F326610

General Info

Members Datasets Scaffolds Average Seq Length
215 156 188 115

Family's Representative Sequence

Representative Sequence 3300031911|Ga0307412_10003187|Ga0307412_100031877
Length 122
Sequence MAMHIKNKKMKFKKDPFFDGNSEWEDLGGGVSRQFVGYNSQVMMVIVKFEKDAIGALHQHFHSQITYVASGKFEVTVDGEVKILQKGDGFFAQPTIFHGVKCLEEGQLIDAFTPFREDFLKD

Samples

Sample ID Description Type Environment
1 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
2 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
3 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
4 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
5 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
6 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
7 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
8 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
9 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
10 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
11 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
12 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
13 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
14 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
15 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
16 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
17 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
18 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
19 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
20 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
21 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
22 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
23 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
24 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
25 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
26 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
27 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
28 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
29 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
30 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
31 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
33 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
34 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
63 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
98 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
99 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
100 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
104 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
105 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
108 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
109 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
110 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
111 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
112 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
113 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
114 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
115 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
116 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
117 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
118 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
119 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
120 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
121 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
122 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
125 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
126 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
127 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
128 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
129 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
130 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
131 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
133 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
134 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
135 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
136 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
137 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
139 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
140 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
141 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
142 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
143 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
144 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
145 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
146 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
147 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
148 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
149 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
150 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
151 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
152 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
153 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
154 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
155 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
156 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.44
Metatranscriptomes 0
Isolates 12.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.84
Nodule 0.47
Rhizoplane 0.47
Rhizosphere 79.53
Stem 0
Stem Tuber 0
Unclassified 10.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10385130 3300003322 Bacteria 1687
2 rootH1_10195105 3300003323 Bacteria 1960
3 Ga0055534_1009033 3300003784 Bacteria 2201
4 Ga0065714_10022946 3300005288 Bacteria 1358
5 Ga0065714_10067020 3300005288 Bacteria 5988
6 Ga0065714_10078700 3300005288 Bacteria 2576
7 Ga0065714_10132538 3300005288 Bacteria 1237
8 Ga0065704_10232733 3300005289 Bacteria 1038
9 Ga0065704_10828751 3300005289 Bacteria 516
10 Ga0065715_10041753 3300005293 Bacteria 1375
11 Ga0065715_10191762 3300005293 Bacteria 1411
12 Ga0065707_10313308 3300005295 Bacteria 980
13 Ga0070670_100052029 3300005331 Bacteria 3517
14 Ga0070670_100500712 3300005331 Bacteria 1080
15 Ga0070670_100510348 3300005331 Bacteria 1070
16 Ga0070682_100001009 3300005337 Bacteria 16310
17 Ga0070689_101700519 3300005340 Bacteria 574
18 Ga0070675_100329958 3300005354 Bacteria 1349
19 Ga0070671_101201920 3300005355 Bacteria 667
20 Ga0070698_100010425 3300005471 Bacteria 9923
21 Ga0070699_100589699 3300005518 Unclassified 1013
22 Ga0068853_100037890 3300005539 Unclassified 4105
23 Ga0068853_100249759 3300005539 Bacteria 1627
24 Ga0068853_101273115 3300005539 Unclassified 710
25 Ga0070665_101089706 3300005548 Bacteria 810
26 Ga0068855_100743593 3300005563 Bacteria 1046
27 Ga0070664_101531925 3300005564 Bacteria 631
28 Ga0068857_100319325 3300005577 Bacteria 1434
29 Ga0068857_101776551 3300005577 Bacteria 603
30 Ga0068852_102787153 3300005616 Unclassified 507
31 Ga0068859_100019701 3300005617 Bacteria 6776
32 Ga0068859_101160712 3300005617 Unclassified 850
33 Ga0068864_100008678 3300005618 Bacteria 8387
34 Ga0068861_100267580 3300005719 Bacteria 1466
35 Ga0068851_10333789 3300005834 Bacteria 878
36 Ga0068863_100003513 3300005841 Bacteria 15466
