F326134

General Info

Members Datasets Scaffolds Average Seq Length
215 149 430 153

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100054995|Ga0070713_1000549951
Length 172
Sequence LPQFQPQSALPAPYIYWMTIPLFNPHAIGYVRSPYKQTAEIPKGLGAKHDAEGVLEILPEFAPGLADIEGFSHVFVIWVFDKSTDFDLIARPPSDDGRPHGVFATRSPRRPNPIGLTTVELLGRDGPKLRVRGVDMLDGTPVLDIKPYLSSVPEHALRRGWLADAEARKGSR

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
63 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
92 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
94 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
95 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
96 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
97 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
98 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
99 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
100 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
103 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
104 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
105 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
106 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
115 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
116 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
121 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
122 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
123 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
124 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
125 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
126 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
127 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
128 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
129 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
130 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
133 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
136 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
137 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
141 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
142 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
143 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
144 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
145 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
146 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
147 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
148 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
149 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.33
Rhizosphere 94.88
Stem 0
Stem Tuber 0
Unclassified 26.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100054995 3300005436 Bacteria 3305
2 LJNas_1001144 3300000546 Unclassified 4036
3 Ga0065704_10643693 3300005289 Bacteria 586
4 Ga0065715_10142521 3300005293 Unclassified 1827
5 Ga0070666_11140469 3300005335 Bacteria 580
6 Ga0070680_100894905 3300005336 Bacteria 766
7 Ga0070689_100489042 3300005340 Unclassified 1052
8 Ga0070675_100218500 3300005354 Unclassified 1659
9 Ga0070674_100299035 3300005356 Unclassified 1282
10 Ga0070673_100060163 3300005364 Bacteria 3009
11 Ga0070688_100173559 3300005365 Bacteria 1490
12 Ga0070688_100282038 3300005365 Bacteria 1194
13 Ga0070709_10197467 3300005434 Unclassified 1423
14 Ga0070709_10238541 3300005434 Bacteria 1305
15 Ga0070714_100687418 3300005435 Bacteria 987
16 Ga0070713_100016695 3300005436 Bacteria 5525
17 Ga0070713_100764209 3300005436 Bacteria 925
18 Ga0070710_10060830 3300005437 Bacteria 2149
19 Ga0070710_10071743 3300005437 Bacteria 1998
20 Ga0070711_100051909 3300005439 Bacteria 2819
