F325971

General Info

Members Datasets Scaffolds Average Seq Length
215 145 430 358

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10116918|Ga0065704_101169181
Length 378
Sequence MRKRVIKYSFMIFFIFLALIVLATVAFMQQPLFGKHPSGARLERIKKSPHYRDGQFQNESFTPDLAEGNSYLKVITKFFFGKSKYNVPGALIPSQKTDLLHLEPEENVLVWFGHSSYFMQIDGKTMLVDPVFSGSASPLKFTTPSFKGTDVYNVEDFPAIDYLFISHDHWDHLDYETILKLKNKVKKVITGLGTGEHFEYWGYDLANIIEKDWNESADLGDGFKVDITPGRHFSGRDFSRNRALWVSFVLQTPTMKIFIGGDSGYDNHFKKIGAQFGPFDLALLECGQYNEAWKYIHMMPEETVTAARDLGARKLMPVHWAKFALSIHDWNEPILRASAEAQKQGMPLVTPLIGQKVELKGDQVFTQWWKEARLQPEG

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
85 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
86 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
87 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
88 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
89 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
90 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
91 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
99 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
100 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
101 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
102 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
103 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
107 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
108 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
109 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
110 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
111 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
112 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
113 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
114 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
115 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
116 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
117 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
118 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
119 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
120 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
121 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
122 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
130 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
131 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
133 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
135 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
136 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
137 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
138 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
139 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
140 2739367663 Pedobacter sp. YR510 Isolate Unclassified
141 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
142 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
143 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
144 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
145 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.74
Metatranscriptomes 0
Isolates 3.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.79
Nodule 0
Rhizoplane 1.4
Rhizosphere 90.7
Stem 0
Stem Tuber 0
Unclassified 6.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10116918 3300005289 Bacteria 1844
2 rootL2_10326718 3300003322 Unclassified 2177
3 Ga0065165_1001300 3300005262 Bacteria 27925
4 Ga0065704_10074578 3300005289 Bacteria 6143
5 Ga0065712_10117673 3300005290 Bacteria 1717
6 Ga0070658_10000421 3300005327 Bacteria 36733
7 Ga0070676_10000635 3300005328 Bacteria 17115
8 Ga0070670_100059222 3300005331 Bacteria 3287
9 Ga0068869_100100500 3300005334 Bacteria 2187
