F326206

General Info

Members Datasets Scaffolds Average Seq Length
215 170 212 152

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100002583|Ga0068853_10000258313
Length 171
Sequence VTTPPNGSVRADRGPHRAARVAIRRAERVDLPAILALHAQPGMNDGEVIALDAAAAIWRRMADYPDYGVYVATAADDGAVVGTFALLVMDNLAHGGAPSAVVEDVCVDERLRGRGIGRAMMMFAMERARASGCYKLTLSSNQARAGAHAFYRALGFEQHGLSFHVPLRALR

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
3 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
66 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
67 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
97 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
98 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
99 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
100 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
109 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
111 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
112 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
113 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
114 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
118 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
119 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
120 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
121 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
122 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
123 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
124 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
125 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
126 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
133 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
136 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
137 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
138 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
139 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
140 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
143 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
160 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
165 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
166 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
167 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
168 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
169 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
170 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.6
Metatranscriptomes 0
Isolates 1.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.12
Nodule 0
Rhizoplane 0.47
Rhizosphere 91.16
Stem 0
Stem Tuber 0
Unclassified 3.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C356 2010549000 Bacteria 2152
2 JGI25406J46586_10189624 3300003203 Bacteria 600
3 JGI25153J46596_10001842 3300003215 Bacteria 12580
4 rootH1_10176453 3300003323 Unclassified 4651
5 Ga0065707_10504406 3300005295 Bacteria 754
6 Ga0070683_101150946 3300005329 Unclassified 745
7 Ga0068869_100008759 3300005334 Bacteria 6538
8 Ga0070666_10675340 3300005335 Bacteria 756
9 Ga0070689_100264945 3300005340 Bacteria 1421
10 Ga0070689_100514091 3300005340 Unclassified 1027
11 Ga0070668_100707886 3300005347 Bacteria 889
12 Ga0070669_100792429 3300005353 Unclassified 805
13 Ga0070674_100244107 3300005356 Bacteria 1408
14 Ga0070688_100299489 3300005365 Bacteria 1162
15 Ga0070667_100403309 3300005367 Bacteria 1245
16 Ga0070700_100310790 3300005441 Bacteria 1154
17 Ga0070678_100431222 3300005456 Bacteria 1151
18 Ga0070662_100820928 3300005457 Bacteria 791
19 Ga0068867_100051051 3300005459 Bacteria 3049
20 Ga0070706_100534304 3300005467 Unclassified 1091
21 Ga0070707_100746564 3300005468 Bacteria 942
22 Ga0070684_100571329 3300005535 Bacteria 1050
23 Ga0070697_101169483 3300005536 Unclassified 685
24 Ga0068853_100002583 3300005539 Bacteria 13608
25 Ga0068853_100656994 3300005539 Bacteria 998
26 Ga0070693_100570957 3300005547 Bacteria 812
27 Ga0070665_100041119 3300005548 Bacteria 4646
28 Ga0068855_100198071 3300005563 Bacteria 2262
29 Ga0068857_101061735 3300005577 Bacteria 781
30 Ga0068859_100016112 3300005617 Bacteria 7507
31 Ga0068859_100421205 3300005617 Unclassified 1431
32 Ga0068861_100040587 3300005719 Bacteria 3482
33 Ga0068861_100108188 3300005719 Bacteria 2224
34 Ga0068858_101485118 3300005842 Bacteria 668