21 Ga0070711_101133752 3300005439 Unclassified 675
22 Ga0070694_100235252 3300005444 Bacteria 1380
23 Ga0070708_100000249 3300005445 Bacteria 40182
24 Ga0070685_10148986 3300005466 Bacteria 1481
25 Ga0070706_100006168 3300005467 Bacteria 11339
26 Ga0070707_100003324 3300005468 Bacteria 15187
27 Ga0070698_100004512 3300005471 Bacteria 15304
28 Ga0070699_100000354 3300005518 Bacteria 44648
29 Ga0070697_100000804 3300005536 Bacteria 23566
30 Ga0070697_101511793 3300005536 Unclassified 600
31 Ga0070695_100198982 3300005545 Unclassified 1431
32 Ga0070695_100284473 3300005545 Bacteria 1216
33 Ga0070696_100003084 3300005546 Bacteria 11080
34 Ga0070696_100084413 3300005546 Bacteria 2253
35 Ga0068855_100268405 3300005563 Bacteria 1898
36 Ga0068855_100532945 3300005563 Unclassified 1273
37 Ga0068856_102143952 3300005614 Bacteria 568
38 Ga0070702_100784920 3300005615 Bacteria 735
39 Ga0068852_102730892 3300005616 Unclassified 513
40 Ga0068851_10509884 3300005834 Unclassified 722
41 Ga0068870_10427134 3300005840 Bacteria 868
42 Ga0068858_101476191 3300005842 Bacteria 670
43 Ga0081540_1024242 3300005983 Bacteria 3525
44 Ga0070717_10003895 3300006028 Bacteria 10733
45 Ga0070717_10005428 3300006028 Bacteria 9307
46 Ga0070715_10042118 3300006163 Bacteria 1917
47 Ga0070715_10130285 3300006163 Bacteria 1210
48 Ga0070716_100011749 3300006173 Bacteria 4415
49 Ga0070712_100012631 3300006175 Bacteria 5373
50 Ga0070712_100150597 3300006175 Unclassified 1786
51 Ga0097621_100138891 3300006237 Unclassified 2075
52 Ga0097621_100195382 3300006237 Bacteria 1754
53 Ga0097621_101493809 3300006237 Bacteria 641
54 Ga0068871_100039297 3300006358 Bacteria 3785
55 Ga0068871_101958458 3300006358 Unclassified 557
56 Ga0075433_10850399 3300006852 Unclassified 796
57 Ga0068865_100787932 3300006881 Unclassified 819
58 Ga0075436_100007717 3300006914 Bacteria 7353
59 Ga0105240_10153590 3300009093 Bacteria 2740
60 Ga0105240_10497484 3300009093 Bacteria 1356
61 Ga0105245_10416899 3300009098 Unclassified 1345
62 Ga0105245_11698308 3300009098 Unclassified 684
63 Ga0114129_11109923 3300009147 Bacteria 990
64 Ga0105241_10008762 3300009174 Bacteria 7435
65 Ga0105242_10360606 3300009176 Unclassified 1345
66 Ga0105242_10510379 3300009176 Bacteria 1145
67 Ga0105248_10188377 3300009177 Bacteria 2324
68 Ga0105248_10194357 3300009177 Bacteria 2286
69 Ga0105248_10216212 3300009177 Bacteria 2158
70 Ga0105248_10272547 3300009177 Bacteria 1905
71 Ga0105237_11502682 3300009545 Bacteria 680
72 Ga0105238_10000001 3300009551 Bacteria 2036163
73 Ga0105239_10517517 3300010375 Bacteria 1357
74 Ga0105239_11738520 3300010375 Bacteria 722
75 Ga0157373_10001585 3300013100 Bacteria 17369
76 Ga0157370_10117712 3300013104 Bacteria 2482
77 Ga0157369_10017558 3300013105 Bacteria 8040
78 Ga0157369_10024162 3300013105 Bacteria 6764
79 Ga0157369_10060665 3300013105 Bacteria 4078
80 Ga0157374_10018947 3300013296 Bacteria 6086
81 Ga0157374_12135554 3300013296 Unclassified 587
82 Ga0163162_10669677 3300013306 Unclassified 1161
83 Ga0157372_10001727 3300013307 Bacteria 23703
84 Ga0157372_10022842 3300013307 Bacteria 6773
85 Ga0157375_10843568 3300013308 Bacteria 1063
86 Ga0157375_10971878 3300013308 Bacteria 990
87 Ga0157375_11373402 3300013308 Bacteria 832
88 Ga0163163_10863249 3300014325 Unclassified 968
89 Ga0157379_10090166 3300014968 Bacteria 2751
90 Ga0157379_10269730 3300014968 Bacteria 1547
91 Ga0157376_10259795 3300014969 Unclassified 1626
92 Ga0157376_11247979 3300014969 Bacteria 772
93 Ga0213876_10000080 3300021384 Bacteria 109125
94 Ga0213876_10131602 3300021384 Bacteria 1329
