F326542

General Info

Members Datasets Scaffolds Average Seq Length
215 166 171 540

Family's Representative Sequence

Representative Sequence 3300026121|Ga0207683_10054533|Ga0207683_100545332
Length 584
Sequence MFQNFRLSMTWLHTWFGLVLGYVLMACFFFGSLSVFDREIDRWSIPETRFQPQPMPSYDKVLAPIFSRLRAHPDDIEATAKRVQGTIPPPDTLKPGSFYAYTTHRDPVLAIGGEFDLPNQPIDPADEHVHVHGWATIDPRSGATLPDSALKIGSRFFYPMHYSLHLHWLDLAYWIVGLAALVMLAALVSGVVVHRKIFREFFTFRPKKHTQRSALDLHNLTGVVALPFHFFFAFTGLVIFAGIYLPVSDTMLRPLAKAHEVIEASRTGLPHEPAGAAAPTASIDAMVLEAKRRWAARGMPGEVGLLRIEHFRDANGYVSLYRAGTDRVALVGQGVHFKAATGEVIREDPLPTAVSSINEFLTGLHLQHFEHWLLRWFYVLGGLSGCVCIATGFIFFVEKRKKQHAKAGVGGSRIVDALAVTTVTGMLIATAAILIANRLLPADLPKLGDWEEYSFWAAWVLALVHAFWRTGPVLQARIAPAWREQCWAVAALTVLAVLLNWVTTGDHHRLPLDTVAPCCYRVAPDRPRTHSARHAAPGPSQRLRHGGALGRRHDRRCTDDGPHPSTSSPKTTWPISRCPSAPSR