10 Ga0070666_10000393 3300005335 Bacteria 27564
11 Ga0070666_10000852 3300005335 Bacteria 18465
12 Ga0068868_100005045 3300005338 Bacteria 9270
13 Ga0068868_100005798 3300005338 Bacteria 8701
14 Ga0070668_100000454 3300005347 Bacteria 27047
15 Ga0070675_100214748 3300005354 Bacteria 1673
16 Ga0070673_100000614 3300005364 Bacteria 19501
17 Ga0070667_100001035 3300005367 Bacteria 25399
18 Ga0070667_100007646 3300005367 Bacteria 8963
19 Ga0070667_100070987 3300005367 Unclassified 2965
20 Ga0070662_100023182 3300005457 Bacteria 4261
21 Ga0070672_100000382 3300005543 Bacteria 25677
22 Ga0070665_100000647 3300005548 Bacteria 47127
23 Ga0070665_100134670 3300005548 Bacteria 2473
24 Ga0070664_100082034 3300005564 Bacteria 2780
25 Ga0068852_100002298 3300005616 Bacteria 13144
26 Ga0068852_100109310 3300005616 Bacteria 2510
27 Ga0068859_100000023 3300005617 Bacteria 221914
28 Ga0068864_100003069 3300005618 Bacteria 13792
29 Ga0068864_100047133 3300005618 Bacteria 3701
30 Ga0068851_10004056 3300005834 Bacteria 6574
31 Ga0068851_10056680 3300005834 Bacteria 1999
32 Ga0068863_100000424 3300005841 Bacteria 42794
33 Ga0068863_100000987 3300005841 Bacteria 28580
34 Ga0068863_100062437 3300005841 Bacteria 3523
35 Ga0068858_100000968 3300005842 Bacteria 29698
36 Ga0068858_100002898 3300005842 Bacteria 17252
37 Ga0068860_100006274 3300005843 Bacteria 11940
38 Ga0097621_100019055 3300006237 Bacteria 5260
39 Ga0097621_100074851 3300006237 Bacteria 2805
40 Ga0068871_100003331 3300006358 Bacteria 11032
41 Ga0075428_100063735 3300006844 Bacteria 4036
42 Ga0075429_100022544 3300006880 Bacteria 5460
43 Ga0068865_100001783 3300006881 Bacteria 12628
44 Ga0097620_100000023 3300006931 Bacteria 221914
45 Ga0105240_10163375 3300009093 Bacteria 2643
46 Ga0105245_10056646 3300009098 Bacteria 3523
47 Ga0105247_10005239 3300009101 Bacteria 8183
48 Ga0105247_10020785 3300009101 Bacteria 3947
49 Ga0105241_10000527 3300009174 Bacteria 28775
50 Ga0105242_10004617 3300009176 Bacteria 10679
51 Ga0105248_10004286 3300009177 Bacteria 15780
52 Ga0105248_10456837 3300009177 Bacteria 1440
53 Ga0105237_10142913 3300009545 Bacteria 2387
54 Ga0105237_10143829 3300009545 Bacteria 2379
55 Ga0105249_10003678 3300009553 Bacteria 13217
56 Ga0105249_10018490 3300009553 Bacteria 6203
57 Ga0105239_10074733 3300010375 Bacteria 3726
58 Ga0105239_10364350 3300010375 Bacteria 1633
59 Ga0105246_10005674 3300011119 Bacteria 7616
60 Ga0105246_10024196 3300011119 Bacteria 3942
61 Ga0105246_10188760 3300011119 Bacteria 1593
62 Ga0157373_10004131 3300013100 Bacteria 10948
63 Ga0157373_10006937 3300013100 Bacteria 8433
64 Ga0157373_10007172 3300013100 Bacteria 8316
65 Ga0157371_10002378 3300013102 Bacteria 17997
66 Ga0157371_10049331 3300013102 Bacteria 2991
67 Ga0157371_10057723 3300013102 Bacteria 2753
68 Ga0157371_10106509 3300013102 Bacteria 1990
69 Ga0157370_10066710 3300013104 Bacteria 3402
70 Ga0157370_10089230 3300013104 Bacteria 2896
71 Ga0157370_10202104 3300013104 Bacteria 1843
72 Ga0157370_10234186 3300013104 Bacteria 1699
73 Ga0157374_10001228 3300013296 Bacteria 21903
74 Ga0157374_10039451 3300013296 Bacteria 4345
75 Ga0157378_10009431 3300013297 Bacteria 8507
76 Ga0157378_10009841 3300013297 Bacteria 8337
77 Ga0163162_10000415 3300013306 Bacteria 39169
78 Ga0163162_10005718 3300013306 Bacteria 12021
79 Ga0163162_10038403 3300013306 Bacteria 4778
80 Ga0163162_10084762 3300013306 Bacteria 3245
81 Ga0157372_10029072 3300013307 Bacteria 6031
82 Ga0157372_10188568 3300013307 Bacteria 2388
83 Ga0157375_10000830 3300013308 Bacteria 27046
84 Ga0157375_10054780 3300013308 Bacteria 3929
85 Ga0163163_10000492 3300014325 Bacteria 35662
86 Ga0163163_10014408 3300014325 Bacteria 7268
