTADGGESWSPRNQGTRCDFLPEEQRYPEFGQCVHSVVMAPGMPDRLYQQNHCGMYRSEDGGRHWDSIESGLPSSFGFPSAVHPRDPETLFLLPLNGDIKGRYVPDGKAAVWRTRDSGASWQALRNGLPQDNVFFGVLRQAMATDRLSPAGVYFGTNTGMLYASADEGESWRCIAQHLPTISSVETLVVDA

Samples

Sample ID Description Type Environment
1 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
16 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
19 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
20 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
21 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
22 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
27 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
38 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
39 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
40 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
41 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
42 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
43 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
44 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
51 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
53 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
54 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
55 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
56 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
57 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
58 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
59 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
60 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
61 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
62 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
63 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
64 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
65 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
66 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
67 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
68 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
69 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
70 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
71 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
72 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
73 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
74 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
75 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
76 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
77 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
78 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
79 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
80 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
81 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
82 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
83 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
84 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
85 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
86 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
87 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
101 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
102 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
103 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
104 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
105 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
106 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
107 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
108 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
109 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
110 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
113 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
114 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
115 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
116 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
117 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
118 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
119 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
120 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
121 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
122 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
123 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
124 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
125 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
126 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
127 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
128 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
129 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
130 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
131 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
132 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
133 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
134 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
135 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
136 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
137 2738543024 Aminobacter sp. AP02 Isolate Unclassified
138 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
139 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
140 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
141 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
142 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
143 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
144 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
145 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
146 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
147 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
148 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
149 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
150 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
151 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
152 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
153 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
154 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
155 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
156 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
157 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
158 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
159 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
160 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
161 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
162 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
163 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
164 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
165 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
166 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
167 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
168 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
169 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.79
Metatranscriptomes 0
Isolates 17.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.95
Nodule 11.16
Rhizoplane 0
Rhizosphere 64.19
Stem 0
Stem Tuber 0
Unclassified 3.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501047_0227043 3300049581 Bacteria 1722
2 JGI25151J46595_10000314 3300003187 Bacteria 52844
3 JGI25406J46586_10001295 3300003203 Bacteria 11771
4 Ga0070690_100033952 3300005330 Unclassified 3196
5 Ga0070682_100071540 3300005337 Bacteria 2220
6 Ga0068868_100016384 3300005338 Bacteria 5505
7 Ga0070692_10002308 3300005345 Bacteria 7349
8 Ga0070692_10060902 3300005345 Bacteria 1988
9 Ga0070667_100154351 3300005367 Bacteria 2019
10 Ga0070694_100000008 3300005444 Bacteria 96501
11 Ga0070708_100048037 3300005445 Bacteria 3772
12 Ga0070707_100075443 3300005468 Bacteria 3253
13 Ga0070679_100253929 3300005530 Bacteria 1714
14 Ga0070665_100424823 3300005548 Bacteria 1338