35 Ga0068860_100346801 3300005843 Bacteria 1461
36 Ga0068860_100707748 3300005843 Bacteria 1017
37 Ga0068862_100343783 3300005844 Bacteria 1382
38 Ga0081455_10006353 3300005937 Bacteria 12684
39 Ga0081455_10269981 3300005937 Bacteria 1234
40 Ga0081540_1013103 3300005983 Bacteria 5414
41 Ga0081539_10044686 3300005985 Bacteria 2555
42 Ga0075365_10015935 3300006038 Bacteria 4557
43 Ga0070712_100003094 3300006175 Bacteria 10271
44 Ga0097621_100244146 3300006237 Bacteria 1571
45 Ga0075428_100209850 3300006844 Bacteria 2104
46 Ga0075428_100280302 3300006844 Bacteria 1793
47 Ga0075428_101753256 3300006844 Unclassified 647
48 Ga0075430_100285579 3300006846 Bacteria 1365
49 Ga0075430_100854493 3300006846 Bacteria 750
50 Ga0075431_100272790 3300006847 Bacteria 1714
51 Ga0075431_101465754 3300006847 Unclassified 641
52 Ga0075433_10098072 3300006852 Bacteria 2594
53 Ga0075433_10229856 3300006852 Bacteria 1647
54 Ga0075434_100942776 3300006871 Unclassified 878
55 Ga0075429_100745200 3300006880 Unclassified 858
56 Ga0097620_100016112 3300006931 Bacteria 7507
57 Ga0097620_100421187 3300006931 Unclassified 1431
58 Ga0097620_101589639 3300006931 Bacteria 722
59 Ga0075435_100050603 3300007076 Bacteria 3344
60 Ga0111539_10012392 3300009094 Bacteria 10689
61 Ga0111539_10063788 3300009094 Bacteria 4359
62 Ga0111539_10242530 3300009094 Bacteria 2098
63 Ga0111539_10791019 3300009094 Bacteria 1104
64 Ga0105247_10264368 3300009101 Unclassified 1181
65 Ga0105241_10165066 3300009174 Bacteria 1824
66 Ga0105242_10084442 3300009176 Bacteria 2661
67 Ga0105248_10021384 3300009177 Bacteria 7169
68 Ga0105248_10971069 3300009177 Unclassified 959
69 Ga0105237_10028964 3300009545 Bacteria 5633
70 Ga0105238_10014253 3300009551 Bacteria 8037
71 Ga0105249_11192634 3300009553 Bacteria 832
72 Ga0105249_11237996 3300009553 Unclassified 818
73 Ga0105246_10211849 3300011119 Bacteria 1513
74 Ga0157378_10094047 3300013297 Bacteria 2729
75 Ga0163162_10239511 3300013306 Bacteria 1945
76 Ga0157375_10192071 3300013308 Bacteria 2197
77 Ga0157379_10299913 3300014968 Bacteria 1464
78 Ga0157376_10390373 3300014969 Unclassified 1343
79 Ga0163161_10522202 3300017792 Unclassified 970
80 Ga0213872_10075546 3300021361 Bacteria 1517
81 Ga0213874_10021462 3300021377 Bacteria 1781
82 Ga0209758_1001234 3300025297 Bacteria 31965
83 Ga0209758_1019807 3300025297 Bacteria 3222
84 Ga0207426_1039072 3300025302 Bacteria 1490
85 Ga0207642_10038965 3300025899 Bacteria 2061
86 Ga0207684_10746210 3300025910 Bacteria 830
87 Ga0207671_10133982 3300025914 Bacteria 1904
88 Ga0207646_11356960 3300025922 Bacteria 619
89 Ga0207694_10017279 3300025924 Bacteria 5453
90 Ga0207686_10098677 3300025934 Bacteria 1945
91 Ga0207670_10447603 3300025936 Unclassified 1041
92 Ga0207669_10067443 3300025937 Bacteria 2230
93 Ga0207689_10000563 3300025942 Bacteria 35456
94 Ga0207661_10504065 3300025944 Bacteria 1106
95 Ga0207667_10615058 3300025949 Bacteria 1094
96 Ga0207667_10908683 3300025949 Bacteria 872
97 Ga0207712_10339951 3300025961 Bacteria 1244
98 Ga0207640_10305806 3300025981 Bacteria 1260
99 Ga0207658_10177982 3300025986 Bacteria 1758
100 Ga0207658_11189801 3300025986 Unclassified 697
101 Ga0207677_11022191 3300026023 Bacteria 750
102 Ga0207703_11391119 3300026035 Bacteria 675
103 Ga0207639_10003943 3300026041 Bacteria 10018
104 Ga0207639_10584987 3300026041 Bacteria 1028
105 Ga0207708_10235886 3300026075 Bacteria 1470
106 Ga0207648_10024403 3300026089 Bacteria 5398
107 Ga0207676_10159995 3300026095 Bacteria 1950
108 Ga0207674_10864243 3300026116 Unclassified 872
109 Ga0207675_100133910 3300026118 Bacteria 2350
110 Ga0207683_10709852 3300026121 Bacteria 932
111 Ga0207428_10059755 3300027907 Unclassified 3021
112 Ga0207428_10068587 3300027907 Bacteria 2789
113 Ga0268266_10004596 3300028379 Bacteria 13175
114 Ga0268265_10072303 3300028380 Bacteria 2690
115 Ga0265334_10008315 3300028573 Bacteria 4414
116 Ga0265338_10096465 3300028800 Bacteria 2426
117 Ga0265338_10279834 3300028800 Unclassified 1219
118 Ga0265324_10131771 3300029957 Bacteria 849
119 Ga0265340_10065692 3300031247 Bacteria 1727
120 Ga0265313_10024479 3300031595 Bacteria 3224
121 Ga0316579_10006300 3300031691 Bacteria 4834
122 Ga0316577_10027994 3300031733 Bacteria 3143
123 Ga0307406_11107080 3300031901 Bacteria 684