95 Ga0207682_10052078 3300025893 Unclassified 1696
96 Ga0207710_10274791 3300025900 Unclassified 847
97 Ga0207680_10079273 3300025903 Bacteria 2059
98 Ga0207680_11090686 3300025903 Bacteria 571
99 Ga0207699_10013483 3300025906 Bacteria 4186
100 Ga0207684_10001082 3300025910 Bacteria 30517
101 Ga0207654_10027710 3300025911 Bacteria 3082
102 Ga0207707_10529226 3300025912 Bacteria 1003
103 Ga0207695_10018188 3300025913 Bacteria 8133
104 Ga0207693_10014606 3300025915 Bacteria 6310
105 Ga0207693_10039977 3300025915 Bacteria 3693
106 Ga0207693_10209490 3300025915 Bacteria 1532
107 Ga0207663_10492183 3300025916 Bacteria 951
108 Ga0207663_10618511 3300025916 Bacteria 852
109 Ga0207660_10778555 3300025917 Bacteria 781
110 Ga0207646_10014657 3300025922 Bacteria 7427
111 Ga0207694_10000001 3300025924 Bacteria 4078485
112 Ga0207659_10424388 3300025926 Unclassified 1116
113 Ga0207700_10084089 3300025928 Bacteria 2493
114 Ga0207700_10177373 3300025928 Unclassified 1781
115 Ga0207700_10299370 3300025928 Bacteria 1388
116 Ga0207686_10107713 3300025934 Bacteria 1873
117 Ga0207670_11080745 3300025936 Unclassified 677
118 Ga0207665_10009897 3300025939 Bacteria 6256
119 Ga0207711_10343373 3300025941 Unclassified 1382
120 Ga0207711_10385904 3300025941 Bacteria 1300
121 Ga0207711_10539778 3300025941 Bacteria 1088
122 Ga0207711_10588772 3300025941 Unclassified 1038
123 Ga0207667_10308706 3300025949 Bacteria 1616
124 Ga0207651_10083573 3300025960 Bacteria 2309
125 Ga0207712_10471449 3300025961 Unclassified 1068
126 Ga0207703_10299761 3300026035 Unclassified 1465
127 Ga0207703_11298712 3300026035 Bacteria 700
128 Ga0207639_10620415 3300026041 Unclassified 998
129 Ga0207641_11316434 3300026088 Bacteria 723
130 Ga0207641_11698248 3300026088 Bacteria 633
131 Ga0207683_10012125 3300026121 Bacteria 7359
132 Ga0265336_10170112 3300028666 Bacteria 648
133 Ga0265338_10534353 3300028800 Bacteria 822
134 Ga0265324_10044571 3300029957 Bacteria 1529
135 Ga0265760_10011742 3300031090 Unclassified 2503
136 Ga0265332_10189067 3300031238 Bacteria 857
137 Ga0265320_10009804 3300031240 Bacteria 5743
138 Ga0265325_10248929 3300031241 Bacteria 805
139 Ga0265329_10121298 3300031242 Bacteria 838
140 Ga0265340_10131707 3300031247 Bacteria 1146
141 Ga0265339_10144407 3300031249 Bacteria 1208
142 Ga0265331_10006429 3300031250 Bacteria 6942
143 Ga0265316_10069103 3300031344 Bacteria 2726
144 Ga0265316_10220027 3300031344 Bacteria 1401
145 Ga0265316_10564658 3300031344 Unclassified 809
146 Ga0265314_10005960 3300031711 Bacteria 10883
147 Ga0265342_10409057 3300031712 Bacteria 700
148 Ga0373926_0014922 3300035083 Bacteria 2646
149 Ga0373936_0001585 3300035113 Bacteria 8298
150 Ga0373945_0056299 3300035116 Bacteria 1458
151 Ga0373943_0103239 3300035170 Bacteria 1494
152 Ga0373943_0804212 3300035170 Unclassified 560
153 Ga0373935_0092195 3300035692 Unclassified 1985
154 Ga0373935_0191652 3300035692 Bacteria 1408
155 Ga0373935_0873722 3300035692 Unclassified 665
156 Ga0373927_0027836 3300035695 Bacteria 3691
157 Ga0373927_0384153 3300035695 Unclassified 926
158 Ga0373933_0040993 3300035724 Bacteria 2731
159 Ga0373947_0007558 3300035725 Bacteria 6287
160 Ga0373947_0360992 3300035725 Bacteria 976
161 Ga0373947_0396993 3300035725 Unclassified 930
162 Ga0373947_0881649 3300035725 Unclassified 611
163 Ga0373937_0915993 3300036401 Unclassified 825
164 Ga0373925_0024213 3300037068 Bacteria 4431
165 Ga0373925_0335689 3300037068 Bacteria 1225
166 Ga0373925_0903514 3300037068 Unclassified 728
167 Ga0436365_0236145 3300039437 Bacteria 1404
168 Ga0436365_1645708 3300039437 Bacteria 58473