37 Ga0068862_101586501 3300005844 Bacteria 661
38 Ga0081539_10259929 3300005985 Bacteria 766
39 Ga0097621_102307953 3300006237 Bacteria 515
40 Ga0068871_100998626 3300006358 Bacteria 779
41 Ga0075428_100541582 3300006844 Bacteria 1244
42 Ga0075428_101694013 3300006844 Bacteria 660
43 Ga0075430_100001752 3300006846 Bacteria 17715
44 Ga0075431_100009205 3300006847 Bacteria 9908
45 Ga0075434_100748248 3300006871 Unclassified 994
46 Ga0097620_100019701 3300006931 Bacteria 6776
47 Ga0097620_101160842 3300006931 Unclassified 850
48 Ga0105244_10000124 3300009036 Bacteria 78977
49 Ga0105250_10142527 3300009092 Bacteria 994
50 Ga0111539_10640491 3300009094 Bacteria 1238
51 Ga0111539_10865137 3300009094 Unclassified 1052
52 Ga0114129_10064999 3300009147 Bacteria 5092
53 Ga0105241_11187562 3300009174 Bacteria 722
54 Ga0105242_11267508 3300009176 Unclassified 759
55 Ga0105249_10001099 3300009553 Bacteria 24057
56 Ga0105249_10007079 3300009553 Bacteria 9789
57 Ga0105249_12548122 3300009553 Bacteria 584
58 Ga0105239_10892058 3300010375 Unclassified 1020
59 Ga0157373_10000006 3300013100 Bacteria 261768
60 Ga0157371_10015502 3300013102 Bacteria 5717
61 Ga0157370_10064351 3300013104 Bacteria 3472
62 Ga0157370_10266598 3300013104 Bacteria 1582
63 Ga0157370_11637610 3300013104 Bacteria 578
64 Ga0157369_10678143 3300013105 Bacteria 1062
65 Ga0157374_10536155 3300013296 Unclassified 1177
66 Ga0157374_12185508 3300013296 Bacteria 580
67 Ga0157372_10151800 3300013307 Bacteria 2674
68 Ga0157372_10422938 3300013307 Bacteria 1553
69 Ga0157375_10000218 3300013308 Bacteria 53847
70 Ga0157375_10099100 3300013308 Bacteria 2993
71 Ga0157375_10154654 3300013308 Bacteria 2431
72 Ga0157375_11868313 3300013308 Bacteria 713
73 Ga0157375_12091193 3300013308 Bacteria 674
74 Ga0163163_11439703 3300014325 Bacteria 751
75 Ga0157380_10048905 3300014326 Bacteria 3333
76 Ga0157380_10081631 3300014326 Unclassified 2645
77 Ga0157380_11446662 3300014326 Bacteria 739
78 Ga0182008_10000003 3300014497 Bacteria 456880
79 Ga0163161_10000881 3300017792 Bacteria 23363
80 Ga0163161_10051458 3300017792 Bacteria 2983
81 Ga0209675_1000572 3300025291 Bacteria 26575
82 Ga0207656_10400443 3300025321 Bacteria 690
83 Ga0207696_1074373 3300025711 Bacteria 942
84 Ga0207655_1004071 3300025728 Bacteria 10526
85 Ga0207710_10061168 3300025900 Unclassified 1708
86 Ga0207644_11037847 3300025931 Bacteria 688
87 Ga0207667_12099452 3300025949 Bacteria 524
88 Ga0207712_10002639 3300025961 Bacteria 11477
89 Ga0207639_10072749 3300026041 Bacteria 2692
90 Ga0207639_10084115 3300026041 Bacteria 2527
91 Ga0207639_10286838 3300026041 Bacteria 1450
92 Ga0207708_10370068 3300026075 Bacteria 1180
93 Ga0207702_10206832 3300026078 Bacteria 1822
94 Ga0207641_10000013 3300026088 Bacteria 341378
95 Ga0207676_10011544 3300026095 Bacteria 6318
96 Ga0207674_10983848 3300026116 Bacteria 813
97 Ga0207674_11030227 3300026116 Bacteria 792
98 Ga0207675_101229583 3300026118 Bacteria 769
99 Ga0207675_101500023 3300026118 Bacteria 695
100 Ga0207675_101530864 3300026118 Bacteria 688
101 Ga0207698_11944938 3300026142 Unclassified 603
102 Ga0307515_10048847 3300028794 Bacteria 6388
103 Ga0265327_10000159 3300031251 Bacteria 145537
104 Ga0307513_10708780 3300031456 Bacteria 712
105 Ga0307509_10479107 3300031507 Bacteria 933
106 Ga0307412_10000028 3300031911 Bacteria 213966
107 Ga0307412_10003187 3300031911 Bacteria 9111
108 Ga0307412_10022270 3300031911 Bacteria 3882
109 Ga0307412_11487010 3300031911 Bacteria 615
110 Ga0307416_100000076 3300032002 Bacteria 73123
111 Ga0307414_10000004 3300032004 Bacteria 472218