15 Ga0081455_10126069 3300005937 Bacteria 2009
16 Ga0081538_10011883 3300005981 Bacteria 7028
17 Ga0081540_1015453 3300005983 Bacteria 4834
18 Ga0081540_1035934 3300005983 Bacteria 2650
19 Ga0081539_10001435 3300005985 Bacteria 40814
20 Ga0081539_10024507 3300005985 Bacteria 3911
21 Ga0081539_10048819 3300005985 Bacteria 2405
22 Ga0075365_10037043 3300006038 Bacteria 3165
23 Ga0075365_10038987 3300006038 Bacteria 3091
24 Ga0075365_10197002 3300006038 Bacteria 1411
25 Ga0075368_10077657 3300006042 Bacteria 1348
26 Ga0075367_10040402 3300006178 Bacteria 2723
27 Ga0075369_10012690 3300006186 Bacteria 3329
28 Ga0075370_10158261 3300006353 Bacteria 1329
29 Ga0075428_100156576 3300006844 Bacteria 2475
30 Ga0075430_100055738 3300006846 Bacteria 3324
31 Ga0075430_100152098 3300006846 Bacteria 1927
32 Ga0075431_100029132 3300006847 Bacteria 5680
33 Ga0075436_100169326 3300006914 Bacteria 1542
34 Ga0075435_100231186 3300007076 Bacteria 1571
35 Ga0111539_10425876 3300009094 Bacteria 1546
36 Ga0114129_10013104 3300009147 Bacteria 11809
37 Ga0114129_10176288 3300009147 Bacteria 2912
38 Ga0105243_10199264 3300009148 Bacteria 1755
39 Ga0105241_10257055 3300009174 Bacteria 1483
40 Ga0105242_10107125 3300009176 Bacteria 2377
41 Ga0105028_101814 3300009993 Bacteria 2238
42 Ga0105239_10203128 3300010375 Bacteria 2220
43 Ga0157369_10004028 3300013105 Bacteria 17417
44 Ga0157375_10371880 3300013308 Bacteria 1596
45 Ga0182008_10022425 3300014497 Bacteria 3234
46 Ga0213872_10001414 3300021361 Bacteria 15752
47 Ga0213872_10044166 3300021361 Bacteria 2029
48 Ga0213872_10080386 3300021361 Bacteria 1465
49 Ga0213875_10009574 3300021388 Bacteria 4899
50 Ga0213875_10017668 3300021388 Bacteria 3441
51 Ga0209130_1000300 3300025284 Bacteria 60286
52 Ga0209025_1000084 3300025294 Bacteria 263812
53 Ga0209758_1003129 3300025297 Bacteria 15617
54 Ga0207426_1000311 3300025302 Bacteria 95578
55 Ga0207705_10049503 3300025909 Bacteria 3024
56 Ga0207695_10178983 3300025913 Bacteria 2042
57 Ga0207646_10067024 3300025922 Bacteria 3204
58 Ga0207669_10028057 3300025937 Bacteria 3092
59 Ga0207679_10273502 3300025945 Bacteria 1446
60 Ga0207678_10252713 3300026067 Bacteria 1510
61 Ga0209813_10019439 3300027866 Bacteria 1888
62 Ga0209813_10023149 3300027866 Bacteria 1764
63 Ga0268266_10012600 3300028379 Bacteria 7306
64 Ga0265338_10031566 3300028800 Bacteria 5191
65 Ga0265330_10030885 3300031235 Bacteria 2402
66 Ga0265328_10023712 3300031239 Bacteria 2325
67 Ga0265325_10014579 3300031241 Bacteria 4437
68 Ga0265325_10038789 3300031241 Bacteria 2512
69 Ga0265339_10004217 3300031249 Bacteria 9844
70 Ga0265339_10049160 3300031249 Bacteria 2311
71 Ga0265316_10159112 3300031344 Bacteria 1689
72 Ga0307513_10031741 3300031456 Bacteria 5976
73 Ga0265314_10045235 3300031711 Bacteria 3114
74 Ga0316576_10149356 3300031727 Bacteria 1761
75 Ga0316576_10167416 3300031727 Bacteria 1658
76 Ga0316578_10118511 3300031728 Bacteria 1591
77 Ga0307516_10094375 3300031730 Bacteria 2816
78 Ga0316577_10079032 3300031733 Bacteria 1838
79 Ga0373947_0034884 3300035725 Bacteria 2977
80 Ga0373937_0003290 3300036401 Bacteria 13562
81 Ga0316584_0054280 3300036712 Bacteria 2999
82 Ga0316584_0103702 3300036712 Bacteria 2129
83 Ga0436364_1074949 3300037853 Bacteria 10367
84 Ga0436364_1106604 3300037853 Bacteria 48807
85 Ga0436364_1241653 3300037853 Bacteria 27547
86 Ga0436365_1834493 3300039437 Bacteria 3049
87 Ga0436360_0626991 3300039438 Bacteria 3148
88 Ga0436360_1004508 3300039438 Unclassified 1558
89 Ga0436361_0148527 3300039447 Bacteria 1982
90 Ga0436361_0192302 3300039447 Bacteria 8591
91 Ga0436361_1002359 3300039447 Bacteria 4290
92 Ga0436361_1139630 3300039447 Bacteria 1854
93 Ga0436361_1210897 3300039447 Bacteria 7624
94 Ga0436363_1579553 3300039450 Bacteria 1182
95 Ga0439458_0022358 3300042157 Bacteria 1469
96 Ga0439435_0005444 3300042436 Bacteria 2802
97 Ga0466963_0284330 3300044694 Bacteria 1163
98 Ga0495638_0007723 3300046460 Bacteria 7685