Samples

Sample ID Description Type Environment
1 2511231024 Pseudomonas sp. GM84 Isolate Nodule
2 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
3 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
4 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
5 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
6 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
7 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
8 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
9 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
10 2643221585 Pelomonas sp. Root662 Isolate Unclassified
11 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
12 2643221609 Acidovorax sp. Root217 Isolate Unclassified
13 2643221611 Acidovorax sp. Root219 Isolate Unclassified
14 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
15 2643221656 Pelomonas sp. Root405 Isolate Unclassified
16 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
17 2721755523 Delftia sp. HK171 Isolate Unclassified
18 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
19 2738541307 Variovorax sp. GV008 Isolate Unclassified
20 2738541337 Pelomonas sp. BT06 Isolate Unclassified
21 2738543012 Acidovorax sp. CF301 Isolate Unclassified
22 2816332133 Acidovorax radicis 2721A Isolate Unclassified
23 2831864461 Roseateles noduli HZ7 Isolate Nodule
24 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
25 2857553236 Duganella sp. R-74557 Isolate Unclassified
26 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
27 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
28 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
29 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
30 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
31 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
32 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
33 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
34 2919476304 Duganella sp. 3397 Isolate Unclassified
35 2919513703 Luteimonas sp. 3794 Isolate Unclassified
36 2919675420 Luteimonas terrae 4099 Isolate Unclassified
37 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
38 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
39 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
40 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
41 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
42 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
43 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
44 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
45 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
46 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
47 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
48 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
49 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
50 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
51 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
52 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
53 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
60 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
61 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
62 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
63 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
72 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
73 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
78 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
88 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
90 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
94 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
95 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
96 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
97 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
98 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
99 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
100 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
101 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
102 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
103 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
104 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
105 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
106 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
107 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
108 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
109 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
110 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
111 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
112 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
113 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
114 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
115 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
116 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
117 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
118 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
119 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