124 Ga0307407_11535811 3300031903 Unclassified 527
125 Ga0307412_10873610 3300031911 Bacteria 786
126 Ga0307409_100672169 3300031995 Bacteria 1032
127 Ga0307416_100689333 3300032002 Bacteria 1110
128 Ga0307416_100693817 3300032002 Bacteria 1107
129 Ga0307411_11069601 3300032005 Bacteria 726
130 Ga0307415_100700170 3300032126 Bacteria 914
131 Ga0373934_0256007 3300035086 Bacteria 724
132 Ga0373923_0256808 3300035111 Bacteria 819
133 Ga0373941_0005840 3300035115 Bacteria 2923
134 Ga0373941_0030991 3300035115 Bacteria 1590
135 Ga0373953_0098710 3300035117 Bacteria 1227
136 Ga0373954_0370248 3300035118 Bacteria 708
137 Ga0373957_0029216 3300035120 Bacteria 2013
138 Ga0373955_0016239 3300035172 Bacteria 3661
139 Ga0373927_0274948 3300035695 Bacteria 1108
140 Ga0373937_0002075 3300036401 Bacteria 16763
141 Ga0373937_0550788 3300036401 Bacteria 1096
142 Ga0316582_0224717 3300036647 Bacteria 1284
143 Ga0316584_0109219 3300036712 Bacteria 2070
144 Ga0316584_0124371 3300036712 Bacteria 1926
145 Ga0316581_0020913 3300037588 Bacteria 1919
146 Ga0436364_0367707 3300037853 Unclassified 1252
147 Ga0436361_1152524 3300039447 Bacteria 1632
148 Ga0436363_0141246 3300039450 Bacteria 5125
149 Ga0439466_0085063 3300041411 Bacteria 995
150 Ga0451800_1664530 3300041459 Bacteria 623
151 Ga0451577_0000128 3300042876 Bacteria 167957
152 Ga0451577_0014043 3300042876 Bacteria 7473
153 Ga0451577_0413051 3300042876 Bacteria 1225
154 Ga0453683_0000348 3300044673 Bacteria 56032
155 Ga0453683_0969997 3300044673 Bacteria 564
156 Ga0466963_0087556 3300044694 Bacteria 2118
157 Ga0453684_0000003 3300044712 Bacteria 1481694
158 Ga0453684_0000180 3300044712 Bacteria 279345
159 Ga0453684_0048979 3300044712 Bacteria 5578
160 Ga0453684_0246571 3300044712 Bacteria 2053
161 Ga0453684_0512591 3300044712 Bacteria 1326
162 Ga0466968_0022532 3300044735 Bacteria 2560
163 Ga0451576_0365781 3300045051 Bacteria 1511
164 Ga0451576_0678738 3300045051 Bacteria 1082
165 Ga0451576_0687096 3300045051 Bacteria 1075
166 Ga0466967_0273029 3300045976 Bacteria 1620
167 Ga0466967_0530506 3300045976 Bacteria 1157
168 Ga0495664_0609541 3300046477 Bacteria 648
169 Ga0495607_0022259 3300046501 Bacteria 3982
170 Ga0495652_0211855 3300046529 Bacteria 1462
171 Ga0495640_0241274 3300046533 Bacteria 1134
172 Ga0495586_0335860 3300046535 Bacteria 867
173 Ga0495656_0288841 3300046615 Bacteria 838
174 Ga0495659_0485394 3300046664 Unclassified 540
175 Ga0495613_0152031 3300046689 Bacteria 1650
176 Ga0495624_0580274 3300046690 Bacteria 669
177 Ga0495674_0258543 3300047319 Bacteria 1431
178 Ga0495684_0288612 3300047471 Bacteria 1182
179 Ga0501031_0460200 3300049568 Bacteria 822
180 Ga0501032_0148088 3300049569 Bacteria 1544
181 Ga0501034_0174113 3300049571 Bacteria 2118
182 Ga0501034_0257483 3300049571 Bacteria 1688
183 Ga0501034_0656824 3300049571 Bacteria 950
184 Ga0501036_0357996 3300049572 Bacteria 1218
185 Ga0501038_0124832 3300049574 Bacteria 2119
186 Ga0501038_0492232 3300049574 Bacteria 938
187 Ga0501039_0268321 3300049575 Bacteria 1341
188 Ga0501043_0056093 3300049579 Bacteria 3094
189 Ga0501047_0047485 3300049581 Bacteria 4147
190 Ga0501067_0007928 3300049583 Bacteria 5899
191 Ga0501070_0084412 3300049586 Bacteria 2629
192 Ga0501072_0317793 3300049588 Bacteria 1237
193 Ga0501073_0127954 3300049589 Bacteria 1760
194 Ga0501079_0042863 3300049741 Bacteria 3494
195 Ga0501080_0032306 3300049742 Bacteria 4880
196 Ga0501080_0179042 3300049742 Bacteria 1952
197 Ga0501035_0067600 3300049822 Bacteria 3170
198 Ga0501044_0537969 3300049823 Bacteria 1066
199 Ga0501045_0571588 3300049824 Bacteria 838
200 nmdc:mga0yw44_111498_c1 3300050492 Bacteria 1753
201 nmdc:mga09592_640142_c1 3300050508 Unclassified 908
202 nmdc:mga06r32_1351681_c1 3300050510 Unclassified 655
203 nmdc:mga08y16_13591_c1 3300050511 Bacteria 8570
204 nmdc:mga08y16_186209_c1 3300050511 Bacteria 2154
205 nmdc:mga08y16_252171_c1 3300050511 Bacteria 1824
206 nmdc:mga0rr50_90853_c1 3300050513 Bacteria 2377
207 nmdc:mga0a205_127064_c1 3300050515 Bacteria 2449
208 nmdc:mga0a205_245518_c1 3300050515 Bacteria 1671
209 Ga0500643_043948 3300053087 Bacteria 1301
210 Ga0500651_0097780 3300053093 Bacteria 1803
211 Ga0500641_0003557 3300053096 Bacteria 5502
212 Ga0500642_0047590 3300053130 Bacteria 1880

