F325742

General Info

Members Datasets Scaffolds Average Seq Length
214 166 205 142

Family's Representative Sequence

Representative Sequence 3300049670|Ga0501236_003879|Ga0501236_003879_24_539
Length 171
Sequence LTLGALKTGFDSLRAKEYGRLKEWVGMSLYGTYDPQNIFARVLRGELPCYKVYEDENVLAFLDLFPQSRGHTLVIPKNHQARNLLELDDEAIGPLFQAVKKVMKAVIAEVEPDGVQLHQFNGGEGSQSVFHIHVHIVPRWPGQPLGLHGQQKGDPAELEALAARLSARLAG

Samples

Sample ID Description Type Environment
1 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
2 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
3 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
4 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
5 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
6 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
7 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
8 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
38 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
39 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
51 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
52 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
53 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
54 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
55 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
56 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
57 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
58 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
59 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
60 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
61 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
62 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
63 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
64 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
65 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
66 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
67 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
68 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
69 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
70 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
71 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
72 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
75 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
76 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
77 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
78 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
79 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
80 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
81 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
82 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
83 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
84 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
85 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
86 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
87 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
88 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
89 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
90 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
91 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
92 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
93 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
94 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
95 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
96 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
97 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
98 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
99 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
100 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
101 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
102 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