120 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
121 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
122 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
123 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
124 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
125 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
126 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
127 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
128 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
129 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
132 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
133 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
134 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
135 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
136 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
137 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
138 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
139 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
140 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
141 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
142 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
152 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
156 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
157 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
158 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
159 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
160 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
161 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
162 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
163 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
164 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
166 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.07
Metatranscriptomes 0
Isolates 20.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.74
Nodule 3.26
Rhizoplane 2.33
Rhizosphere 48.37
Stem 0
Stem Tuber 0
Unclassified 29.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1012627 3300002987 Bacteria 2004
2 JGI25151J46595_10002029 3300003187 Bacteria 12644
3 JGI25153J46596_10001279 3300003215 Bacteria 15099
4 rootH1_10000502 3300003316 Bacteria 2796
5 rootH1_10000502 3300003323 Bacteria 55195
6 rootH1_10225531 3300003323 Unclassified 2676
7 Ga0055526_1002755 3300003771 Bacteria 11652
8 Ga0055524_1000907 3300003775 Bacteria 19124
9 Ga0055536_1001299 3300003781 Bacteria 15375
10 Ga0065165_1000050 3300005262 Bacteria 195237
11 Ga0065165_1000239 3300005262 Bacteria 94061
12 Ga0065165_1000352 3300005262 Bacteria 75362
13 Ga0065704_10074129 3300005289 Bacteria 6508
14 Ga0068854_100045662 3300005578 Bacteria 3116
15 Ga0075364_10000127 3300006051 Bacteria 31803
16 Ga0075362_10031959 3300006177 Bacteria 2281
17 Ga0075366_10016602 3300006195 Bacteria 4234
18 Ga0075370_10005152 3300006353 Bacteria 6452
19 Ga0099823_1034259 3300006944 Bacteria 4029
20 Ga0079104_1012665 3300006946 Bacteria 2636
21 Ga0099826_10024105 3300006948 Bacteria 4524
22 Ga0105244_10000848 3300009036 Bacteria 25829
23 Ga0105244_10007209 3300009036 Bacteria 7091
24 Ga0105244_10018326 3300009036 Bacteria 3929
25 Ga0105250_10042297 3300009092 Bacteria 1826
26 Ga0105243_10000352 3300009148 Bacteria 49052
27 Ga0105243_10009024 3300009148 Bacteria 7616
28 Ga0105237_10042938 3300009545 Bacteria 4557
29 Ga0105239_10044298 3300010375 Bacteria 4878
30 Ga0157319_1000031 3300012497 Bacteria 48442
31 Ga0157370_10038136 3300013104 Bacteria 4650
32 Ga0157369_10011614 3300013105 Bacteria 10000
33 Ga0182008_10001155 3300014497 Bacteria 18210
34 Ga0182006_1000080 3300015261 Bacteria 122163
35 Ga0182005_1000016 3300015265 Bacteria 346889
36 Ga0209130_1000065 3300025284 Bacteria 195251
37 Ga0209676_1000086 3300025292 Bacteria 264155
38 Ga0209676_1001669 3300025292 Bacteria 19275
39 Ga0209025_1000038 3300025294 Bacteria 380508
40 Ga0209564_1000003 3300025295 Bacteria 1585848
41 Ga0209758_1000124 3300025297 Bacteria 189933
42 Ga0209050_1000165 3300025298 Bacteria 152109
43 Ga0209256_1000637 3300025299 Bacteria 47908
44 Ga0209051_1020162 3300025303 Bacteria 2882
45 Ga0209257_1002866 3300025304 Bacteria 16088
46 Ga0207696_1000023 3300025711 Bacteria 422195
47 Ga0207696_1009349 3300025711 Bacteria 3659
48 Ga0207696_1011843 3300025711 Bacteria 3118
49 Ga0207655_1000302 3300025728 Bacteria 74492
50 Ga0207655_1000658 3300025728 Bacteria 41061
51 Ga0207655_1012429 3300025728 Bacteria 4975
52 Ga0207709_10000138 3300025935 Bacteria 104006
53 Ga0207709_10023539 3300025935 Bacteria 3507
54 Ga0207668_10009002 3300025972 Bacteria 5969
55 Ga0207683_10054533 3300026121 Bacteria 3505
56 Ga0209281_1000005 3300027111 Bacteria 1242284
57 Ga0209281_1005784 3300027111 Bacteria 3343
58 Ga0209970_1000012 3300027614 Bacteria 24458
59 Ga0307515_10000014 3300028794 Bacteria 562358
60 Ga0307513_10050132 3300031456 Bacteria 4516
61 Ga0307408_100000589 3300031548 Bacteria 31221
62 Ga0307408_100031800 3300031548 Bacteria 3676
63 Ga0307408_100032351 3300031548 Bacteria 3646
64 Ga0307412_10014205 3300031911 Bacteria 4691