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044673 Ga0453683_0969997 Ga0453683_0969997_131_514 126
2 3300005334 Ga0068869_100008759 Ga0068869_1000087592 135
3 3300005340 Ga0070689_100264945 Ga0070689_1002649452 135
4 3300005365 Ga0070688_100299489 Ga0070688_1002994892 135
5 3300005367 Ga0070667_100403309 Ga0070667_1004033092 135
6 3300005456 Ga0070678_100431222 Ga0070678_1004312222 135
7 3300005457 Ga0070662_100820928 Ga0070662_1008209281 135
8 3300005459 Ga0068867_100051051 Ga0068867_1000510513 135
9 3300005468 Ga0070707_100746564 Ga0070707_1007465642 135
10 3300005547 Ga0070693_100570957 Ga0070693_1005709571 135
11 3300006931 Ga0097620_101589639 Ga0097620_1015896392 135
12 3300026089 Ga0207648_10024403 Ga0207648_100244032 135
13 3300032126 Ga0307415_100700170 Ga0307415_1007001702 137
14 3300049589 Ga0501073_0127954 Ga0501073_0127954_1335_1748 137
15 3300049742 Ga0501080_0032306 Ga0501080_0032306_4448_4861 137
16 3300031995 Ga0307409_100672169 Ga0307409_1006721692 140
17 3300032002 Ga0307416_100693817 Ga0307416_1006938172 140
18 3300028573 Ga0265334_10008315 Ga0265334_100083153 143
19 3300028800 Ga0265338_10279834 Ga0265338_102798342 143
20 3300031595 Ga0265313_10024479 Ga0265313_100244792 143
21 3300025986 Ga0207658_11189801 Ga0207658_111898011 144
22 3300005548 Ga0070665_100041119 Ga0070665_1000411195 145
23 3300005563 Ga0068855_100198071 Ga0068855_1001980712 145
24 3300006846 Ga0075430_100854493 Ga0075430_1008544932 145
25 3300014969 Ga0157376_10390373 Ga0157376_103903732 145
26 3300025949 Ga0207667_10615058 Ga0207667_106150582 145
27 3300028379 Ga0268266_10004596 Ga0268266_1000459614 145
28 3300005467 Ga0070706_100534304 Ga0070706_1005343042 146
29 3300005539 Ga0068853_100656994 Ga0068853_1006569942 146
30 3300044712 Ga0453684_0512591 Ga0453684_0512591_535_975 146
31 3300031691 Ga0316579_10006300 Ga0316579_100063003 147
32 3300031733 Ga0316577_10027994 Ga0316577_100279941 147
33 3300036712 Ga0316584_0109219 Ga0316584_0109219_1554_2012 147
34 3300037588 Ga0316581_0020913 Ga0316581_0020913_801_1259 147
35 3300037853 Ga0436364_0367707 Ga0436364_0367707_488_937 147
36 3300045051 Ga0451576_0365781 Ga0451576_0365781_566_1009 147
37 3300053130 Ga0500642_0047590 Ga0500642_0047590_432_875 147
38 iso_pu_bacteria 2857576091 2857579684 147
39 3300005353 Ga0070669_100792429 Ga0070669_1007924291 148
40 3300005441 Ga0070700_100310790 Ga0070700_1003107901 148
41 3300005535 Ga0070684_100571329 Ga0070684_1005713292 148
42 3300005536 Ga0070697_101169483 Ga0070697_1011694831 148
43 3300006844 Ga0075428_100280302 Ga0075428_1002803021 148
44 3300006844 Ga0075428_101753256 Ga0075428_1017532562 148
45 3300006847 Ga0075431_101465754 Ga0075431_1014657541 148
46 3300006852 Ga0075433_10098072 Ga0075433_100980721 148
47 3300006871 Ga0075434_100942776 Ga0075434_1009427761 148
48 3300006880 Ga0075429_100745200 Ga0075429_1007452001 148
49 3300009094 Ga0111539_10063788 Ga0111539_100637882 148
50 3300009177 Ga0105248_10971069 Ga0105248_109710691 148
51 3300009553 Ga0105249_11237996 Ga0105249_112379962 148
52 3300026075 Ga0207708_10235886 Ga0207708_102358862 148
53 3300027907 Ga0207428_10068587 Ga0207428_100685873 148
54 3300031903 Ga0307407_11535811 Ga0307407_115358111 148
55 3300035117 Ga0373953_0098710 Ga0373953_0098710_618_1064 148