103 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
104 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
105 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
106 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
107 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
108 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
109 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
110 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
111 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
112 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
113 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
114 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
127 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
128 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
129 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
130 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
131 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
132 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
133 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
134 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
135 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
136 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
137 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
138 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
139 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
140 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
141 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
142 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
143 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
144 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
145 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
146 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
147 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
148 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
151 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
152 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
153 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
154 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
158 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
159 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
160 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
161 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
162 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
163 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
166 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.86
Metatranscriptomes 0.93
Isolates 4.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.74
Nodule 0.47
Rhizoplane 8.88
Rhizosphere 80.84
Stem 0
Stem Tuber 0
Unclassified 6.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10075715 3300003320 Bacteria 2149
2 Ga0065165_1049080 3300005262 Bacteria 1209
3 Ga0070658_10090733 3300005327 Bacteria 2518
4 Ga0070658_10976079 3300005327 Bacteria 737
5 Ga0070690_100295459 3300005330 Bacteria 1160
6 Ga0068869_100435246 3300005334 Bacteria 1084
7 Ga0070671_101042557 3300005355 Unclassified 717
8 Ga0070671_101489274 3300005355 Bacteria 599
9 Ga0070679_101663250 3300005530 Bacteria 586
10 Ga0070696_101907787 3300005546 Unclassified 515
11 Ga0070704_101382715 3300005549 Bacteria 645
12 Ga0068859_101031884 3300005617 Unclassified 904
13 Ga0068851_10962359 3300005834 Bacteria 537
14 Ga0068863_100158249 3300005841 Bacteria 2169
15 Ga0068860_100286385 3300005843 Bacteria 1611
16 Ga0068862_100159369 3300005844 Bacteria 2013
17 Ga0068862_101004319 3300005844 Unclassified 825
18 Ga0075363_100735883 3300006048 Bacteria 597
19 Ga0075436_101060834 3300006914 Unclassified 609
20 Ga0097620_101031839 3300006931 Unclassified 904
21 Ga0105243_10283401 3300009148 Bacteria 1494