99 Ga0495610_0014001 3300046512 Bacteria 4739
100 Ga0495637_0074231 3300046520 Bacteria 1366
101 Ga0495643_0050978 3300046522 Bacteria 2227
102 Ga0495597_0074530 3300046542 Bacteria 1457
103 Ga0495625_0040511 3300046660 Bacteria 3396
104 Ga0495686_0099033 3300047472 Bacteria 1760
105 Ga0496119_0000416 3300048922 Bacteria 58592
106 Ga0496119_0056872 3300048922 Bacteria 2367
107 Ga0496120_0028389 3300048923 Bacteria 3430
108 Ga0496122_0001164 3300048925 Bacteria 44969
109 Ga0496123_0003355 3300048926 Bacteria 18119
110 Ga0496126_0298228 3300048929 Unclassified 1331
111 Ga0501031_0018657 3300049568 Bacteria 4518
112 Ga0501032_0213107 3300049569 Unclassified 1259
113 Ga0501033_0001862 3300049570 Bacteria 18338
114 Ga0501033_0120982 3300049570 Bacteria 1900
115 Ga0501034_0002825 3300049571 Bacteria 20269
116 Ga0501034_0024402 3300049571 Bacteria 6151
117 Ga0501034_0028548 3300049571 Bacteria 5679
118 Ga0501034_0050899 3300049571 Bacteria 4176
119 Ga0501034_0090257 3300049571 Bacteria 3062
120 Ga0501036_0097487 3300049572 Bacteria 2485
121 Ga0501037_0008381 3300049573 Bacteria 7580
122 Ga0501038_0033270 3300049574 Bacteria 4542
123 Ga0501038_0166136 3300049574 Bacteria 1790
124 Ga0501039_0051700 3300049575 Bacteria 3179
125 Ga0501040_0122483 3300049576 Bacteria 1825
126 Ga0501041_0064466 3300049577 Bacteria 2244
127 Ga0501043_0073737 3300049579 Bacteria 2681
128 Ga0501046_0090629 3300049580 Unclassified 2352
129 Ga0501046_0197674 3300049580 Bacteria 1497
130 Ga0501047_0305090 3300049581 Bacteria 1434
131 Ga0501048_0083155 3300049582 Bacteria 2257
132 Ga0501068_0098809 3300049584 Bacteria 1808
133 Ga0501069_0018983 3300049585 Bacteria 3713
134 Ga0501070_0041415 3300049586 Bacteria 3837
135 Ga0501072_0116122 3300049588 Bacteria 2131
136 Ga0501073_0020597 3300049589 Bacteria 4756
137 Ga0501073_0216603 3300049589 Bacteria 1323
138 Ga0501075_0057083 3300049591 Bacteria 2939
139 Ga0501075_0236216 3300049591 Unclassified 1394
140 Ga0501075_0251344 3300049591 Bacteria 1347
141 Ga0501076_0087955 3300049592 Bacteria 2497
142 Ga0501076_0201203 3300049592 Bacteria 1626
143 Ga0501079_0005863 3300049741 Bacteria 9192
144 Ga0501079_0072519 3300049741 Bacteria 2661
145 Ga0501080_0011965 3300049742 Bacteria 7948
146 Ga0501080_0053682 3300049742 Unclassified 3753
147 Ga0501081_0005137 3300049743 Bacteria 8427
148 Ga0501081_0107039 3300049743 Bacteria 1983
149 Ga0501035_0059407 3300049822 Bacteria 3405
150 Ga0501044_0007287 3300049823 Bacteria 12154
151 Ga0501044_0143382 3300049823 Bacteria 2376
152 Ga0501045_0071793 3300049824 Bacteria 2548
153 nmdc:mga03683_154877_c1 3300050489 Bacteria 1036
154 nmdc:mga03n38_76262_c1 3300050490 Bacteria 1564
155 nmdc:mga0yw44_1916_c1 3300050492 Bacteria 8593
156 nmdc:mga0yw44_42945_c1 3300050492 Bacteria 2698
157 nmdc:mga06z11_2201_c1 3300050494 Bacteria 7403
158 nmdc:mga04h51_1858_c1 3300050495 Bacteria 4934
159 nmdc:mga04h51_44978_c1 3300050495 Bacteria 1458
160 nmdc:mga05p37_161512_c1 3300050507 Bacteria 2736
161 nmdc:mga05p37_87082_c1 3300050507 Bacteria 3849
162 nmdc:mga0qj67_312754_c1 3300050509 Bacteria 1272
163 nmdc:mga06r32_81725_c1 3300050510 Bacteria 3147
164 nmdc:mga08x19_189546_c1 3300050514 Bacteria 1406
165 nmdc:mga0sz30_3307_c2 3300050516 Bacteria 4658
166 Ga0500556_0000176 3300053104 Bacteria 52698
167 Ga0500652_047267 3300053131 Bacteria 1749
168 Ga0500568_0000054 3300053139 Bacteria 111105
169 Ga0500568_0056894 3300053139 Bacteria 1523
170 Ga0500616_0083322 3300053153 Bacteria 1602
171 Ga0500620_000428 3300053155 Bacteria 7658
172 Ga0500627_0100271 3300053158 Bacteria 1299
173 Ga0500645_022504 3300053730 Bacteria 1937
174 Ga0501084_0122371 3300054114 Bacteria 2188
175 Ga0501082_0003668 3300060353 Bacteria 13416
176 Ga0501082_0081843 3300060353 Bacteria 2786
177 Ga0530510_0008678 3300061734 Bacteria 7104
178 Ga0530510_0087612 3300061734 Bacteria 2268
179 2514417813 2513237305 Bacteria 7293571
180 2523104871 2522572158 Bacteria 6514390