112 Ga0307414_10183287 3300032004 Bacteria 1686
113 Ga0307414_10340597 3300032004 Bacteria 1283
114 Ga0307414_10406957 3300032004 Bacteria 1183
115 Ga0307414_10628297 3300032004 Bacteria 966
116 Ga0307414_10673290 3300032004 Bacteria 934
117 Ga0307510_10011424 3300033180 Bacteria 10548
118 Ga0451843_0055253 3300041509 Bacteria 1215
119 Ga0451843_1493911 3300041509 Bacteria 1578
120 Ga0466959_0636083 3300045049 Unclassified 717
121 Ga0495627_000029 3300046453 Bacteria 232349
122 Ga0495638_0152614 3300046460 Bacteria 1339
123 Ga0495638_0336102 3300046460 Bacteria 802
124 Ga0495606_0012119 3300046507 Bacteria 6953
125 Ga0495606_0013116 3300046507 Bacteria 6579
126 Ga0495610_0000001 3300046512 Bacteria 1620061
127 Ga0495632_0001366 3300046519 Bacteria 20490
128 Ga0495643_0181513 3300046522 Bacteria 1022
129 Ga0495663_0000094 3300046525 Bacteria 38834
130 Ga0495663_0006994 3300046525 Bacteria 3112
131 Ga0495654_0000008 3300046530 Bacteria 398340
132 Ga0495609_0000010 3300046538 Bacteria 342605
133 Ga0495621_0052305 3300046539 Bacteria 1464
134 Ga0495633_0000048 3300046558 Bacteria 158166
135 Ga0495633_0001088 3300046558 Bacteria 21932
136 Ga0495668_0000339 3300046616 Bacteria 62659
137 Ga0495625_0001356 3300046660 Bacteria 30163
138 Ga0495671_0050393 3300046692 Bacteria 2073
139 Ga0495660_0174925 3300046810 Bacteria 1043
140 Ga0495686_0000408 3300047472 Bacteria 67911
141 Ga0495686_0002965 3300047472 Bacteria 15133
142 Ga0495686_0003582 3300047472 Bacteria 13334
143 Ga0495686_0019034 3300047472 Unclassified 4593
144 Ga0495686_0111475 3300047472 Bacteria 1640
145 Ga0495686_0194599 3300047472 Bacteria 1167
146 Ga0496114_1025533 3300048917 Bacteria 709
147 Ga0496116_0088008 3300048919 Bacteria 1899
148 Ga0496117_0003761 3300048920 Bacteria 17370
149 Ga0496117_0088714 3300048920 Bacteria 2000
150 Ga0496118_0045815 3300048921 Bacteria 3408
151 Ga0496122_0189831 3300048925 Bacteria 1214
152 Ga0496124_0142680 3300048927 Bacteria 1888
153 Ga0496125_0059490 3300048928 Bacteria 3078
154 Ga0496125_0080726 3300048928 Bacteria 2488
155 Ga0496126_0000114 3300048929 Bacteria 188605
156 Ga0496126_0173177 3300048929 Bacteria 1837
157 Ga0496126_0862973 3300048929 Bacteria 689
158 Ga0501033_0062256 3300049570 Bacteria 2748
159 Ga0501240_106891 3300049673 Bacteria 543
160 Ga0501249_000011 3300049679 Bacteria 168084
161 Ga0501251_027985 3300049681 Bacteria 788
162 Ga0501241_000005 3300049758 Bacteria 176449
163 Ga0501269_000243 3300049766 Bacteria 15774
164 Ga0501035_0026219 3300049822 Bacteria 5334
165 Ga0501212_114204 3300049851 Unclassified 518
166 nmdc:mga05p37_184689_c1 3300050507 Bacteria 2535
167 nmdc:mga09592_32222_c1 3300050508 Bacteria 4370
168 nmdc:mga06r32_1432816_c1 3300050510 Bacteria 632
169 nmdc:mga06r32_54713_c1 3300050510 Bacteria 3827
170 nmdc:mga08y16_575921_c1 3300050511 Bacteria 1137
171 nmdc:mga0n895_1527530_c1 3300050512 Bacteria 633
172 Ga0500644_0000327 3300053088 Bacteria 24662
173 Ga0500644_0268246 3300053088 Bacteria 724
174 Ga0500581_203927 3300053089 Unclassified 875
175 Ga0500646_0011172 3300053090 Bacteria 2306
176 Ga0500646_0168209 3300053090 Bacteria 736
177 Ga0500641_0000018 3300053096 Bacteria 132142
178 Ga0500562_000117 3300053108 Bacteria 26644
179 Ga0500655_011204 3300053133 Bacteria 1624
180 Ga0500655_098659 3300053133 Bacteria 611
181 Ga0500561_0034812 3300053137 Bacteria 1296
182 Ga0500616_0133549 3300053153 Bacteria 1170
183 Ga0500622_0000176 3300053156 Bacteria 69125
184 Ga0500633_0007555 3300053160 Bacteria 2745
185 Ga0500611_000020 3300053727 Bacteria 105250
186 Ga0500645_169269 3300053730 Bacteria 597