56 3300035120 Ga0373957_0029216 Ga0373957_0029216_1297_1743 148
57 3300035172 Ga0373955_0016239 Ga0373955_0016239_2682_3128 148
58 3300036401 Ga0373937_0002075 Ga0373937_0002075_3449_3895 148
59 3300041459 Ga0451800_1664530 Ga0451800_1664530_20_466 148
60 3300045051 Ga0451576_0678738 Ga0451576_0678738_595_1044 148
61 3300045051 Ga0451576_0687096 Ga0451576_0687096_454_924 148
62 3300045976 Ga0466967_0273029 Ga0466967_0273029_83_532 148
63 3300046477 Ga0495664_0609541 Ga0495664_0609541_132_578 148
64 3300046533 Ga0495640_0241274 Ga0495640_0241274_640_1086 148
65 3300046535 Ga0495586_0335860 Ga0495586_0335860_399_845 148
66 3300046689 Ga0495613_0152031 Ga0495613_0152031_508_954 148
67 3300047319 Ga0495674_0258543 Ga0495674_0258543_814_1260 148
68 3300050508 nmdc:mga09592_640142_c1 nmdc:mga09592_640142_c1_104_553 148
69 3300050510 nmdc:mga06r32_1351681_c1 nmdc:mga06r32_1351681_c1_154_600 148
70 3300050511 nmdc:mga08y16_252171_c1 nmdc:mga08y16_252171_c1_810_1259 148
71 3300005577 Ga0068857_101061735 Ga0068857_1010617352 149
72 3300005719 Ga0068861_100040587 Ga0068861_1000405872 149
73 3300005843 Ga0068860_100707748 Ga0068860_1007077483 149
74 3300006852 Ga0075433_10229856 Ga0075433_102298562 149
75 3300007076 Ga0075435_100050603 Ga0075435_1000506031 149
76 3300009094 Ga0111539_10012392 Ga0111539_1001239210 149
77 3300009101 Ga0105247_10264368 Ga0105247_102643681 149
78 3300009545 Ga0105237_10028964 Ga0105237_100289642 149
79 3300025914 Ga0207671_10133982 Ga0207671_101339822 149
80 3300026116 Ga0207674_10864243 Ga0207674_108642433 149
81 3300027907 Ga0207428_10059755 Ga0207428_100597555 149
82 3300036647 Ga0316582_0224717 Ga0316582_0224717_752_1204 149
83 3300036712 Ga0316584_0124371 Ga0316584_0124371_1196_1645 149
84 3300050511 nmdc:mga08y16_13591_c1 nmdc:mga08y16_13591_c1_179_634 149
85 3300050513 nmdc:mga0rr50_90853_c1 nmdc:mga0rr50_90853_c1_1152_1604 149
86 3300050515 nmdc:mga0a205_127064_c1 nmdc:mga0a205_127064_c1_51_527 149
87 3300050515 nmdc:mga0a205_245518_c1 nmdc:mga0a205_245518_c1_644_1096 149
88 3300005340 Ga0070689_100514091 Ga0070689_1005140912 150
89 3300005617 Ga0068859_100421205 Ga0068859_1004212052 150
90 3300005937 Ga0081455_10006353 Ga0081455_100063534 150
91 3300006931 Ga0097620_100421187 Ga0097620_1004211872 150
92 3300009551 Ga0105238_10014253 Ga0105238_100142535 150
93 3300025910 Ga0207684_10746210 Ga0207684_107462102 150
94 3300025924 Ga0207694_10017279 Ga0207694_100172794 150
95 3300025936 Ga0207670_10447603 Ga0207670_104476032 150
96 3300026041 Ga0207639_10584987 Ga0207639_105849872 150
97 3300031911 Ga0307412_10873610 Ga0307412_108736101 150
98 3300032002 Ga0307416_100689333 Ga0307416_1006893332 150
99 3300042876 Ga0451577_0014043 Ga0451577_0014043_4854_5309 150
100 3300044712 Ga0453684_0000003 Ga0453684_0000003_1404072_1404527 150
101 3300046501 Ga0495607_0022259 Ga0495607_0022259_3095_3568 150
102 3300046615 Ga0495656_0288841 Ga0495656_0288841_366_824 150
103 3300046664 Ga0495659_0485394 Ga0495659_0485394_27_485 150
104 3300049742 Ga0501080_0179042 Ga0501080_0179042_792_1247 150
105 iso_pu_bacteria 8001522603 8001526438 150
106 3300003323 rootH1_10176453 rootH1_101764533 151
107 3300005335 Ga0070666_10675340 Ga0070666_106753402 151
108 3300005347 Ga0070668_100707886 Ga0070668_1007078862 151