22 Ga0105241_10061198 3300009174 Bacteria 2899
23 Ga0105242_10435689 3300009176 Bacteria 1232
24 Ga0105242_11088325 3300009176 Unclassified 812
25 Ga0105242_12009803 3300009176 Bacteria 620
26 Ga0105248_10006796 3300009177 Bacteria 12541
27 Ga0105248_10256643 3300009177 Unclassified 1968
28 Ga0105238_10168801 3300009551 Bacteria 2164
29 Ga0105249_10208917 3300009553 Unclassified 1914
30 Ga0105249_10363447 3300009553 Bacteria 1469
31 Ga0105246_11071738 3300011119 Bacteria 734
32 Ga0157374_11142019 3300013296 Bacteria 800
33 Ga0163162_10324125 3300013306 Bacteria 1673
34 Ga0157379_12562312 3300014968 Bacteria 510
35 Ga0157376_12039497 3300014969 Bacteria 612
36 Ga0163161_10597629 3300017792 Bacteria 909
37 Ga0213872_10047453 3300021361 Bacteria 1953
38 Ga0207656_10316983 3300025321 Bacteria 774
39 Ga0207654_10136903 3300025911 Bacteria 1557
40 Ga0207650_10060051 3300025925 Bacteria 2837
41 Ga0207644_10389382 3300025931 Bacteria 1138
42 Ga0207644_10859159 3300025931 Unclassified 760
43 Ga0207686_10193908 3300025934 Bacteria 1450
44 Ga0207686_10270889 3300025934 Bacteria 1249
45 Ga0207709_10397380 3300025935 Bacteria 1053
46 Ga0207711_10151406 3300025941 Bacteria 2093
47 Ga0207689_10473853 3300025942 Bacteria 1048
48 Ga0207712_10351589 3300025961 Bacteria 1225
49 Ga0207712_10596996 3300025961 Unclassified 954
50 Ga0207641_10129189 3300026088 Bacteria 2266
51 Ga0207641_10518576 3300026088 Bacteria 1159
52 Ga0268265_10007318 3300028380 Bacteria 7451
53 Ga0268265_10171211 3300028380 Bacteria 1856
54 Ga0268265_10999049 3300028380 Unclassified 826
55 Ga0265340_10144034 3300031247 Bacteria 1089
56 Ga0265339_10165784 3300031249 Bacteria 1109
57 Ga0307408_100000027 3300031548 Bacteria 261506
58 Ga0265342_10062823 3300031712 Bacteria 2184
59 Ga0307410_10251800 3300031852 Bacteria 1373
60 Ga0307407_10184473 3300031903 Bacteria 1385
61 Ga0307407_10775302 3300031903 Bacteria 728
62 Ga0307412_10512845 3300031911 Bacteria 1000
63 Ga0307412_11344208 3300031911 Bacteria 645
64 Ga0307409_100288202 3300031995 Bacteria 1521
65 Ga0307411_10217370 3300032005 Bacteria 1480
66 Ga0307510_10134717 3300033180 Bacteria 2132
67 Ga0373948_0211909 3300034817 Bacteria 509
68 Ga0373928_0028874 3300035084 Bacteria 1216
69 Ga0373940_0296786 3300035088 Bacteria 555
70 Ga0373951_0033920 3300035091 Bacteria 1211
71 Ga0373952_0053759 3300035092 Bacteria 967
72 Ga0373939_0071729 3300035114 Bacteria 1129
73 Ga0373939_0373750 3300035114 Bacteria 585
74 Ga0373960_0068170 3300035121 Bacteria 1094
75 Ga0373942_0006179 3300035207 Bacteria 2764
76 Ga0373962_0008989 3300035242 Bacteria 2467
77 Ga0373962_0056393 3300035242 Bacteria 1144
78 Ga0373931_0038472 3300035691 Bacteria 2502
79 Ga0373931_0346003 3300035691 Unclassified 930
80 Ga0373931_0947684 3300035691 Bacteria 580
81 Ga0373935_0615451 3300035692 Bacteria 795
82 Ga0395899_0000013 3300037312 Bacteria 510397
83 Ga0436364_0496516 3300037853 Bacteria 3633
84 Ga0436364_1025470 3300037853 Bacteria 721
85 Ga0395901_0616000 3300038443 Bacteria 1093
86 Ga0436365_0083694 3300039437 Bacteria 3160
87 Ga0436365_1136182 3300039437 Bacteria 986
88 Ga0436361_0247502 3300039447 Bacteria 714
89 Ga0436361_0417388 3300039447 Bacteria 682
90 Ga0436361_0960944 3300039447 Bacteria 3279
91 Ga0436361_0995372 3300039447 Bacteria 1410
92 Ga0439464_0000151 3300042439 Bacteria 11358
93 Ga0466966_0149490 3300044684 Bacteria 1425
94 Ga0466961_0077279 3300044693 Bacteria 2109
95 Ga0466971_0289502 3300044719 Bacteria 785
96 Ga0466968_0090016 3300044735 Bacteria 1358
97 Ga0466957_0300961 3300044842 Bacteria 1078
98 Ga0495639_0519062 3300046475 Bacteria 609
99 Ga0495628_0152155 3300046516 Bacteria 1762
100 Ga0495597_0118877 3300046542 Bacteria 1103
101 Ga0495622_0016228 3300046557 Bacteria 3467
102 Ga0495658_0089088 3300046683 Bacteria 1825
103 Ga0495649_0039806 3300046694 Bacteria 2577