187 Ga0500661_002043 3300055283 Bacteria 3810
188 Ga0500661_034209 3300055283 Unclassified 897

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005289 Ga0065704_10828751 Ga0065704_108287511 93
2 iso_pu_bacteria 2721755487 2722727457 106
3 iso_pu_bacteria 2904780799 2904781775 106
4 iso_pu_bacteria 2919177583 2919181533 106
5 iso_pu_bacteria 2993480792 2993483074 107
6 iso_pu_bacteria 2511231000 2511233994 108
7 iso_pu_bacteria 2582581278 2585144818 108
8 iso_pu_bacteria 2582581281 2585157004 108
9 iso_pu_bacteria 2582581282 2585161523 108
10 iso_pu_bacteria 2585428061 2587753781 108
11 iso_pu_bacteria 2585428095 2587865077 108
12 iso_pu_bacteria 2585428115 2587942484 108
13 iso_pu_bacteria 2585428182 2588207980 108
14 iso_pu_bacteria 2585428183 2588213473 108
15 iso_pu_bacteria 2585428187 2588231058 108
16 iso_pu_bacteria 2588254257 2590612929 108
17 iso_pu_bacteria 2765235839 2765572452 108
18 iso_pu_bacteria 2775506739 2775673177 108
19 iso_pu_bacteria 2816332188 2816873182 108
20 iso_pu_bacteria 2842083920 2842087927 108
21 iso_pu_bacteria 2871720351 2871722505 108
22 iso_pu_bacteria 2889290771 2889291774 108
23 iso_pu_bacteria 2905999023 2905999800 108
24 iso_pu_bacteria 2919097161 2919097262 108
25 iso_pu_bacteria 2945924605 2945928629 108
26 iso_pu_bacteria 2946019816 2946020828 108
27 iso_pu_bacteria 2993372514 2993376261 108
28 3300005289 Ga0065704_10232733 Ga0065704_102327332 110
29 3300048919 Ga0496116_0088008 Ga0496116_0088008_476_814 110
30 3300048920 Ga0496117_0003761 Ga0496117_0003761_15675_16013 110
31 3300048925 Ga0496122_0189831 Ga0496122_0189831_479_817 110
32 3300048928 Ga0496125_0080726 Ga0496125_0080726_1313_1651 110
33 3300048929 Ga0496126_0862973 Ga0496126_0862973_29_367 110
34 iso_pu_bacteria 2643221667 2644370417 111
35 3300003784 Ga0055534_1009033 Ga0055534_10090333 112
36 3300005288 Ga0065714_10067020 Ga0065714_100670206 112
37 3300005288 Ga0065714_10132538 Ga0065714_101325382 112
38 3300005337 Ga0070682_100001009 Ga0070682_1000010096 112
39 3300005564 Ga0070664_101531925 Ga0070664_1015319252 112
40 3300006844 Ga0075428_100541582 Ga0075428_1005415822 112
41 3300006846 Ga0075430_100001752 Ga0075430_1000017529 112
42 3300006847 Ga0075431_100009205 Ga0075431_10000920511 112
43 3300009036 Ga0105244_10000124 Ga0105244_1000012453 112
44 3300009092 Ga0105250_10142527 Ga0105250_101425272 112
45 3300013100 Ga0157373_10000006 Ga0157373_10000006220 112
46 3300013102 Ga0157371_10015502 Ga0157371_100155023 112
47 3300013104 Ga0157370_10064351 Ga0157370_100643512 112
48 3300013104 Ga0157370_10266598 Ga0157370_102665982 112
49 3300013105 Ga0157369_10678143 Ga0157369_106781432 112
50 3300013308 Ga0157375_10000218 Ga0157375_1000021818 112
51 3300013308 Ga0157375_10099100 Ga0157375_100991003 112
52 3300013308 Ga0157375_10154654 Ga0157375_101546542 112
53 3300014497 Ga0182008_10000003 Ga0182008_10000003397 112
54 3300017792 Ga0163161_10000881 Ga0163161_1000088111 112
55 3300017792 Ga0163161_10051458 Ga0163161_100514583 112
56 3300025291 Ga0209675_1000572 Ga0209675_100057220 112
57 3300025711 Ga0207696_1074373 Ga0207696_10743732 112
58 3300025728 Ga0207655_1004071 Ga0207655_10040712 112
59 3300031911 Ga0307412_10000028 Ga0307412_100000285 112
60 3300031911 Ga0307412_10003187 Ga0307412_100031877 112
61 3300031911 Ga0307412_10022270 Ga0307412_100222703 112
62 3300032002 Ga0307416_100000076 Ga0307416_10000007644 112
63 3300032004 Ga0307414_10000004 Ga0307414_1000000410 112
64 3300032004 Ga0307414_10183287 Ga0307414_101832872 112
65 3300032004 Ga0307414_10340597 Ga0307414_103405972 112