109 3300005356 Ga0070674_100244107 Ga0070674_1002441071 151
110 3300005617 Ga0068859_100016112 Ga0068859_1000161122 151
111 3300005719 Ga0068861_100108188 Ga0068861_1001081882 151
112 3300005843 Ga0068860_100346801 Ga0068860_1003468012 151
113 3300005844 Ga0068862_100343783 Ga0068862_1003437832 151
114 3300006237 Ga0097621_100244146 Ga0097621_1002441463 151
115 3300006931 Ga0097620_100016112 Ga0097620_1000161122 151
116 3300009094 Ga0111539_10791019 Ga0111539_107910192 151
117 3300009174 Ga0105241_10165066 Ga0105241_101650663 151
118 3300009176 Ga0105242_10084442 Ga0105242_100844424 151
119 3300009177 Ga0105248_10021384 Ga0105248_100213842 151
120 3300009553 Ga0105249_11192634 Ga0105249_111926341 151
121 3300011119 Ga0105246_10211849 Ga0105246_102118492 151
122 3300013297 Ga0157378_10094047 Ga0157378_100940472 151
123 3300013306 Ga0163162_10239511 Ga0163162_102395112 151
124 3300013308 Ga0157375_10192071 Ga0157375_101920712 151
125 3300014968 Ga0157379_10299913 Ga0157379_102999132 151
126 3300017792 Ga0163161_10522202 Ga0163161_105222022 151
127 3300025899 Ga0207642_10038965 Ga0207642_100389652 151
128 3300025922 Ga0207646_11356960 Ga0207646_113569601 151
129 3300025934 Ga0207686_10098677 Ga0207686_100986773 151
130 3300025937 Ga0207669_10067443 Ga0207669_100674434 151
131 3300025942 Ga0207689_10000563 Ga0207689_1000056311 151
132 3300025961 Ga0207712_10339951 Ga0207712_103399512 151
133 3300025981 Ga0207640_10305806 Ga0207640_103058063 151
134 3300025986 Ga0207658_10177982 Ga0207658_101779822 151
135 3300026023 Ga0207677_11022191 Ga0207677_110221912 151
136 3300026095 Ga0207676_10159995 Ga0207676_101599952 151
137 3300026118 Ga0207675_100133910 Ga0207675_1001339102 151
138 3300026121 Ga0207683_10709852 Ga0207683_107098522 151
139 3300028380 Ga0268265_10072303 Ga0268265_100723032 151
140 3300029957 Ga0265324_10131771 Ga0265324_101317711 151
141 3300003203 JGI25406J46586_10189624 JGI25406J46586_101896241 152
142 3300005329 Ga0070683_101150946 Ga0070683_1011509461 152
143 3300005985 Ga0081539_10044686 Ga0081539_100446862 152
144 3300009094 Ga0111539_10242530 Ga0111539_102425301 152
145 3300025944 Ga0207661_10504065 Ga0207661_105040652 152
146 3300035115 Ga0373941_0005840 Ga0373941_0005840_2293_2751 152
147 3300049569 Ga0501032_0148088 Ga0501032_0148088_830_1288 152
148 3300049571 Ga0501034_0174113 Ga0501034_0174113_1354_1812 152
149 3300049571 Ga0501034_0257483 Ga0501034_0257483_307_765 152
150 3300049572 Ga0501036_0357996 Ga0501036_0357996_454_912 152
151 3300049574 Ga0501038_0124832 Ga0501038_0124832_307_765 152
152 3300049574 Ga0501038_0492232 Ga0501038_0492232_174_632 152
153 3300049575 Ga0501039_0268321 Ga0501039_0268321_49_507 152
154 3300049579 Ga0501043_0056093 Ga0501043_0056093_834_1292 152
155 3300049581 Ga0501047_0047485 Ga0501047_0047485_2325_2783 152
156 3300049583 Ga0501067_0007928 Ga0501067_0007928_1954_2412 152
157 3300049586 Ga0501070_0084412 Ga0501070_0084412_227_685 152
158 3300049588 Ga0501072_0317793 Ga0501072_0317793_151_609 152
159 3300049741 Ga0501079_0042863 Ga0501079_0042863_828_1286 152
160 3300049822 Ga0501035_0067600 Ga0501035_0067600_1544_2002 152
161 3300049823 Ga0501044_0537969 Ga0501044_0537969_302_760 152
162 3300050511 nmdc:mga08y16_186209_c1 nmdc:mga08y16_186209_c1_1612_2112 152