104 Ga0495589_0078215 3300046794 Bacteria 1611
105 Ga0495672_0111873 3300047320 Bacteria 1464
106 Ga0495626_0112461 3300048091 Bacteria 1178
107 Ga0496100_0265878 3300048903 Bacteria 1273
108 Ga0496101_0087840 3300048904 Bacteria 2308
109 Ga0496102_0053546 3300048905 Bacteria 3678
110 Ga0496103_0036052 3300048906 Bacteria 3029
111 Ga0496104_0011928 3300048907 Bacteria 7795
112 Ga0496106_0020646 3300048909 Bacteria 4891
113 Ga0496106_0177183 3300048909 Bacteria 1692
114 Ga0496107_0078539 3300048910 Bacteria 2405
115 Ga0496109_0064969 3300048912 Bacteria 3340
116 Ga0496109_1473543 3300048912 Bacteria 616
117 Ga0496110_0112080 3300048913 Bacteria 2452
118 Ga0496111_0033129 3300048914 Bacteria 3685
119 Ga0496112_0188955 3300048915 Bacteria 2022
120 Ga0496112_0870964 3300048915 Bacteria 823
121 Ga0496112_1226918 3300048915 Bacteria 666
122 Ga0496115_0174098 3300048918 Bacteria 1779
123 Ga0496122_0389260 3300048925 Unclassified 712
124 Ga0496124_0433163 3300048927 Bacteria 902
125 Ga0496125_0053514 3300048928 Plasmid 3307
126 Ga0496126_0012397 3300048929 Bacteria 8738
127 Ga0501290_097780 3300049513 Bacteria 519
128 Ga0501292_000044 3300049515 Bacteria 28741
129 Ga0501294_000023 3300049517 Bacteria 15801
130 Ga0501297_036423 3300049520 Bacteria 675
131 Ga0501299_016090 3300049522 Bacteria 1321
132 Ga0501300_001297 3300049523 Bacteria 3770
133 Ga0501301_004058 3300049524 Bacteria 1027
134 Ga0501314_000379 3300049530 Bacteria 2709
135 Ga0501317_003054 3300049533 Bacteria 1636
136 Ga0501032_0075321 3300049569 Bacteria 2247
137 Ga0501033_0025887 3300049570 Bacteria 4417
138 Ga0501034_0101694 3300049571 Bacteria 2867
139 Ga0501036_0002829 3300049572 Bacteria 13751
140 Ga0501037_0032091 3300049573 Bacteria 3877
141 Ga0501038_0028917 3300049574 Bacteria 4918
142 Ga0501038_0991790 3300049574 Bacteria 617
143 Ga0501039_0048297 3300049575 Bacteria 3290
144 Ga0501043_0059802 3300049579 Bacteria 2990
145 Ga0501047_0045958 3300049581 Bacteria 4221
146 Ga0501047_0270128 3300049581 Bacteria 1547
147 Ga0501048_0009262 3300049582 Bacteria 7397
148 Ga0501048_0593367 3300049582 Bacteria 795
149 Ga0501067_0009519 3300049583 Bacteria 5382
150 Ga0501067_0588077 3300049583 Bacteria 624
151 Ga0501068_0067881 3300049584 Bacteria 2173
152 Ga0501069_0001900 3300049585 Bacteria 10423
153 Ga0501070_0016439 3300049586 Bacteria 6217
154 Ga0501070_0589539 3300049586 Bacteria 887
155 Ga0501070_0786355 3300049586 Bacteria 748
156 Ga0501071_0020855 3300049587 Bacteria 4559
157 Ga0501071_0746353 3300049587 Bacteria 754
158 Ga0501074_0023154 3300049590 Bacteria 4516
159 Ga0501198_002836 3300049649 Bacteria 2352
160 Ga0501202_039757 3300049652 Bacteria 1012
161 Ga0501223_000435 3300049663 Bacteria 10163
162 Ga0501223_005410 3300049663 Bacteria 2684
163 Ga0501223_008192 3300049663 Bacteria 2130
164 Ga0501224_000010 3300049664 Bacteria 93410
165 Ga0501224_000414 3300049664 Bacteria 5096
166 Ga0501227_002992 3300049665 Bacteria 3692
167 Ga0501233_010299 3300049668 Bacteria 1839
168 Ga0501235_005886 3300049669 Bacteria 2669
169 Ga0501236_003879 3300049670 Bacteria 1756
170 Ga0501243_124957 3300049675 Bacteria 535
171 Ga0501257_000362 3300049686 Bacteria 8855
172 Ga0501259_000029 3300049688 Bacteria 20126
173 Ga0501261_000026 3300049690 Bacteria 34772
174 Ga0501221_017970 3300049704 Bacteria 1356
175 Ga0501221_089459 3300049704 Unclassified 751
176 Ga0501225_0009357 3300049705 Bacteria 2791
177 Ga0501234_003650 3300049707 Bacteria 2418
178 Ga0501245_003072 3300049708 Bacteria 2252
179 Ga0501245_054016 3300049708 Bacteria 719
180 Ga0501079_0093531 3300049741 Bacteria 2329
181 Ga0501079_0480236 3300049741 Bacteria 977
182 Ga0501080_0002083 3300049742 Bacteria 17358
183 Ga0501080_0078531 3300049742 Bacteria 3069
184 Ga0501083_0001750 3300049744 Bacteria 14813
185 Ga0501083_0006139 3300049744 Bacteria 8521