65 Ga0307414_10001816 3300032004 Bacteria 11027
66 Ga0307411_10000048 3300032005 Bacteria 35443
67 Ga0439436_0000237 3300041404 Bacteria 13271
68 Ga0439461_0010907 3300041410 Bacteria 1677
69 Ga0439466_0002113 3300041411 Bacteria 7782
70 Ga0439465_0000527 3300041413 Bacteria 11451
71 Ga0451791_0488486 3300041451 Bacteria 2821
72 Ga0451802_1895173 3300041460 Bacteria 2392
73 Ga0451807_0400482 3300041486 Bacteria 15735
74 Ga0451837_0666136 3300041494 Bacteria 3031
75 Ga0451837_1304130 3300041494 Bacteria 2271
76 Ga0439431_0000858 3300041997 Bacteria 6581
77 Ga0439433_0000015 3300041999 Bacteria 22784
78 Ga0439442_003382 3300042002 Bacteria 3151
79 Ga0439445_0001222 3300042004 Bacteria 5551
80 Ga0439432_000826 3300042006 Bacteria 11552
81 Ga0439432_002145 3300042006 Bacteria 7440
82 Ga0439449_0000342 3300042007 Bacteria 16936
83 Ga0439452_000945 3300042010 Bacteria 13044
84 Ga0439462_0000939 3300042015 Bacteria 6176
85 Ga0450911_000082 3300042115 Bacteria 38325
86 Ga0450892_000567 3300042130 Bacteria 4248
87 Ga0450902_001091 3300042137 Bacteria 3604
88 Ga0450905_000119 3300042142 Bacteria 7998
89 Ga0439434_0000280 3300042435 Bacteria 14555
90 Ga0439459_0002874 3300042438 Bacteria 2692
91 Ga0450918_000066 3300042531 Bacteria 21730
92 Ga0450893_0000451 3300042532 Bacteria 5801
93 Ga0495627_000011 3300046453 Bacteria 354522
94 Ga0495638_0004837 3300046460 Bacteria 10147
95 Ga0495620_0000349 3300046515 Bacteria 32029
96 Ga0495632_0001654 3300046519 Bacteria 18270
97 Ga0495632_0047512 3300046519 Bacteria 2128
98 Ga0495643_0000297 3300046522 Bacteria 69703
99 Ga0495643_0002794 3300046522 Bacteria 13340
100 Ga0495648_0002258 3300046524 Bacteria 18003
101 Ga0495654_0002797 3300046530 Bacteria 10997
102 Ga0495609_0000014 3300046538 Bacteria 326023
103 Ga0495609_0001531 3300046538 Bacteria 15203
104 Ga0495649_0001500 3300046694 Bacteria 17508
105 Ga0495660_0003563 3300046810 Bacteria 9601
106 Ga0495660_0004751 3300046810 Bacteria 8199
107 Ga0495686_0018959 3300047472 Bacteria 4605
108 Ga0496114_0002888 3300048917 Bacteria 13167
109 Ga0496114_0072755 3300048917 Bacteria 2892
110 Ga0496116_0020900 3300048919 Bacteria 4954
111 Ga0496116_0047815 3300048919 Bacteria 2876
112 Ga0496117_0001021 3300048920 Bacteria 42741
113 Ga0496117_0003585 3300048920 Bacteria 17909
114 Ga0496117_0004011 3300048920 Bacteria 16606
115 Ga0496117_0007470 3300048920 Bacteria 10664
116 Ga0496118_0000183 3300048921 Bacteria 110206
117 Ga0496118_0001205 3300048921 Bacteria 39819
118 Ga0496118_0003092 3300048921 Bacteria 21340
119 Ga0496119_0017284 3300048922 Bacteria 5433
120 Ga0496121_0001088 3300048924 Bacteria 48017
121 Ga0496121_0046600 3300048924 Bacteria 3709
122 Ga0496122_0000079 3300048925 Bacteria 212416
123 Ga0496122_0001505 3300048925 Bacteria 37148
124 Ga0496123_0000073 3300048926 Bacteria 198307
125 Ga0496123_0000240 3300048926 Bacteria 110383
126 Ga0496123_0090193 3300048926 Bacteria 1823
127 Ga0496124_0002616 3300048927 Bacteria 23205
128 Ga0496124_0005287 3300048927 Bacteria 14604
129 Ga0496124_0025450 3300048927 Bacteria 5359
130 Ga0496124_0043053 3300048927 Bacteria 3883
131 Ga0496124_0092936 3300048927 Bacteria 2456
132 Ga0496125_0000383 3300048928 Bacteria 82288
133 Ga0496125_0000944 3300048928 Bacteria 45671
134 Ga0496125_0011599 3300048928 Bacteria 8803
135 Ga0496125_0064185 3300048928 Bacteria 2920
136 Ga0496126_0020590 3300048929 Bacteria 6460
137 Ga0496126_0029404 3300048929 Bacteria 5220
138 Ga0496126_0126010 3300048929 Bacteria 2217
139 Ga0495678_000010 3300049459 Bacteria 357896
140 Ga0501033_0019089 3300049570 Bacteria 5183
141 Ga0501034_0001633 3300049571 Bacteria 29030
142 Ga0501034_0012886 3300049571 Bacteria 8624
143 Ga0501034_0017063 3300049571 Bacteria 7446
144 Ga0501034_0091527 3300049571 Bacteria 3039
145 Ga0501037_0016170 3300049573 Bacteria 5492
146 Ga0501038_0010829 3300049574 Bacteria 8334
147 Ga0501043_0000698 3300049579 Bacteria 29682
148 Ga0501046_0032358 3300049580 Bacteria 4235
149 Ga0501047_0066146 3300049581 Bacteria 3484
150 Ga0501073_0000502 3300049589 Bacteria 27364
151 Ga0501074_0004901 3300049590 Bacteria 9598
152 Ga0501074_0011085 3300049590 Bacteria 6546
153 Ga0501221_001704 3300049704 Bacteria 3658
154 Ga0501229_003232 3300049706 Bacteria 1944
155 Ga0501080_0001622 3300049742 Bacteria 19129
156 Ga0501080_0005808 3300049742 Bacteria 11046
157 Ga0501044_0002664 3300049823 Bacteria 20309
158 nmdc:mga00v17_255_c1 3300050491 Bacteria 31356
159 nmdc:mga0k408_52577_c1 3300050493 Bacteria 2361
160 Ga0500651_0000297 3300053093 Bacteria 28799
161 Ga0500651_0007926 3300053093 Bacteria 6216
162 Ga0500593_000691 3300053117 Bacteria 12851
163 Ga0500595_015754 3300053119 Bacteria 2832
164 Ga0500628_001054 3300053129 Bacteria 4815
165 Ga0500652_000097 3300053131 Bacteria 35527
166 Ga0500559_0036321 3300053136 Bacteria 2130
167 Ga0500568_0016917 3300053139 Bacteria 3229
168 Ga0500568_0030186 3300053139 Bacteria 2245
169 Ga0500622_0000359 3300053156 Bacteria 44261
170 Ga0500622_0003156 3300053156 Bacteria 11269
171 Ga0501082_0045512 3300060353 Bacteria 3784