66 3300032004 Ga0307414_10406957 Ga0307414_104069571 112
67 3300032004 Ga0307414_10628297 Ga0307414_106282971 112
68 3300032004 Ga0307414_10673290 Ga0307414_106732902 112
69 3300046453 Ga0495627_000029 Ga0495627_000029_107700_108041 112
70 3300046460 Ga0495638_0152614 Ga0495638_0152614_204_545 112
71 3300046507 Ga0495606_0012119 Ga0495606_0012119_3069_3410 112
72 3300046507 Ga0495606_0013116 Ga0495606_0013116_1269_1607 112
73 3300046512 Ga0495610_0000001 Ga0495610_0000001_1070401_1070742 112
74 3300046519 Ga0495632_0001366 Ga0495632_0001366_15998_16339 112
75 3300046522 Ga0495643_0181513 Ga0495643_0181513_24_365 112
76 3300046525 Ga0495663_0000094 Ga0495663_0000094_9257_9598 112
77 3300046525 Ga0495663_0006994 Ga0495663_0006994_2268_2609 112
78 3300046530 Ga0495654_0000008 Ga0495654_0000008_289951_290292 112
79 3300046538 Ga0495609_0000010 Ga0495609_0000010_122489_122830 112
80 3300046558 Ga0495633_0000048 Ga0495633_0000048_124395_124736 112
81 3300046558 Ga0495633_0001088 Ga0495633_0001088_4895_5236 112
82 3300046660 Ga0495625_0001356 Ga0495625_0001356_26387_26728 112
83 3300046810 Ga0495660_0174925 Ga0495660_0174925_528_869 112
84 3300047472 Ga0495686_0000408 Ga0495686_0000408_4473_4814 112
85 3300047472 Ga0495686_0002965 Ga0495686_0002965_10201_10542 112
86 3300048917 Ga0496114_1025533 Ga0496114_1025533_306_647 112
87 3300048920 Ga0496117_0088714 Ga0496117_0088714_820_1161 112
88 3300048921 Ga0496118_0045815 Ga0496118_0045815_1778_2119 112
89 3300048927 Ga0496124_0142680 Ga0496124_0142680_1142_1483 112
90 3300048928 Ga0496125_0059490 Ga0496125_0059490_1472_1813 112
91 3300048929 Ga0496126_0000114 Ga0496126_0000114_37343_37684 112
92 3300049758 Ga0501241_000005 Ga0501241_000005_142495_142836 112
93 3300049766 Ga0501269_000243 Ga0501269_000243_11534_11896 112
94 3300053089 Ga0500581_203927 Ga0500581_203927_282_623 112
95 3300055283 Ga0500661_002043 Ga0500661_002043_2348_2686 112
96 3300005331 Ga0070670_100510348 Ga0070670_1005103482 113
97 3300006237 Ga0097621_102307953 Ga0097621_1023079531 113
98 3300006358 Ga0068871_100998626 Ga0068871_1009986262 113
99 3300013308 Ga0157375_12091193 Ga0157375_120911932 113
100 3300026078 Ga0207702_10206832 Ga0207702_102068322 113
101 3300045049 Ga0466959_0636083 Ga0466959_0636083_26_373 113
102 3300005617 Ga0068859_101160712 Ga0068859_1011607122 114
103 3300006871 Ga0075434_100748248 Ga0075434_1007482482 114
104 3300006931 Ga0097620_101160842 Ga0097620_1011608421 114
105 3300010375 Ga0105239_10892058 Ga0105239_108920582 114
106 3300013307 Ga0157372_10151800 Ga0157372_101518003 114
107 3300013307 Ga0157372_10422938 Ga0157372_104229382 114
108 3300049673 Ga0501240_106891 Ga0501240_106891_73_423 114
109 3300049851 Ga0501212_114204 Ga0501212_114204_26_376 114
110 3300050512 nmdc:mga0n895_1527530_c1 nmdc:mga0n895_1527530_c1_175_549 114
111 3300053090 Ga0500646_0168209 Ga0500646_0168209_189_533 114
112 3300053108 Ga0500562_000117 Ga0500562_000117_11524_11868 114
113 3300053133 Ga0500655_098659 Ga0500655_098659_108_452 114
114 3300053156 Ga0500622_0000176 Ga0500622_0000176_13811_14155 114
115 3300055283 Ga0500661_034209 Ga0500661_034209_266_610 114
116 3300003322 rootL2_10385130 rootL2_103851302 115
117 3300003323 rootH1_10195105 rootH1_101951051 115
118 3300005288 Ga0065714_10022946 Ga0065714_100229462 115
119 3300005288 Ga0065714_10078700 Ga0065714_100787003 115
120 3300005293 Ga0065715_10041753 Ga0065715_100417532 115
121 3300005293 Ga0065715_10191762 Ga0065715_101917622 115
122 3300005295 Ga0065707_10313308 Ga0065707_103133082 115
123 3300005331 Ga0070670_100052029 Ga0070670_1000520292 115