169 Ga0436363_0878152 3300039450 Bacteria 981
170 Ga0436363_0957420 3300039450 Bacteria 955
171 Ga0436362_0441251 3300039453 Bacteria 4538
172 Ga0466963_0297294 3300044694 Unclassified 1135
173 Ga0466959_0221186 3300045049 Unclassified 1313
174 Ga0466958_0379362 3300045836 Unclassified 911
175 Ga0466967_0047401 3300045976 Bacteria 3746
176 Ga0466967_0216621 3300045976 Unclassified 1818
177 Ga0495592_0602578 3300046454 Unclassified 670
178 Ga0495580_0000132 3300046472 Bacteria 52529
179 Ga0495580_0004964 3300046472 Bacteria 11112
180 Ga0495580_0010691 3300046472 Bacteria 7128
181 Ga0495580_0165059 3300046472 Bacteria 1532
182 Ga0495580_0807834 3300046472 Unclassified 608
183 Ga0495582_0007526 3300046473 Bacteria 6021
184 Ga0495662_0053620 3300046476 Unclassified 1948
185 Ga0495664_0165879 3300046477 Bacteria 1340
186 Ga0495665_0016939 3300046531 Bacteria 3921
187 Ga0495665_0095503 3300046531 Unclassified 1561
188 Ga0495665_0147462 3300046531 Bacteria 1229
189 Ga0495640_0020024 3300046533 Unclassified 4932
190 Ga0495645_0204988 3300046543 Bacteria 1335
191 Ga0495635_0207758 3300046663 Bacteria 1327
192 Ga0495635_0578717 3300046663 Unclassified 734
193 Ga0495599_0351809 3300046678 Bacteria 883
194 Ga0495623_0111468 3300046679 Unclassified 1658
195 Ga0495658_0164313 3300046683 Bacteria 1371
196 Ga0495669_0126168 3300046684 Bacteria 1202
197 Ga0495581_0031695 3300047315 Bacteria 3063
198 Ga0495604_0106684 3300047317 Bacteria 2049
199 Ga0495674_0002851 3300047319 Bacteria 16785
200 Ga0495684_0176292 3300047471 Bacteria 1587
201 Ga0495602_0209067 3300048088 Bacteria 1483
202 Ga0496104_0260348 3300048907 Bacteria 1648
203 Ga0496112_0022155 3300048915 Bacteria 6053
204 Ga0496112_0285473 3300048915 Bacteria 1597
205 Ga0496112_1696616 3300048915 Bacteria 544
206 Ga0496115_0043184 3300048918 Bacteria 3595
207 nmdc:mga0qj67_396725_c1 3300050509 Bacteria 1113
208 nmdc:mga0n895_189566_c1 3300050512 Bacteria 2087
209 nmdc:mga0rr50_29933_c1 3300050513 Bacteria 3847
210 nmdc:mga08x19_781_c1 3300050514 Bacteria 20275
211 Ga0495595_0676440 3300053084 Unclassified 529
212 Ga0590074_000037 3300059423 Bacteria 12693
213 Ga0590075_004571 3300059424 Bacteria 3279
214 Ga0590077_000060 3300059426 Bacteria 26907
215 Ga0466962_0221946 3300061719 Unclassified 926
216 Ga0070713_100054995
217 LJNas_1001144
218 Ga0065704_10643693
219 Ga0065715_10142521
220 Ga0070666_11140469
221 Ga0070680_100894905
222 Ga0070689_100489042
223 Ga0070675_100218500
224 Ga0070674_100299035
225 Ga0070673_100060163
226 Ga0070688_100173559
227 Ga0070688_100282038
228 Ga0070709_10197467
229 Ga0070709_10238541
230 Ga0070714_100687418
231 Ga0070713_100016695
232 Ga0070713_100764209
233 Ga0070710_10060830
234 Ga0070710_10071743
235 Ga0070711_100051909
236 Ga0070711_101133752
237 Ga0070694_100235252
238 Ga0070708_100000249
239 Ga0070685_10148986
240 Ga0070706_100006168
241 Ga0070707_100003324
242 Ga0070698_100004512
243 Ga0070699_100000354
244 Ga0070697_100000804
245 Ga0070697_101511793
246 Ga0070695_100198982
247 Ga0070695_100284473
248 Ga0070696_100003084
249 Ga0070696_100084413
250 Ga0068855_100268405
251 Ga0068855_100532945
252 Ga0068856_102143952
253 Ga0070702_100784920
254 Ga0068852_102730892
255 Ga0068851_10509884
256 Ga0068870_10427134
257 Ga0068858_101476191
258 Ga0081540_1024242
259 Ga0070717_10003895
260 Ga0070717_10005428
261 Ga0070715_10042118
262 Ga0070715_10130285
263 Ga0070716_100011749
264 Ga0070712_100012631
265 Ga0070712_100150597
266 Ga0097621_100138891
267 Ga0097621_100195382
268 Ga0097621_101493809
269 Ga0068871_100039297
270 Ga0068871_101958458
271 Ga0075433_10850399
272 Ga0068865_100787932