87 Ga0157380_10001006 3300014326 Bacteria 17933
88 Ga0157380_10046511 3300014326 Bacteria 3409
89 Ga0157379_10004933 3300014968 Bacteria 11449
90 Ga0157379_10049151 3300014968 Bacteria 3766
91 Ga0157376_10000373 3300014969 Bacteria 29297
92 Ga0157376_10001179 3300014969 Bacteria 17222
93 Ga0157376_10001590 3300014969 Bacteria 15022
94 Ga0157376_10060044 3300014969 Bacteria 3191
95 Ga0163161_10000762 3300017792 Bacteria 25326
96 Ga0163161_10009326 3300017792 Bacteria 6790
97 Ga0163161_10051600 3300017792 Bacteria 2980
98 Ga0163161_10268290 3300017792 Unclassified 1335
99 Ga0209676_1001714 3300025292 Bacteria 18901
100 Ga0207656_10045777 3300025321 Bacteria 1874
101 Ga0207680_10000373 3300025903 Bacteria 21488
102 Ga0207645_10005520 3300025907 Bacteria 9161
103 Ga0207705_10002791 3300025909 Bacteria 13358
104 Ga0207654_10014156 3300025911 Bacteria 4116
105 Ga0207695_10131289 3300025913 Bacteria 2462
106 Ga0207671_10005636 3300025914 Bacteria 11475
107 Ga0207657_10226351 3300025919 Bacteria 1497
108 Ga0207650_10018737 3300025925 Bacteria 4861
109 Ga0207659_10042695 3300025926 Bacteria 3181
110 Ga0207659_10246095 3300025926 Bacteria 1449
111 Ga0207687_10057282 3300025927 Unclassified 2737
112 Ga0207687_10105670 3300025927 Bacteria 2080
113 Ga0207706_10033636 3300025933 Bacteria 4561
114 Ga0207704_10008869 3300025938 Bacteria 4829
115 Ga0207691_10000054 3300025940 Bacteria 91463
116 Ga0207711_10030415 3300025941 Bacteria 4555
117 Ga0207689_10001785 3300025942 Bacteria 20329
118 Ga0207667_10147928 3300025949 Bacteria 2418
119 Ga0207712_10003491 3300025961 Bacteria 9918
120 Ga0207668_10000404 3300025972 Bacteria 27171
121 Ga0207677_10000969 3300026023 Bacteria 15898
122 Ga0207677_10019265 3300026023 Bacteria 4118
123 Ga0207703_10001211 3300026035 Bacteria 24154
124 Ga0207639_10114870 3300026041 Bacteria 2201
125 Ga0207678_10015676 3300026067 Bacteria 6661
126 Ga0207641_10000250 3300026088 Bacteria 68774
127 Ga0207641_10001018 3300026088 Bacteria 28503
128 Ga0207641_10009645 3300026088 Bacteria 7956
129 Ga0207676_10002229 3300026095 Bacteria 13932
130 Ga0207698_10001510 3300026142 Bacteria 13547
131 Ga0207698_10150125 3300026142 Bacteria 2021
132 Ga0268266_10001784 3300028379 Bacteria 24417
133 Ga0268264_10004794 3300028381 Bacteria 11475
134 Ga0268264_10024939 3300028381 Bacteria 4887
135 Ga0307515_10000057 3300028794 Bacteria 261695
136 Ga0265338_10001166 3300028800 Bacteria 43408
137 Ga0316182_1074762 3300030745 Bacteria 1738
138 Ga0265327_10000743 3300031251 Bacteria 50644
139 Ga0265327_10009252 3300031251 Bacteria 7144
140 Ga0307513_10032599 3300031456 Bacteria 5872
141 Ga0307508_10001120 3300031616 Bacteria 31019
142 Ga0307508_10202406 3300031616 Bacteria 1586
143 Ga0307405_10029143 3300031731 Bacteria 3223
144 Ga0307413_10200221 3300031824 Bacteria 1442
145 Ga0307412_10044162 3300031911 Bacteria 2907
146 Ga0307507_10184302 3300033179 Bacteria 1484
147 Ga0373937_0253539 3300036401 Unclassified 1659
148 Ga0395898_0077081 3300037466 Bacteria 3218
149 Ga0395905_0001735 3300037471 Bacteria 25490
150 Ga0395905_0078100 3300037471 Unclassified 3102
151 Ga0395905_0218605 3300037471 Bacteria 1784
152 Ga0436365_0614130 3300039437 Bacteria 27402
153 Ga0439431_0000247 3300041997 Bacteria 10960
154 Ga0451577_0063732 3300042876 Bacteria 3287
155 Ga0451577_0077166 3300042876 Unclassified 2971
156 Ga0451577_0283468 3300042876 Bacteria 1501
157 Ga0453683_0000397 3300044673 Bacteria 51516
158 Ga0453683_0055095 3300044673 Bacteria 2488
159 Ga0453683_0163982 3300044673 Bacteria 1406
160 Ga0466965_0062633 3300044683 Bacteria 1861
161 Ga0453684_0000501 3300044712 Bacteria 153475
162 Ga0453684_0000648 3300044712 Bacteria 125276