163 3300005937 Ga0081455_10269981 Ga0081455_102699812 153
164 3300021361 Ga0213872_10075546 Ga0213872_100755462 153
165 3300021377 Ga0213874_10021462 Ga0213874_100214623 153
166 3300026035 Ga0207703_11391119 Ga0207703_113911192 153
167 3300028800 Ga0265338_10096465 Ga0265338_100964654 153
168 3300031901 Ga0307406_11107080 Ga0307406_111070801 153
169 3300039447 Ga0436361_1152524 Ga0436361_1152524_950_1489 153
170 3300039450 Ga0436363_0141246 Ga0436363_0141246_1268_1807 153
171 3300042876 Ga0451577_0000128 Ga0451577_0000128_147770_148276 153
172 3300042876 Ga0451577_0413051 Ga0451577_0413051_84_554 153
173 3300044673 Ga0453683_0000348 Ga0453683_0000348_1818_2288 153
174 3300044712 Ga0453684_0000180 Ga0453684_0000180_264292_264798 153
175 3300044712 Ga0453684_0048979 Ga0453684_0048979_810_1295 153
176 3300044712 Ga0453684_0246571 Ga0453684_0246571_1066_1536 153
177 3300044735 Ga0466968_0022532 Ga0466968_0022532_1914_2393 153
178 3300053087 Ga0500643_043948 Ga0500643_043948_388_855 153
179 3300005539 Ga0068853_100002583 Ga0068853_10000258313 154
180 3300006175 Ga0070712_100003094 Ga0070712_1000030945 154
181 3300025949 Ga0207667_10908683 Ga0207667_109086831 154
182 3300026041 Ga0207639_10003943 Ga0207639_100039437 154
183 3300035118 Ga0373954_0370248 Ga0373954_0370248_11_475 154
184 3300035695 Ga0373927_0274948 Ga0373927_0274948_118_582 154
185 3300046690 Ga0495624_0580274 Ga0495624_0580274_109_573 154
186 3300003215 JGI25153J46596_10001842 JGI25153J46596_1000184211 155
187 3300005295 Ga0065707_10504406 Ga0065707_105044062 155
188 3300006844 Ga0075428_100209850 Ga0075428_1002098502 155
189 3300006846 Ga0075430_100285579 Ga0075430_1002855792 155
190 3300025297 Ga0209758_1001234 Ga0209758_100123415 155
191 3300025297 Ga0209758_1019807 Ga0209758_10198075 155
192 3300025302 Ga0207426_1039072 Ga0207426_10390722 155
193 3300044694 Ga0466963_0087556 Ga0466963_0087556_712_1194 155
194 3300045976 Ga0466967_0530506 Ga0466967_0530506_153_635 155
195 3300049824 Ga0501045_0571588 Ga0501045_0571588_143_610 155
196 2010549000 RicEn_C356 RicEn_06510 156
197 3300005842 Ga0068858_101485118 Ga0068858_1014851182 156
198 3300005983 Ga0081540_1013103 Ga0081540_10131037 156
199 3300006038 Ga0075365_10015935 Ga0075365_100159354 156
200 3300006847 Ga0075431_100272790 Ga0075431_1002727901 156
201 3300031247 Ga0265340_10065692 Ga0265340_100656922 156
202 3300032005 Ga0307411_11069601 Ga0307411_110696012 156
203 3300035086 Ga0373934_0256007 Ga0373934_0256007_70_540 156
204 3300035111 Ga0373923_0256808 Ga0373923_0256808_163_633 156
205 3300035115 Ga0373941_0030991 Ga0373941_0030991_851_1321 156
206 3300036401 Ga0373937_0550788 Ga0373937_0550788_64_534 156
207 3300041411 Ga0439466_0085063 Ga0439466_0085063_242_712 156
208 3300046529 Ga0495652_0211855 Ga0495652_0211855_353_823 156
209 3300047471 Ga0495684_0288612 Ga0495684_0288612_263_733 156
210 3300049568 Ga0501031_0460200 Ga0501031_0460200_12_491 156
211 3300049571 Ga0501034_0656824 Ga0501034_0656824_112_591 156
212 3300050492 nmdc:mga0yw44_111498_c1 nmdc:mga0yw44_111498_c1_758_1246 156
213 3300053093 Ga0500651_0097780 Ga0500651_0097780_1102_1584 156
214 3300053096 Ga0500641_0003557 Ga0500641_0003557_3442_3924 156
215 iso_pu_bacteria 2643221547 2643758346 156