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048920 Ga0496117_0001021 Ga0496117_0001021_10943_12463 441
2 3300048921 Ga0496118_0001205 Ga0496118_0001205_10913_12433 441
3 3300048928 Ga0496125_0000944 Ga0496125_0000944_33212_34732 441
4 3300048929 Ga0496126_0029404 Ga0496126_0029404_390_1910 441
5 iso_pu_bacteria 2511231024 2511377612 448
6 iso_pu_bacteria 3007803356 3007804694 448
7 iso_pu_bacteria 2554235231 2555249443 450
8 3300006944 Ga0099823_1034259 Ga0099823_10342593 452
9 3300009036 Ga0105244_10000848 Ga0105244_1000084815 452
10 3300009036 Ga0105244_10007209 Ga0105244_100072093 452
11 3300009036 Ga0105244_10018326 Ga0105244_100183263 452
12 3300009092 Ga0105250_10042297 Ga0105250_100422972 452
13 3300009148 Ga0105243_10009024 Ga0105243_100090248 452
14 3300025711 Ga0207696_1000023 Ga0207696_1000023343 452
15 3300025711 Ga0207696_1009349 Ga0207696_10093493 452
16 3300025728 Ga0207655_1000302 Ga0207655_100030234 452
17 3300025728 Ga0207655_1000658 Ga0207655_100065810 452
18 3300025728 Ga0207655_1012429 Ga0207655_10124294 452
19 3300041410 Ga0439461_0010907 Ga0439461_0010907_166_1662 452
20 3300042006 Ga0439432_000826 Ga0439432_000826_5245_6765 452
21 3300046515 Ga0495620_0000349 Ga0495620_0000349_10136_11656 452
22 3300046519 Ga0495632_0001654 Ga0495632_0001654_6148_7668 452
23 3300046522 Ga0495643_0000297 Ga0495643_0000297_28697_30217 452
24 3300046522 Ga0495643_0002794 Ga0495643_0002794_10136_11656 452
25 3300046524 Ga0495648_0002258 Ga0495648_0002258_10136_11656 452
26 3300046538 Ga0495609_0000014 Ga0495609_0000014_122035_123582 452
27 3300048917 Ga0496114_0002888 Ga0496114_0002888_4162_5682 452
28 3300048919 Ga0496116_0020900 Ga0496116_0020900_3132_4652 452
29 3300048920 Ga0496117_0004011 Ga0496117_0004011_4144_5664 452
30 3300048920 Ga0496117_0007470 Ga0496117_0007470_7971_9491 452
31 3300048921 Ga0496118_0003092 Ga0496118_0003092_15643_17163 452
32 3300048922 Ga0496119_0017284 Ga0496119_0017284_1094_2614 452
33 3300048924 Ga0496121_0046600 Ga0496121_0046600_1105_2625 452
34 3300048926 Ga0496123_0000240 Ga0496123_0000240_40250_41770 452
35 3300048926 Ga0496123_0090193 Ga0496123_0090193_206_1726 452
36 3300048927 Ga0496124_0002616 Ga0496124_0002616_3791_5311 452
37 3300048927 Ga0496124_0043053 Ga0496124_0043053_742_2262 452
38 3300042137 Ga0450902_001091 Ga0450902_001091_365_1888 454
39 3300042142 Ga0450905_000119 Ga0450905_000119_3535_5058 454
40 3300048927 Ga0496124_0005287 Ga0496124_0005287_4006_5541 454
41 3300041411 Ga0439466_0002113 Ga0439466_0002113_6257_7771 458
42 iso_pu_bacteria 2886848708 2886853481 473
43 3300041494 Ga0451837_1304130 Ga0451837_1304130_99_1766 480
44 3300049571 Ga0501034_0012886 Ga0501034_0012886_3148_4839 485
45 3300025303 Ga0209051_1020162 Ga0209051_10201623 487
46 3300025935 Ga0207709_10023539 Ga0207709_100235393 487
47 3300042531 Ga0450918_000066 Ga0450918_000066_7560_9227 487
48 3300048929 Ga0496126_0126010 Ga0496126_0126010_575_2200 487
49 3300006353 Ga0075370_10005152 Ga0075370_100051526 488
50 3300005578 Ga0068854_100045662 Ga0068854_1000456623 489
51 3300009545 Ga0105237_10042938 Ga0105237_100429384 489
52 3300010375 Ga0105239_10044298 Ga0105239_100442984 489
53 3300013104 Ga0157370_10038136 Ga0157370_100381362 489
54 3300013105 Ga0157369_10011614 Ga0157369_100116143 489
55 3300048928 Ga0496125_0064185 Ga0496125_0064185_1147_2802 491
56 3300049570 Ga0501033_0019089 Ga0501033_0019089_2605_4290 493
57 3300049571 Ga0501034_0001633 Ga0501034_0001633_7009_8694 493
58 3300049573 Ga0501037_0016170 Ga0501037_0016170_531_2216 493
59 3300049574 Ga0501038_0010829 Ga0501038_0010829_4891_6576 493
60 3300049579 Ga0501043_0000698 Ga0501043_0000698_18570_20255 493
61 3300049580 Ga0501046_0032358 Ga0501046_0032358_1319_3004 493
62 3300049581 Ga0501047_0066146 Ga0501047_0066146_1760_3445 493
63 3300049589 Ga0501073_0000502 Ga0501073_0000502_17904_19589 493
64 3300049590 Ga0501074_0004901 Ga0501074_0004901_7297_8982 493
65 3300049742 Ga0501080_0005808 Ga0501080_0005808_531_2216 493
66 3300049823 Ga0501044_0002664 Ga0501044_0002664_17904_19589 493
67 3300053156 Ga0500622_0003156 Ga0500622_0003156_318_1979 493
68 3300060353 Ga0501082_0045512 Ga0501082_0045512_1643_3328 493