186 Ga0501279_000001 3300049775 Bacteria 299671
187 Ga0501280_000077 3300049776 Bacteria 26151
188 Ga0501280_001435 3300049776 Bacteria 4420
189 Ga0501281_00027 3300049777 Bacteria 18342
190 Ga0501282_000422 3300049778 Bacteria 4992
191 Ga0501035_0046577 3300049822 Bacteria 3900
192 Ga0501044_0136529 3300049823 Bacteria 2444
193 Ga0501044_0498268 3300049823 Bacteria 1120
194 Ga0501044_1244111 3300049823 Bacteria 612
195 Ga0501226_000036 3300049853 Bacteria 66785
196 Ga0501284_03707 3300050005 Bacteria 857
197 Ga0500643_012827 3300053087 Bacteria 2987
198 Ga0500643_038590 3300053087 Bacteria 1415
199 Ga0500655_006981 3300053133 Bacteria 2030
200 Ga0500616_0026725 3300053153 Bacteria 3192
201 Ga0500622_0018626 3300053156 Bacteria 3690
202 Ga0500645_011932 3300053730 Bacteria 2820
203 Ga0501084_0106352 3300054114 Bacteria 2357
204 Ga0501082_0052191 3300060353 Bacteria 3525
205 Ga0501082_0350791 3300060353 Unclassified 1286

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039437 Ga0436365_1136182 Ga0436365_1136182_604_963 119
2 3300006048 Ga0075363_100735883 Ga0075363_1007358832 124
3 3300048915 Ga0496112_0870964 Ga0496112_0870964_32_457 129
4 3300005330 Ga0070690_100295459 Ga0070690_1002954592 130
5 3300005355 Ga0070671_101489274 Ga0070671_1014892742 130
6 3300005834 Ga0068851_10962359 Ga0068851_109623592 130
7 3300009148 Ga0105243_10283401 Ga0105243_102834012 130
8 3300009176 Ga0105242_10435689 Ga0105242_104356892 130
9 3300009177 Ga0105248_10006796 Ga0105248_1000679610 130
10 3300013296 Ga0157374_11142019 Ga0157374_111420192 130
11 3300013306 Ga0163162_10324125 Ga0163162_103241252 130
12 3300014968 Ga0157379_12562312 Ga0157379_125623121 130
13 3300025931 Ga0207644_10389382 Ga0207644_103893822 130
14 3300025934 Ga0207686_10270889 Ga0207686_102708891 130
15 3300025935 Ga0207709_10397380 Ga0207709_103973802 130
16 3300025941 Ga0207711_10151406 Ga0207711_101514063 130
17 3300031247 Ga0265340_10144034 Ga0265340_101440341 130
18 3300031249 Ga0265339_10165784 Ga0265339_101657842 130
19 3300031712 Ga0265342_10062823 Ga0265342_100628233 130
20 3300035084 Ga0373928_0028874 Ga0373928_0028874_583_1008 130
21 3300035091 Ga0373951_0033920 Ga0373951_0033920_109_534 130
22 3300035092 Ga0373952_0053759 Ga0373952_0053759_69_494 130
23 3300035114 Ga0373939_0071729 Ga0373939_0071729_210_635 130
24 3300035121 Ga0373960_0068170 Ga0373960_0068170_541_966 130
25 3300035242 Ga0373962_0056393 Ga0373962_0056393_589_1014 130
26 3300035691 Ga0373931_0038472 Ga0373931_0038472_1117_1542 130
27 3300035692 Ga0373935_0615451 Ga0373935_0615451_107_532 130
28 3300048903 Ga0496100_0265878 Ga0496100_0265878_804_1229 130
29 3300048904 Ga0496101_0087840 Ga0496101_0087840_598_1023 130
30 3300048905 Ga0496102_0053546 Ga0496102_0053546_732_1157 130
31 3300048906 Ga0496103_0036052 Ga0496103_0036052_1751_2176 130
32 3300048907 Ga0496104_0011928 Ga0496104_0011928_1694_2119 130
33 3300048909 Ga0496106_0020646 Ga0496106_0020646_551_976 130
34 3300048910 Ga0496107_0078539 Ga0496107_0078539_546_971 130
35 3300048912 Ga0496109_0064969 Ga0496109_0064969_2681_3106 130
36 3300048913 Ga0496110_0112080 Ga0496110_0112080_978_1403 130
37 3300048914 Ga0496111_0033129 Ga0496111_0033129_784_1209 130
38 3300048915 Ga0496112_0188955 Ga0496112_0188955_1231_1656 130
39 3300048915 Ga0496112_1226918 Ga0496112_1226918_205_630 130
40 3300048918 Ga0496115_0174098 Ga0496115_0174098_304_729 130
41 3300011119 Ga0105246_11071738 Ga0105246_110717382 132
42 3300035691 Ga0373931_0947684 Ga0373931_0947684_26_451 134
43 iso_pu_bacteria 2894232714 2894239227 137
44 3300005841 Ga0068863_100158249 Ga0068863_1001582492 138
45 3300026088 Ga0207641_10129189 Ga0207641_101291893 138
46 3300035088 Ga0373940_0296786 Ga0373940_0296786_13_435 138
47 3300035207 Ga0373942_0006179 Ga0373942_0006179_2172_2594 138
48 3300046516 Ga0495628_0152155 Ga0495628_0152155_1005_1427 138