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

47

156

0.91

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

65

158

0.79

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

50

165

0.79

PF13527

Acetyltransf_9

Acetyltransferase (GNAT) domain

22

159

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z4e-assembly1.cif.gz_B crystal structure of transcriptional regulator from bacillus halodurans c-125 0.9227 7 151
2dxq-assembly1.cif.gz_B putative acetyltransferase from agrobacterium tumefaciens str. c58 0.9182 8 150
2dxq-assembly1.cif.gz_B putative acetyltransferase from agrobacterium tumefaciens str. c58 0.9003 8 150
3t9y-assembly1.cif.gz_A-2 crystal structure of gnat family acetyltransferase staphylococcus aureus subsp. aureus usa300_tch1516 0.8887 6 151
1z4e-assembly1.cif.gz_B crystal structure of transcriptional regulator from bacillus halodurans c-125 0.8878 7 151
ID Description Score Start End Superfamily
af_P16691_3_141_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9267 7 148 3.40.630.30
1z4eB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9227 7 151 3.40.630.30
2dxqB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9202 8 150 3.40.630.30
af_P16691_3_141_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9141 7 148 3.40.630.30
2dxqB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9019 8 150 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A4Y9RM19-F1-model_v4 GNAT family N-acetyltransferase 0.9939 7 151 GO:0016747
AF-A0A7C3TUG4-F1-model_v4 GNAT family N-acetyltransferase 0.9738 7 151 GO:0016747
AF-A0A847EHR3-F1-model_v4 GNAT family N-acetyltransferase 0.9721 42 151 GO:0016747
AF-A0A1F8R661-F1-model_v4 N-acetyltransferase domain-containing protein 0.9678 51 151 GO:0016747
AF-A0A327K1C6-F1-model_v4 GNAT family N-acetyltransferase 0.9617 6 155 GO:0016747

Feature Viewer

pLDDT pTM Quality
91.73 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map