69 3300041460 Ga0451802_1895173 Ga0451802_1895173_38_1711 496
70 3300041486 Ga0451807_0400482 Ga0451807_0400482_180_1853 496
71 3300025972 Ga0207668_10009002 Ga0207668_100090023 498
72 3300042115 Ga0450911_000082 Ga0450911_000082_13982_15661 498
73 3300047472 Ga0495686_0018959 Ga0495686_0018959_2857_4551 499
74 3300048928 Ga0496125_0011599 Ga0496125_0011599_5064_6725 499
75 3300048929 Ga0496126_0020590 Ga0496126_0020590_4797_6446 499
76 3300003771 Ga0055526_1002755 Ga0055526_100275512 501
77 3300025295 Ga0209564_1000003 Ga0209564_10000031190 501
78 3300003775 Ga0055524_1000907 Ga0055524_100090713 502
79 3300025299 Ga0209256_1000637 Ga0209256_100063716 502
80 3300042438 Ga0439459_0002874 Ga0439459_0002874_780_2459 502
81 3300005262 Ga0065165_1000239 Ga0065165_100023932 503
82 3300031456 Ga0307513_10050132 Ga0307513_100501324 503
83 3300049571 Ga0501034_0091527 Ga0501034_0091527_347_2014 503
84 3300012497 Ga0157319_1000031 Ga0157319_100003110 504
85 3300025304 Ga0209257_1002866 Ga0209257_100286614 504
86 3300031548 Ga0307408_100031800 Ga0307408_1000318003 504
87 3300041404 Ga0439436_0000237 Ga0439436_0000237_3938_5590 504
88 3300041413 Ga0439465_0000527 Ga0439465_0000527_6349_8001 504
89 3300041997 Ga0439431_0000858 Ga0439431_0000858_2080_3732 504
90 3300041999 Ga0439433_0000015 Ga0439433_0000015_8342_9994 504
91 3300042002 Ga0439442_003382 Ga0439442_003382_536_2188 504
92 3300042004 Ga0439445_0001222 Ga0439445_0001222_342_1994 504
93 3300042006 Ga0439432_002145 Ga0439432_002145_2089_3741 504
94 3300042007 Ga0439449_0000342 Ga0439449_0000342_6530_8182 504
95 3300042010 Ga0439452_000945 Ga0439452_000945_2757_4409 504
96 3300042015 Ga0439462_0000939 Ga0439462_0000939_1622_3274 504
97 3300042435 Ga0439434_0000280 Ga0439434_0000280_5125_6777 504
98 3300046519 Ga0495632_0047512 Ga0495632_0047512_38_1723 504
99 3300053139 Ga0500568_0016917 Ga0500568_0016917_244_1929 504
100 3300015261 Ga0182006_1000080 Ga0182006_100008021 505
101 3300015265 Ga0182005_1000016 Ga0182005_100001620 505
102 3300049571 Ga0501034_0017063 Ga0501034_0017063_600_2294 505
103 iso_pu_bacteria 2526164512 2526211520 505
104 iso_pu_bacteria 2891633521 2891636475 505
105 3300003781 Ga0055536_1001299 Ga0055536_10012998 506
106 3300006051 Ga0075364_10000127 Ga0075364_1000012723 506
107 3300006177 Ga0075362_10031959 Ga0075362_100319591 506
108 3300006195 Ga0075366_10016602 Ga0075366_100166023 506
109 3300014497 Ga0182008_10001155 Ga0182008_1000115511 506
110 3300025292 Ga0209676_1000086 Ga0209676_1000086248 506
111 3300046530 Ga0495654_0002797 Ga0495654_0002797_4361_6061 506
112 3300050491 nmdc:mga00v17_255_c1 nmdc:mga00v17_255_c1_25096_26796 506
113 3300050493 nmdc:mga0k408_52577_c1 nmdc:mga0k408_52577_c1_68_1747 506
114 3300053093 Ga0500651_0000297 Ga0500651_0000297_374_2068 506
115 3300053093 Ga0500651_0007926 Ga0500651_0007926_1743_3428 506
116 3300053129 Ga0500628_001054 Ga0500628_001054_2306_3991 506
117 3300053131 Ga0500652_000097 Ga0500652_000097_10590_12275 506
118 3300053156 Ga0500622_0000359 Ga0500622_0000359_17304_18989 506
119 iso_pu_bacteria 2923516293 2923516514 506
120 3300042130 Ga0450892_000567 Ga0450892_000567_2522_4195 507
121 3300042532 Ga0450893_0000451 Ga0450893_0000451_1872_3545 507
122 3300048925 Ga0496122_0001505 Ga0496122_0001505_6981_8654 507
123 3300048927 Ga0496124_0092936 Ga0496124_0092936_85_1791 507
124 3300048928 Ga0496125_0000383 Ga0496125_0000383_7189_8862 507
125 3300053117 Ga0500593_000691 Ga0500593_000691_4582_6273 507
126 iso_pu_bacteria 2643221579 2643907732 507
127 iso_pu_bacteria 2643221581 2643914053 507
128 iso_pu_bacteria 2643221685 2644477638 507
129 iso_pu_bacteria 2919130084 2919133712 507
130 iso_pu_bacteria 2929195423 2929197553 507
131 iso_pu_bacteria 2987605356 2987606802 507
132 iso_pu_bacteria 8003014200 8003015648 507
133 3300046460 Ga0495638_0004837 Ga0495638_0004837_4978_6633 508
134 3300046810 Ga0495660_0003563 Ga0495660_0003563_4433_6112 508
135 iso_pu_bacteria 2585428057 2587728219 508
136 iso_pu_bacteria 2585428058 2587734566 508
137 iso_pu_bacteria 2588253510 2588295682 508
138 iso_pu_bacteria 2643221544 2643744249 508
139 iso_pu_bacteria 2643221592 2643971608 508
140 iso_pu_bacteria 2643221609 2644063097 508