163 Ga0453684_0013640 3300044712 Bacteria 13165
164 Ga0453684_0016876 3300044712 Bacteria 11364
165 Ga0453684_0044269 3300044712 Bacteria 5961
166 Ga0453684_0066020 3300044712 Bacteria 4610
167 Ga0453684_0086877 3300044712 Bacteria 3879
168 Ga0453684_0146165 3300044712 Bacteria 2816
169 Ga0453684_0200091 3300044712 Bacteria 2329
170 Ga0466970_0139370 3300044765 Bacteria 1335
171 Ga0466959_0092735 3300045049 Unclassified 2168
172 Ga0451576_0000044 3300045051 Bacteria 334467
173 Ga0451576_0063006 3300045051 Bacteria 3865
174 Ga0495627_001532 3300046453 Bacteria 13260
175 Ga0495580_0034599 3300046472 Bacteria 3637
176 Ga0495607_0097671 3300046501 Bacteria 1579
177 Ga0495606_0029124 3300046507 Bacteria 3882
178 Ga0495643_0001043 3300046522 Bacteria 28066
179 Ga0495668_0000257 3300046616 Bacteria 75166
180 Ga0495625_0066155 3300046660 Bacteria 2546
181 Ga0495658_0132912 3300046683 Bacteria 1516
182 Ga0495604_0133263 3300047317 Bacteria 1784
183 Ga0495636_0029540 3300047318 Unclassified 2238
184 Ga0496109_0057514 3300048912 Bacteria 3550
185 Ga0496110_0201225 3300048913 Unclassified 1810
186 Ga0496115_0010578 3300048918 Bacteria 6900
187 Ga0496122_0090377 3300048925 Bacteria 2090
188 Ga0496125_0000189 3300048928 Bacteria 133541
189 Ga0496126_0010307 3300048929 Bacteria 9812
190 Ga0501032_0071269 3300049569 Unclassified 2316
191 Ga0501033_0042795 3300049570 Bacteria 3376
192 Ga0501034_0006117 3300049571 Bacteria 12989
193 Ga0501034_0031359 3300049571 Bacteria 5399
194 Ga0501037_0031425 3300049573 Bacteria 3920
195 Ga0501038_0011987 3300049574 Bacteria 7916
196 Ga0501039_0052394 3300049575 Unclassified 3158
197 Ga0501043_0016984 3300049579 Bacteria 5706
198 Ga0501198_005675 3300049649 Bacteria 1761
199 Ga0501223_000221 3300049663 Bacteria 14582
200 Ga0501035_0009860 3300049822 Bacteria 8869
201 Ga0501044_0008208 3300049823 Bacteria 11459
202 Ga0501044_0239075 3300049823 Unclassified 1760
203 nmdc:mga06r32_160403_c1 3300050510 Unclassified 2231
204 nmdc:mga08y16_598109_c1 3300050511 Bacteria 1112
205 Ga0500646_0007320 3300053090 Bacteria 2821
206 Ga0500641_0000057 3300053096 Bacteria 48444
207 Ga0500622_0000844 3300053156 Bacteria 26216
208 Ga0500637_0151657 3300053178 Bacteria 1339
209 2522548155 2522125168 Bacteria 7376607
210 2739645961 2739367663 Bacteria 5040914
211 2881248765 2881247448 Bacteria 3717788
212 2910247019 2910245624 Bacteria 6935613
213 2958515626 2958512119 Bacteria 4528530
214 8036738938 8036736890 Bacteria 2944828
215 8055590845 8055588893 Bacteria 3619545
216 Ga0065704_10116918
217 rootL2_10326718
218 Ga0065165_1001300
219 Ga0065704_10074578
220 Ga0065712_10117673
221 Ga0070658_10000421
222 Ga0070676_10000635
223 Ga0070670_100059222
224 Ga0068869_100100500
225 Ga0070666_10000393
226 Ga0070666_10000852
227 Ga0068868_100005045
228 Ga0068868_100005798
229 Ga0070668_100000454
230 Ga0070675_100214748
231 Ga0070673_100000614
232 Ga0070667_100001035
233 Ga0070667_100007646
234 Ga0070667_100070987
235 Ga0070662_100023182
236 Ga0070672_100000382
237 Ga0070665_100000647
238 Ga0070665_100134670
239 Ga0070664_100082034
240 Ga0068852_100002298
241 Ga0068852_100109310
242 Ga0068859_100000023
243 Ga0068864_100003069
244 Ga0068864_100047133
245 Ga0068851_10004056
246 Ga0068851_10056680
247 Ga0068863_100000424
248 Ga0068863_100000987
249 Ga0068863_100062437
250 Ga0068858_100000968
251 Ga0068858_100002898
252 Ga0068860_100006274
253 Ga0097621_100019055
254 Ga0097621_100074851
255 Ga0068871_100003331
256 Ga0075428_100063735
257 Ga0075429_100022544
258 Ga0068865_100001783
259 Ga0097620_100000023
260 Ga0105240_10163375
261 Ga0105245_10056646
262 Ga0105247_10005239
263 Ga0105247_10020785
264 Ga0105241_10000527
265 Ga0105242_10004617