181 2644129443 2643221623 Bacteria 5239945
182 2723575968 2721755686 Bacteria 7343952
183 2739307115 2738543024 Bacteria 5603683
184 2821446324 2821443989 Bacteria 7658172
185 2842338822 2842333319 Bacteria 8899485
186 2844538429 2844533157 Bacteria 7517899
187 2871495343 2871488783 Bacteria 6929816
188 2874128252 2874123672 Bacteria 7238285
189 2878757991 2878753008 Bacteria 6922523
190 2881155882 2881155292 Bacteria 6461656
191 2881860524 2881853255 Bacteria 6698367
192 2881865063 2881861095 Bacteria 7128710
193 2882918068 2882912400 Bacteria 6801539
194 2883580300 2883577096 Bacteria 4709178
195 2885322293 2885318864 Bacteria 6729568
196 2885354203 2885350715 Bacteria 6787678
197 2894775464 2894772417 Bacteria 5305674
198 2903502111 2903492973 Bacteria 13473544
199 2917555501 2917554339 Bacteria 4987857
200 2919451057 2919450847 Bacteria 5631160
201 2924765650 2924762789 Bacteria 6561353
202 2924784703 2924784321 Bacteria 7416538
203 2937848145 2937843397 Bacteria 5256375
204 2961134462 2961127735 Bacteria 7196641
205 2961174564 2961170736 Bacteria 7072258
206 2968000556 2967996073 Bacteria 6787468
207 2968010072 2968003550 Bacteria 6929263
208 2970507151 2970503327 Bacteria 7099517
209 2977828935 2977821940 Bacteria 6906439
210 2977831724 2977828996 Bacteria 7007971
211 2979812346 2979808191 Bacteria 7179355
212 2987668613 2987666974 Bacteria 6509233
213 8001848448 8001845381 Bacteria 5804942
214 8002289099 8002285264 Bacteria 6717907
215 8004379503 8004374579 Bacteria 6898112
216 Ga0501047_0227043
217 JGI25151J46595_10000314
218 JGI25406J46586_10001295
219 Ga0070690_100033952
220 Ga0070682_100071540
221 Ga0068868_100016384
222 Ga0070692_10002308
223 Ga0070692_10060902
224 Ga0070667_100154351
225 Ga0070694_100000008
226 Ga0070708_100048037
227 Ga0070707_100075443
228 Ga0070679_100253929
229 Ga0070665_100424823
230 Ga0081455_10126069
231 Ga0081538_10011883
232 Ga0081540_1015453
233 Ga0081540_1035934
234 Ga0081539_10001435
235 Ga0081539_10024507
236 Ga0081539_10048819
237 Ga0075365_10037043
238 Ga0075365_10038987
239 Ga0075365_10197002
240 Ga0075368_10077657
241 Ga0075367_10040402
242 Ga0075369_10012690
243 Ga0075370_10158261
244 Ga0075428_100156576
245 Ga0075430_100055738
246 Ga0075430_100152098
247 Ga0075431_100029132
248 Ga0075436_100169326
249 Ga0075435_100231186
250 Ga0111539_10425876
251 Ga0114129_10013104
252 Ga0114129_10176288
253 Ga0105243_10199264
254 Ga0105241_10257055
255 Ga0105242_10107125
256 Ga0105028_101814
257 Ga0105239_10203128
258 Ga0157369_10004028
259 Ga0157375_10371880
260 Ga0182008_10022425
261 Ga0213872_10001414
262 Ga0213872_10044166
263 Ga0213872_10080386
264 Ga0213875_10009574
265 Ga0213875_10017668
266 Ga0209130_1000300
267 Ga0209025_1000084
268 Ga0209758_1003129
269 Ga0207426_1000311
270 Ga0207705_10049503
271 Ga0207695_10178983
272 Ga0207646_10067024
273 Ga0207669_10028057
274 Ga0207679_10273502
275 Ga0207678_10252713
276 Ga0209813_10019439
277 Ga0209813_10023149
278 Ga0268266_10012600
279 Ga0265338_10031566
280 Ga0265330_10030885
281 Ga0265328_10023712
282 Ga0265325_10014579
283 Ga0265325_10038789
284 Ga0265339_10004217
285 Ga0265339_10049160
286 Ga0265316_10159112
287 Ga0307513_10031741
288 Ga0265314_10045235
289 Ga0316576_10149356
290 Ga0316576_10167416
291 Ga0316578_10118511
292 Ga0307516_10094375
293 Ga0316577_10079032
294 Ga0373947_0034884
295 Ga0373937_0003290
296 Ga0316584_0054280
297 Ga0316584_0103702
298 Ga0436364_1074949
299 Ga0436364_1106604
300 Ga0436364_1241653
301 Ga0436365_1834493
302 Ga0436360_0626991
303 Ga0436360_1004508
304 Ga0436361_0148527
305 Ga0436361_0192302
306 Ga0436361_1002359
307 Ga0436361_1139630
308 Ga0436361_1210897
309 Ga0436363_1579553
310 Ga0439458_0022358
311 Ga0439435_0005444
312 Ga0466963_0284330
313 Ga0495638_0007723
314 Ga0495610_0014001
315 Ga0495637_0074231
316 Ga0495643_0050978
317 Ga0495597_0074530
318 Ga0495625_0040511
319 Ga0495686_0099033
320 Ga0496119_0000416
321 Ga0496119_0056872
322 Ga0496120_0028389