141 iso_pu_bacteria 2643221611 2644075533 508
142 iso_pu_bacteria 2643221644 2644243721 508
143 iso_pu_bacteria 2738543012 2739246752 508
144 iso_pu_bacteria 2816332133 2816475466 508
145 iso_pu_bacteria 2904541872 2904542628 508
146 iso_pu_bacteria 2929160207 2929167899 508
147 iso_pu_bacteria 2945909444 2945913888 508
148 iso_pu_bacteria 2945984333 2945990716 508
149 iso_pu_bacteria 2643221585 2643935342 509
150 iso_pu_bacteria 2643221656 2644317124 509
151 iso_pu_bacteria 2738541307 2738881132 509
152 iso_pu_bacteria 2738541337 2739055162 509
153 iso_pu_bacteria 2831864461 2831865675 509
154 iso_pu_bacteria 2842718218 2842719257 509
155 iso_pu_bacteria 2895498888 2895500860 509
156 iso_pu_bacteria 2895511927 2895516271 509
157 iso_pu_bacteria 2895522137 2895523811 509
158 iso_pu_bacteria 2895525241 2895526607 509
159 iso_pu_bacteria 2974320154 2974323595 509
160 3300025292 Ga0209676_1001669 Ga0209676_10016699 511
161 3300027614 Ga0209970_1000012 Ga0209970_100001214 511
162 3300032004 Ga0307414_10001816 Ga0307414_100018164 511
163 3300041451 Ga0451791_0488486 Ga0451791_0488486_63_1733 511
164 3300041494 Ga0451837_0666136 Ga0451837_0666136_926_2593 511
165 3300046694 Ga0495649_0001500 Ga0495649_0001500_13078_14787 511
166 3300048917 Ga0496114_0072755 Ga0496114_0072755_10_1677 511
167 3300048925 Ga0496122_0000079 Ga0496122_0000079_74364_76031 511
168 3300048926 Ga0496123_0000073 Ga0496123_0000073_133445_135112 511
169 3300049590 Ga0501074_0011085 Ga0501074_0011085_2003_3706 511
170 3300049742 Ga0501080_0001622 Ga0501080_0001622_16554_18257 511
171 iso_pu_bacteria 2919513703 2919514517 511
172 iso_pu_bacteria 2919675420 2919678782 511
173 3300003187 JGI25151J46595_10002029 JGI25151J46595_100020296 512
174 3300003215 JGI25153J46596_10001279 JGI25153J46596_1000127912 512
175 3300003323 rootH1_10225531 rootH1_102255312 512
176 3300005289 Ga0065704_10074129 Ga0065704_100741294 512
177 3300006946 Ga0079104_1012665 Ga0079104_10126653 512
178 3300006948 Ga0099826_10024105 Ga0099826_100241053 512
179 3300025294 Ga0209025_1000038 Ga0209025_100003858 512
180 3300025297 Ga0209758_1000124 Ga0209758_1000124122 512
181 3300025298 Ga0209050_1000165 Ga0209050_100016555 512
182 3300028794 Ga0307515_10000014 Ga0307515_10000014420 512
183 3300031548 Ga0307408_100000589 Ga0307408_1000005896 512
184 3300031548 Ga0307408_100032351 Ga0307408_1000323513 512
185 3300031911 Ga0307412_10014205 Ga0307412_100142056 512
186 3300032005 Ga0307411_10000048 Ga0307411_100000485 512
187 3300049704 Ga0501221_001704 Ga0501221_001704_1966_3639 512
188 3300049706 Ga0501229_003232 Ga0501229_003232_261_1934 512
189 3300053119 Ga0500595_015754 Ga0500595_015754_206_1903 512
190 3300053139 Ga0500568_0030186 Ga0500568_0030186_332_2017 512
191 3300005262 Ga0065165_1000352 Ga0065165_100035224 513
192 3300026121 Ga0207683_10054533 Ga0207683_100545332 513
193 3300053136 Ga0500559_0036321 Ga0500559_0036321_359_2029 513
194 iso_pu_bacteria 2721755523 2722884297 513
195 iso_pu_bacteria 2738541276 2738715676 513
196 iso_pu_bacteria 2857553236 2857558520 513
197 iso_pu_bacteria 2919476304 2919477221 513
198 3300048920 Ga0496117_0003585 Ga0496117_0003585_3629_5302 516
199 3300048921 Ga0496118_0000183 Ga0496118_0000183_11869_13542 516
200 3300003323 rootH1_10000502 rootH1_1000050242 517
201 3300009148 Ga0105243_10000352 Ga0105243_100003529 517
202 3300025711 Ga0207696_1011843 Ga0207696_10118433 517
203 3300025935 Ga0207709_10000138 Ga0207709_1000013892 517
204 3300027111 Ga0209281_1000005 Ga0209281_1000005498 517
205 3300027111 Ga0209281_1005784 Ga0209281_10057841 517
206 3300046453 Ga0495627_000011 Ga0495627_000011_17932_19611 517
207 3300046538 Ga0495609_0001531 Ga0495609_0001531_4310_5989 517
208 3300046810 Ga0495660_0004751 Ga0495660_0004751_3096_4775 517
209 3300048919 Ga0496116_0047815 Ga0496116_0047815_745_2424 517
210 3300048924 Ga0496121_0001088 Ga0496121_0001088_32050_33729 517
211 3300048927 Ga0496124_0025450 Ga0496124_0025450_2050_3729 517
212 3300049459 Ga0495678_000010 Ga0495678_000010_18821_20500 517
213 3300002987 JGI25159J45721_1012627 JGI25159J45721_10126271 518
214 3300005262 Ga0065165_1000050 Ga0065165_100005045 518
215 3300025284 Ga0209130_1000065 Ga0209130_100006545 518