266 Ga0105248_10004286
267 Ga0105248_10456837
268 Ga0105237_10142913
269 Ga0105237_10143829
270 Ga0105249_10003678
271 Ga0105249_10018490
272 Ga0105239_10074733
273 Ga0105239_10364350
274 Ga0105246_10005674
275 Ga0105246_10024196
276 Ga0105246_10188760
277 Ga0157373_10004131
278 Ga0157373_10006937
279 Ga0157373_10007172
280 Ga0157371_10002378
281 Ga0157371_10049331
282 Ga0157371_10057723
283 Ga0157371_10106509
284 Ga0157370_10066710
285 Ga0157370_10089230
286 Ga0157370_10202104
287 Ga0157370_10234186
288 Ga0157374_10001228
289 Ga0157374_10039451
290 Ga0157378_10009431
291 Ga0157378_10009841
292 Ga0163162_10000415
293 Ga0163162_10005718
294 Ga0163162_10038403
295 Ga0163162_10084762
296 Ga0157372_10029072
297 Ga0157372_10188568
298 Ga0157375_10000830
299 Ga0157375_10054780
300 Ga0163163_10000492
301 Ga0163163_10014408
302 Ga0157380_10001006
303 Ga0157380_10046511
304 Ga0157379_10004933
305 Ga0157379_10049151
306 Ga0157376_10000373
307 Ga0157376_10001179
308 Ga0157376_10001590
309 Ga0157376_10060044
310 Ga0163161_10000762
311 Ga0163161_10009326
312 Ga0163161_10051600
313 Ga0163161_10268290
314 Ga0209676_1001714
315 Ga0207656_10045777
316 Ga0207680_10000373
317 Ga0207645_10005520
318 Ga0207705_10002791
319 Ga0207654_10014156
320 Ga0207695_10131289
321 Ga0207671_10005636
322 Ga0207657_10226351
323 Ga0207650_10018737
324 Ga0207659_10042695
325 Ga0207659_10246095
326 Ga0207687_10057282
327 Ga0207687_10105670
328 Ga0207706_10033636
329 Ga0207704_10008869
330 Ga0207691_10000054
331 Ga0207711_10030415
332 Ga0207689_10001785
333 Ga0207667_10147928
334 Ga0207712_10003491
335 Ga0207668_10000404
336 Ga0207677_10000969
337 Ga0207677_10019265
338 Ga0207703_10001211
339 Ga0207639_10114870
340 Ga0207678_10015676
341 Ga0207641_10000250
342 Ga0207641_10001018
343 Ga0207641_10009645
344 Ga0207676_10002229
345 Ga0207698_10001510
346 Ga0207698_10150125
347 Ga0268266_10001784
348 Ga0268264_10004794
349 Ga0268264_10024939
350 Ga0307515_10000057
351 Ga0265338_10001166
352 Ga0316182_1074762
353 Ga0265327_10000743
354 Ga0265327_10009252
355 Ga0307513_10032599
356 Ga0307508_10001120
357 Ga0307508_10202406
358 Ga0307405_10029143
359 Ga0307413_10200221
360 Ga0307412_10044162
361 Ga0307507_10184302
362 Ga0373937_0253539
363 Ga0395898_0077081
364 Ga0395905_0001735
365 Ga0395905_0078100
366 Ga0395905_0218605
367 Ga0436365_0614130
368 Ga0439431_0000247
369 Ga0451577_0063732
370 Ga0451577_0077166
371 Ga0451577_0283468
372 Ga0453683_0000397
373 Ga0453683_0055095
374 Ga0453683_0163982
375 Ga0466965_0062633
376 Ga0453684_0000501
377 Ga0453684_0000648
378 Ga0453684_0013640
379 Ga0453684_0016876
380 Ga0453684_0044269
381 Ga0453684_0066020
382 Ga0453684_0086877
383 Ga0453684_0146165
384 Ga0453684_0200091
385 Ga0466970_0139370
386 Ga0466959_0092735
387 Ga0451576_0000044
388 Ga0451576_0063006
389 Ga0495627_001532
390 Ga0495580_0034599
391 Ga0495607_0097671
392 Ga0495606_0029124
393 Ga0495643_0001043
394 Ga0495668_0000257
395 Ga0495625_0066155
396 Ga0495658_0132912
397 Ga0495604_0133263
398 Ga0495636_0029540
399 Ga0496109_0057514
400 Ga0496110_0201225
401 Ga0496115_0010578
402 Ga0496122_0090377
403 Ga0496125_0000189
404 Ga0496126_0010307
405 Ga0501032_0071269
406 Ga0501033_0042795
407 Ga0501034_0006117
408 Ga0501034_0031359
409 Ga0501037_0031425
410 Ga0501038_0011987
411 Ga0501039_0052394
412 Ga0501043_0016984
413 Ga0501198_005675
414 Ga0501223_000221
415 Ga0501035_0009860
416 Ga0501044_0008208
417 Ga0501044_0239075
418 nmdc:mga06r32_160403_c1
419 nmdc:mga08y16_598109_c1
420 Ga0500646_0007320
421 Ga0500641_0000057
422 Ga0500622_0000844
423 Ga0500637_0151657
424 2522548155
425 2739645961
426 2881248765
427 2910247019
428 2958515626
429 8036738938
430 8055590845