124 3300005331 Ga0070670_100500712 Ga0070670_1005007122 115
125 3300005340 Ga0070689_101700519 Ga0070689_1017005191 115
126 3300005354 Ga0070675_100329958 Ga0070675_1003299582 115
127 3300005355 Ga0070671_101201920 Ga0070671_1012019201 115
128 3300005471 Ga0070698_100010425 Ga0070698_1000104255 115
129 3300005518 Ga0070699_100589699 Ga0070699_1005896992 115
130 3300005539 Ga0068853_100037890 Ga0068853_1000378902 115
131 3300005539 Ga0068853_100249759 Ga0068853_1002497592 115
132 3300005539 Ga0068853_101273115 Ga0068853_1012731151 115
133 3300005548 Ga0070665_101089706 Ga0070665_1010897061 115
134 3300005563 Ga0068855_100743593 Ga0068855_1007435931 115
135 3300005577 Ga0068857_100319325 Ga0068857_1003193252 115
136 3300005577 Ga0068857_101776551 Ga0068857_1017765512 115
137 3300005616 Ga0068852_102787153 Ga0068852_1027871531 115
138 3300005617 Ga0068859_100019701 Ga0068859_1000197012 115
139 3300005618 Ga0068864_100008678 Ga0068864_1000086789 115
140 3300005719 Ga0068861_100267580 Ga0068861_1002675802 115
141 3300005834 Ga0068851_10333789 Ga0068851_103337892 115
142 3300005841 Ga0068863_100003513 Ga0068863_1000035136 115
143 3300005844 Ga0068862_101586501 Ga0068862_1015865012 115
144 3300005985 Ga0081539_10259929 Ga0081539_102599292 115
145 3300006844 Ga0075428_101694013 Ga0075428_1016940132 115
146 3300006931 Ga0097620_100019701 Ga0097620_1000197012 115
147 3300009094 Ga0111539_10640491 Ga0111539_106404912 115
148 3300009094 Ga0111539_10865137 Ga0111539_108651372 115
149 3300009147 Ga0114129_10064999 Ga0114129_100649993 115
150 3300009174 Ga0105241_11187562 Ga0105241_111875622 115
151 3300009176 Ga0105242_11267508 Ga0105242_112675082 115
152 3300009553 Ga0105249_10001099 Ga0105249_1000109930 115
153 3300009553 Ga0105249_10007079 Ga0105249_100070795 115
154 3300009553 Ga0105249_12548122 Ga0105249_125481222 115
155 3300013104 Ga0157370_11637610 Ga0157370_116376101 115
156 3300013296 Ga0157374_10536155 Ga0157374_105361552 115
157 3300013296 Ga0157374_12185508 Ga0157374_121855081 115
158 3300013308 Ga0157375_11868313 Ga0157375_118683131 115
159 3300014325 Ga0163163_11439703 Ga0163163_114397031 115
160 3300014326 Ga0157380_10048905 Ga0157380_100489052 115
161 3300014326 Ga0157380_10081631 Ga0157380_100816312 115
162 3300014326 Ga0157380_11446662 Ga0157380_114466622 115
163 3300025321 Ga0207656_10400443 Ga0207656_104004431 115
164 3300025900 Ga0207710_10061168 Ga0207710_100611682 115
165 3300025931 Ga0207644_11037847 Ga0207644_110378471 115
166 3300025949 Ga0207667_12099452 Ga0207667_120994521 115
167 3300025961 Ga0207712_10002639 Ga0207712_100026399 115
168 3300026041 Ga0207639_10072749 Ga0207639_100727492 115
169 3300026041 Ga0207639_10084115 Ga0207639_100841152 115
170 3300026041 Ga0207639_10286838 Ga0207639_102868382 115
171 3300026075 Ga0207708_10370068 Ga0207708_103700682 115
172 3300026088 Ga0207641_10000013 Ga0207641_1000001371 115
173 3300026095 Ga0207676_10011544 Ga0207676_100115442 115
174 3300026116 Ga0207674_10983848 Ga0207674_109838481 115
175 3300026116 Ga0207674_11030227 Ga0207674_110302271 115
176 3300026118 Ga0207675_101229583 Ga0207675_1012295832 115
177 3300026118 Ga0207675_101500023 Ga0207675_1015000232 115
178 3300026118 Ga0207675_101530864 Ga0207675_1015308642 115
179 3300026142 Ga0207698_11944938 Ga0207698_119449381 115
180 3300028794 Ga0307515_10048847 Ga0307515_100488475 115
181 3300031251 Ga0265327_10000159 Ga0265327_100001597 115
182 3300031456 Ga0307513_10708780 Ga0307513_107087802 115
183 3300031507 Ga0307509_10479107 Ga0307509_104791072 115
184 3300031911 Ga0307412_11487010 Ga0307412_114870101 115