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03929

PepSY_TM

PepSY-associated TM region

10

399

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
7abw-assembly2.cif.gz_B crystal structure of siderophore reductase foxb 0.6077 6 396
7abw-assembly2.cif.gz_B crystal structure of siderophore reductase foxb 0.5948 6 396
4yla-assembly1.cif.gz_A crystal structure of the indole prenyltransferase mpnd complexed with indolactam v and dmspp 0.5267 281 352
2z3a-assembly1.cif.gz_J crystal structure of bacillus subtilis codw, a non-canonical hslv-like peptidase with an impaired catalytic apparatus 0.515 93 122
7e5v-assembly2.cif.gz_B crystal structure of phm7 in complex with inhibitor 0.4945 91 140
ID Description Score Start End Superfamily
af_Q4DE93_82_448_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6513 106 143 2.130.10.10
af_Q54PV7_257_447_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6014 99 140 2.130.10.10
af_Q5ALW2_79_599_2.120.10.10 Mainly Beta;6 Propeller;Neuraminidase; 0.5997 93 140 2.120.10.10
af_Q19052_195_433_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.5802 91 140 2.130.10.10
1pbyB00 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.5621 99 141 2.130.10.10
ID Description Score Start End GO Terms
AF-B7WXB4-F1-model_v4 PepSY-associated TM helix domain protein 0.9343 140 517 GO:0016020
AF-A0A5C6Z5F6-F1-model_v4 PepSY domain-containing protein 0.9313 1 480 GO:0016020
AF-A0A841HHB2-F1-model_v4 Putative iron-regulated membrane protein 0.93 1 517 GO:0016020
AF-A0A7V8GAM9-F1-model_v4 PepSY domain-containing protein 0.9278 1 398 GO:0016020
AF-A0A841HHB2-F1-model_v4 Putative iron-regulated membrane protein 0.9265 1 517 GO:0016020

Feature Viewer

pLDDT pTM Quality
81.44 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map