273 Ga0075436_100007717
274 Ga0105240_10153590
275 Ga0105240_10497484
276 Ga0105245_10416899
277 Ga0105245_11698308
278 Ga0114129_11109923
279 Ga0105241_10008762
280 Ga0105242_10360606
281 Ga0105242_10510379
282 Ga0105248_10188377
283 Ga0105248_10194357
284 Ga0105248_10216212
285 Ga0105248_10272547
286 Ga0105237_11502682
287 Ga0105238_10000001
288 Ga0105239_10517517
289 Ga0105239_11738520
290 Ga0157373_10001585
291 Ga0157370_10117712
292 Ga0157369_10017558
293 Ga0157369_10024162
294 Ga0157369_10060665
295 Ga0157374_10018947
296 Ga0157374_12135554
297 Ga0163162_10669677
298 Ga0157372_10001727
299 Ga0157372_10022842
300 Ga0157375_10843568
301 Ga0157375_10971878
302 Ga0157375_11373402
303 Ga0163163_10863249
304 Ga0157379_10090166
305 Ga0157379_10269730
306 Ga0157376_10259795
307 Ga0157376_11247979
308 Ga0213876_10000080
309 Ga0213876_10131602
310 Ga0207682_10052078
311 Ga0207710_10274791
312 Ga0207680_10079273
313 Ga0207680_11090686
314 Ga0207699_10013483
315 Ga0207684_10001082
316 Ga0207654_10027710
317 Ga0207707_10529226
318 Ga0207695_10018188
319 Ga0207693_10014606
320 Ga0207693_10039977
321 Ga0207693_10209490
322 Ga0207663_10492183
323 Ga0207663_10618511
324 Ga0207660_10778555
325 Ga0207646_10014657
326 Ga0207694_10000001
327 Ga0207659_10424388
328 Ga0207700_10084089
329 Ga0207700_10177373
330 Ga0207700_10299370
331 Ga0207686_10107713
332 Ga0207670_11080745
333 Ga0207665_10009897
334 Ga0207711_10343373
335 Ga0207711_10385904
336 Ga0207711_10539778
337 Ga0207711_10588772
338 Ga0207667_10308706
339 Ga0207651_10083573
340 Ga0207712_10471449
341 Ga0207703_10299761
342 Ga0207703_11298712
343 Ga0207639_10620415
344 Ga0207641_11316434
345 Ga0207641_11698248
346 Ga0207683_10012125
347 Ga0265336_10170112
348 Ga0265338_10534353
349 Ga0265324_10044571
350 Ga0265760_10011742
351 Ga0265332_10189067
352 Ga0265320_10009804
353 Ga0265325_10248929
354 Ga0265329_10121298
355 Ga0265340_10131707
356 Ga0265339_10144407
357 Ga0265331_10006429
358 Ga0265316_10069103
359 Ga0265316_10220027
360 Ga0265316_10564658
361 Ga0265314_10005960
362 Ga0265342_10409057
363 Ga0373926_0014922
364 Ga0373936_0001585
365 Ga0373945_0056299
366 Ga0373943_0103239
367 Ga0373943_0804212
368 Ga0373935_0092195
369 Ga0373935_0191652
370 Ga0373935_0873722
371 Ga0373927_0027836
372 Ga0373927_0384153
373 Ga0373933_0040993
374 Ga0373947_0007558
375 Ga0373947_0360992
376 Ga0373947_0396993
377 Ga0373947_0881649
378 Ga0373937_0915993
379 Ga0373925_0024213
380 Ga0373925_0335689
381 Ga0373925_0903514
382 Ga0436365_0236145
383 Ga0436365_1645708
384 Ga0436363_0878152
385 Ga0436363_0957420
386 Ga0436362_0441251
387 Ga0466963_0297294
388 Ga0466959_0221186
389 Ga0466958_0379362
390 Ga0466967_0047401
391 Ga0466967_0216621
392 Ga0495592_0602578
393 Ga0495580_0000132
394 Ga0495580_0004964
395 Ga0495580_0010691
396 Ga0495580_0165059
397 Ga0495580_0807834
398 Ga0495582_0007526
399 Ga0495662_0053620
400 Ga0495664_0165879
401 Ga0495665_0016939
402 Ga0495665_0095503
403 Ga0495665_0147462
404 Ga0495640_0020024
405 Ga0495645_0204988
406 Ga0495635_0207758
407 Ga0495635_0578717
408 Ga0495599_0351809
409 Ga0495623_0111468
410 Ga0495658_0164313
411 Ga0495669_0126168
412 Ga0495581_0031695
413 Ga0495604_0106684
414 Ga0495674_0002851
415 Ga0495684_0176292
416 Ga0495602_0209067
417 Ga0496104_0260348
418 Ga0496112_0022155
419 Ga0496112_0285473
420 Ga0496112_1696616
421 Ga0496115_0043184
422 nmdc:mga0qj67_396725_c1
423 nmdc:mga0n895_189566_c1
424 nmdc:mga0rr50_29933_c1
425 nmdc:mga08x19_781_c1
426 Ga0495595_0676440
427 Ga0590074_000037
428 Ga0590075_004571
429 Ga0590077_000060
430 Ga0466962_0221946