323 Ga0496122_0001164
324 Ga0496123_0003355
325 Ga0496126_0298228
326 Ga0501031_0018657
327 Ga0501032_0213107
328 Ga0501033_0001862
329 Ga0501033_0120982
330 Ga0501034_0002825
331 Ga0501034_0024402
332 Ga0501034_0028548
333 Ga0501034_0050899
334 Ga0501034_0090257
335 Ga0501036_0097487
336 Ga0501037_0008381
337 Ga0501038_0033270
338 Ga0501038_0166136
339 Ga0501039_0051700
340 Ga0501040_0122483
341 Ga0501041_0064466
342 Ga0501043_0073737
343 Ga0501046_0090629
344 Ga0501046_0197674
345 Ga0501047_0305090
346 Ga0501048_0083155
347 Ga0501068_0098809
348 Ga0501069_0018983
349 Ga0501070_0041415
350 Ga0501072_0116122
351 Ga0501073_0020597
352 Ga0501073_0216603
353 Ga0501075_0057083
354 Ga0501075_0236216
355 Ga0501075_0251344
356 Ga0501076_0087955
357 Ga0501076_0201203
358 Ga0501079_0005863
359 Ga0501079_0072519
360 Ga0501080_0011965
361 Ga0501080_0053682
362 Ga0501081_0005137
363 Ga0501081_0107039
364 Ga0501035_0059407
365 Ga0501044_0007287
366 Ga0501044_0143382
367 Ga0501045_0071793
368 nmdc:mga03683_154877_c1
369 nmdc:mga03n38_76262_c1
370 nmdc:mga0yw44_1916_c1
371 nmdc:mga0yw44_42945_c1
372 nmdc:mga06z11_2201_c1
373 nmdc:mga04h51_1858_c1
374 nmdc:mga04h51_44978_c1
375 nmdc:mga05p37_161512_c1
376 nmdc:mga05p37_87082_c1
377 nmdc:mga0qj67_312754_c1
378 nmdc:mga06r32_81725_c1
379 nmdc:mga08x19_189546_c1
380 nmdc:mga0sz30_3307_c2
381 Ga0500556_0000176
382 Ga0500652_047267
383 Ga0500568_0000054
384 Ga0500568_0056894
385 Ga0500616_0083322
386 Ga0500620_000428
387 Ga0500627_0100271
388 Ga0500645_022504
389 Ga0501084_0122371
390 Ga0501082_0003668
391 Ga0501082_0081843
392 Ga0530510_0008678
393 Ga0530510_0087612
394 2514417813
395 2523104871
396 2644129443
397 2723575968
398 2739307115
399 2821446324
400 2842338822
401 2844538429
402 2871495343
403 2874128252
404 2878757991
405 2881155882
406 2881860524
407 2881865063
408 2882918068
409 2883580300
410 2885322293
411 2885354203
412 2894775464
413 2903502111
414 2917555501
415 2919451057
416 2924765650
417 2924784703
418 2937848145
419 2961134462
420 2961174564
421 2968000556
422 2968010072
423 2970507151
424 2977828935
425 2977831724
426 2979812346
427 2987668613
428 8001848448
429 8002289099
430 8004379503

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3b7f-assembly1.cif.gz_A crystal structure of a putative glycosyl hydrolase with bnr repeats (reut_b4987) from ralstonia eutropha jmp134 at 2.20 a resolution 0.9266 1 356
3b7f-assembly1.cif.gz_A crystal structure of a putative glycosyl hydrolase with bnr repeats (reut_b4987) from ralstonia eutropha jmp134 at 2.20 a resolution 0.9141 1 356
7jyp-assembly1.cif.gz_A-2 structure of thioredoxin reductase from the thermophilic eubacterium thermosipho africanus tcf52b 0.8172 89 116
4j77-assembly2.cif.gz_B crystal structure of beta'-cop/hwbp1 complex 0.7714 39 341
2ynn-assembly2.cif.gz_A yeast betaprime cop 1-304 with ktktn motif 0.7614 39 341
ID Description Score Start End Superfamily
3b7fA00 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9182 1 356 2.130.10.10
3b7fA00 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9033 1 356 2.130.10.10
af_A0A1D6FYR6_710_903_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7563 30 235 2.130.10.10
af_P9WHH1_16_305_2.30.40.10 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.7491 93 116 2.30.40.10
3sfzA06 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7481 9 325 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A841PKR1-F1-model_v4 Photosystem II stability/assembly factor-like uncharacterized protein 0.996 39 360 GO:0000272
GO:0010411
GO:0016798
AF-A0A531M617-F1-model_v4 Exo-alpha-sialidase 0.9959 93 274 GO:0000272
GO:0010411
GO:0016798
AF-A0A257WU66-F1-model_v4 Glycosyl hydrolase 0.9951 291 354 GO:0016787
AF-A0A841PKR1-F1-model_v4 Photosystem II stability/assembly factor-like uncharacterized protein 0.9929 39 360 GO:0000272
GO:0010411
GO:0016798
AF-A0A2E4YYQ2-F1-model_v4 Glycoside hydrolase 0.9926 247 354 GO:0010411
GO:0016787

Map