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

109

173

0.92

PF12706

Lactamase_B_2

Beta-lactamase superfamily domain

124

320

0.91

PF13483

Lactamase_B_3

Beta-lactamase superfamily domain

108

319

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kl7-assembly1.cif.gz_A crystal structure of putative metal-dependent hydrolase (yp_001302908.1) from parabacteroides distasonis atcc 8503 at 2.30 a resolution 0.8429 98 339
3x2y-assembly1.cif.gz_C crystal structure of metallo-beta-lactamase h8a from thermotoga maritima 0.842 98 350
3x2x-assembly1.cif.gz_C crystal structure of metallo-beta-lactamase h48a from thermotoga maritima 0.8413 98 350
3x30-assembly1.cif.gz_A crystal structure of metallo-beta-lactamase from thermotoga maritima 0.8363 98 350
3x2y-assembly1.cif.gz_C crystal structure of metallo-beta-lactamase h8a from thermotoga maritima 0.835 98 350
ID Description Score Start End Superfamily
af_P9WKP3_98_359_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9561 97 348 3.60.15.10
af_Q965X7_61_355_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9363 83 352 3.60.15.10
af_Q8BH82_99_394_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9315 83 351 3.60.15.10
af_P9WKP3_98_359_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.917 97 348 3.60.15.10
af_Q02883_187_468_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.894 86 351 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A2K8ZB76-F1-model_v4 MBL fold metallo-hydrolase 0.9891 1 362 GO:0005737
GO:0008270
GO:0070290
AF-A0A6N4EET7-F1-model_v4 deleted 0.9887 1 362
AF-A0A4R6G131-F1-model_v4 L-ascorbate metabolism protein UlaG (Beta-lactamase superfamily) 0.9878 22 362 GO:0005737
GO:0008270
GO:0070290
AF-A0A2K8ZB76-F1-model_v4 MBL fold metallo-hydrolase 0.9864 1 362 GO:0005737
GO:0008270
GO:0070290
AF-A0A6N4EET7-F1-model_v4 deleted 0.986 1 362

Map