185 3300033180 Ga0307510_10011424 Ga0307510_100114248 115
186 3300041509 Ga0451843_0055253 Ga0451843_0055253_712_1059 115
187 3300041509 Ga0451843_1493911 Ga0451843_1493911_139_498 115
188 3300046460 Ga0495638_0336102 Ga0495638_0336102_101_463 115
189 3300046539 Ga0495621_0052305 Ga0495621_0052305_904_1254 115
190 3300046616 Ga0495668_0000339 Ga0495668_0000339_54846_55220 115
191 3300046692 Ga0495671_0050393 Ga0495671_0050393_75_425 115
192 3300047472 Ga0495686_0003582 Ga0495686_0003582_3892_4251 115
193 3300047472 Ga0495686_0019034 Ga0495686_0019034_113_472 115
194 3300047472 Ga0495686_0111475 Ga0495686_0111475_230_589 115
195 3300047472 Ga0495686_0194599 Ga0495686_0194599_27_377 115
196 3300048929 Ga0496126_0173177 Ga0496126_0173177_1397_1786 115
197 3300049570 Ga0501033_0062256 Ga0501033_0062256_34_399 115
198 3300049679 Ga0501249_000011 Ga0501249_000011_158126_158473 115
199 3300049681 Ga0501251_027985 Ga0501251_027985_164_514 115
200 3300049822 Ga0501035_0026219 Ga0501035_0026219_248_613 115
201 3300050507 nmdc:mga05p37_184689_c1 nmdc:mga05p37_184689_c1_783_1133 115
202 3300050508 nmdc:mga09592_32222_c1 nmdc:mga09592_32222_c1_1924_2274 115
203 3300050510 nmdc:mga06r32_1432816_c1 nmdc:mga06r32_1432816_c1_49_399 115
204 3300050510 nmdc:mga06r32_54713_c1 nmdc:mga06r32_54713_c1_115_465 115
205 3300050511 nmdc:mga08y16_575921_c1 nmdc:mga08y16_575921_c1_538_888 115
206 3300053088 Ga0500644_0000327 Ga0500644_0000327_15918_16301 115
207 3300053088 Ga0500644_0268246 Ga0500644_0268246_283_633 115
208 3300053090 Ga0500646_0011172 Ga0500646_0011172_470_820 115
209 3300053096 Ga0500641_0000018 Ga0500641_0000018_127698_128048 115
210 3300053133 Ga0500655_011204 Ga0500655_011204_101_484 115
211 3300053137 Ga0500561_0034812 Ga0500561_0034812_303_686 115
212 3300053153 Ga0500616_0133549 Ga0500616_0133549_145_495 115
213 3300053160 Ga0500633_0007555 Ga0500633_0007555_713_1096 115
214 3300053727 Ga0500611_000020 Ga0500611_000020_51896_52258 115
215 3300053730 Ga0500645_169269 Ga0500645_169269_150_497 115

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

45

111

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zyb-assembly1.cif.gz_A bekdgf with ca 0.9887 8 115
5fpz-assembly1.cif.gz_A-2 the structure of kdgf from yersinia enterocolitica with malonate bound in the active site. 0.9833 9 113
2pfw-assembly1.cif.gz_B crystal structure of a rmlc-like cupin (sfri_3105) from shewanella frigidimarina ncimb 400 at 1.90 a resolution 0.9813 8 113
5fq0-assembly1.cif.gz_A the structure of kdgf from halomonas sp. 0.9733 10 113
5fq0-assembly2.cif.gz_D the structure of kdgf from halomonas sp. 0.9733 10 113
ID Description Score Start End Superfamily
2pfwB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9812 8 113 2.60.120.10
5fpxA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9594 7 108 2.60.120.10
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9492 29 109 2.60.120.10
af_Q17765_350_577_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.945 36 106 2.60.120.650
af_Q55DF5_199_447_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.9444 38 103 2.60.120.650
ID Description Score Start End GO Terms
AF-A0A352P308-F1-model_v4 deleted 1.005 27 113
AF-A0A660X886-F1-model_v4 deleted 1.003 9 115
AF-A0A161LCJ9-F1-model_v4 Chondroitin AC lyase 1.003 9 114 GO:0005576
GO:0005975
GO:0016829
GO:0030246
AF-A0A193KDQ5-F1-model_v4 deleted 1.002 10 113
AF-A0A090QEA4-F1-model_v4 Pectin degradation protein KdgF 1.002 17 114

Feature Viewer

pLDDT pTM Quality
93.97 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map