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01980

TrmO

tRNA-methyltransferase O

40

152

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nv4-assembly1.cif.gz_B crystal structure of upf0066 protein af0241 in complex with s-adenosylmethionine. northeast structural genomics consortium target gr27 0.9175 5 133
2nv4-assembly1.cif.gz_B crystal structure of upf0066 protein af0241 in complex with s-adenosylmethionine. northeast structural genomics consortium target gr27 0.8781 5 133
3okx-assembly1.cif.gz_B crystal structure of yaeb-like protein from rhodopseudomonas palustris 0.8731 1 129
7bu1-assembly1.cif.gz_A crystal structure of trmo from pseudomonas aeruginosa 0.8473 4 141
7btu-assembly1.cif.gz_A crystal structure of trmo from p. areuginosa 0.8362 4 141
ID Description Score Start End Superfamily
2nv4B00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.9165 6 133 2.40.30.70
af_P28634_1_140_2.40.30.70 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.885 3 131 2.40.30.70
2nv4B00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.8765 6 133 2.40.30.70
af_Q9BU70_29_181_2.40.30.70 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.8764 6 139 2.40.30.70
af_Q6NMB4_59_230_2.40.30.70 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.8746 1 131 2.40.30.70
ID Description Score Start End GO Terms
AF-A0A2V9M3B7-F1-model_v4 tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO 0.98 3 149 GO:0008168
GO:0032259
AF-A0A7C1HYZ3-F1-model_v4 tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO 0.9789 34 131
AF-M1ZYY7-F1-model_v4 TsaA-like domain-containing protein 0.977 36 130
AF-A0A1E4BDH0-F1-model_v4 tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO 0.9697 4 155 GO:0008168
GO:0032259
AF-A0A2V8JSI3-F1-model_v4 tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO 0.969 4 153 GO:0008168
GO:0032259

Map