49 3300046542 Ga0495597_0118877 Ga0495597_0118877_507_929 138
50 3300046557 Ga0495622_0016228 Ga0495622_0016228_876_1298 138
51 3300046683 Ga0495658_0089088 Ga0495658_0089088_114_536 138
52 3300046694 Ga0495649_0039806 Ga0495649_0039806_166_588 138
53 3300046794 Ga0495589_0078215 Ga0495589_0078215_849_1271 138
54 3300047320 Ga0495672_0111873 Ga0495672_0111873_1010_1432 138
55 3300048091 Ga0495626_0112461 Ga0495626_0112461_568_990 138
56 3300053133 Ga0500655_006981 Ga0500655_006981_1287_1709 138
57 iso_pu_bacteria 2821443989 2821445443 139
58 3300031903 Ga0307407_10775302 Ga0307407_107753022 140
59 3300035242 Ga0373962_0008989 Ga0373962_0008989_872_1303 140
60 3300035691 Ga0373931_0346003 Ga0373931_0346003_18_449 140
61 3300044842 Ga0466957_0300961 Ga0466957_0300961_495_917 140
62 3300053153 Ga0500616_0026725 Ga0500616_0026725_1831_2253 140
63 iso_pu_bacteria 2600254954 2600442415 140
64 iso_pu_bacteria 2600255389 2602009624 140
65 iso_pu_bacteria 2823421272 2823424513 140
66 iso_pu_bacteria 2919501602 2919504251 140
67 iso_pu_bacteria 2926063275 2926065176 140
68 iso_pu_bacteria 3007866637 3007869424 140
69 iso_pu_bacteria 8034962539 8034967119 140
70 3300005262 Ga0065165_1049080 Ga0065165_10490802 141
71 3300005334 Ga0068869_100435246 Ga0068869_1004352462 141
72 3300005530 Ga0070679_101663250 Ga0070679_1016632501 141
73 3300005546 Ga0070696_101907787 Ga0070696_1019077871 141
74 3300005549 Ga0070704_101382715 Ga0070704_1013827151 141
75 3300005617 Ga0068859_101031884 Ga0068859_1010318842 141
76 3300005843 Ga0068860_100286385 Ga0068860_1002863852 141
77 3300005844 Ga0068862_100159369 Ga0068862_1001593691 141
78 3300005844 Ga0068862_101004319 Ga0068862_1010043192 141
79 3300006914 Ga0075436_101060834 Ga0075436_1010608341 141
80 3300006931 Ga0097620_101031839 Ga0097620_1010318392 141
81 3300009176 Ga0105242_11088325 Ga0105242_110883251 141
82 3300009176 Ga0105242_12009803 Ga0105242_120098031 141
83 3300009177 Ga0105248_10256643 Ga0105248_102566432 141
84 3300009553 Ga0105249_10208917 Ga0105249_102089172 141
85 3300009553 Ga0105249_10363447 Ga0105249_103634472 141
86 3300014969 Ga0157376_12039497 Ga0157376_120394972 141
87 3300017792 Ga0163161_10597629 Ga0163161_105976291 141
88 3300025934 Ga0207686_10193908 Ga0207686_101939082 141
89 3300025942 Ga0207689_10473853 Ga0207689_104738532 141
90 3300025961 Ga0207712_10351589 Ga0207712_103515891 141
91 3300025961 Ga0207712_10596996 Ga0207712_105969961 141
92 3300028380 Ga0268265_10007318 Ga0268265_100073182 141
93 3300028380 Ga0268265_10171211 Ga0268265_101712112 141
94 3300028380 Ga0268265_10999049 Ga0268265_109990491 141
95 3300031852 Ga0307410_10251800 Ga0307410_102518001 141
96 3300031903 Ga0307407_10184473 Ga0307407_101844733 141
97 3300031911 Ga0307412_10512845 Ga0307412_105128453 141
98 3300031911 Ga0307412_11344208 Ga0307412_113442082 141
99 3300031995 Ga0307409_100288202 Ga0307409_1002882021 141
100 3300032005 Ga0307411_10217370 Ga0307411_102173702 141
101 3300034817 Ga0373948_0211909 Ga0373948_0211909_20_454 141
102 3300035114 Ga0373939_0373750 Ga0373939_0373750_77_511 141
103 3300037853 Ga0436364_0496516 Ga0436364_0496516_2055_2486 141
104 3300046475 Ga0495639_0519062 Ga0495639_0519062_166_591 141
105 3300048909 Ga0496106_0177183 Ga0496106_0177183_979_1413 141
106 3300048912 Ga0496109_1473543 Ga0496109_1473543_177_602 141
107 3300049574 Ga0501038_0991790 Ga0501038_0991790_163_597 141
108 3300049581 Ga0501047_0045958 Ga0501047_0045958_849_1283 141
109 3300049581 Ga0501047_0270128 Ga0501047_0270128_1017_1451 141
110 3300049583 Ga0501067_0588077 Ga0501067_0588077_62_487 141
111 3300049586 Ga0501070_0589539 Ga0501070_0589539_124_633 141
112 3300049586 Ga0501070_0786355 Ga0501070_0786355_294_719 141
113 3300049587 Ga0501071_0746353 Ga0501071_0746353_132_641 141
114 3300049675 Ga0501243_124957 Ga0501243_124957_41_466 141
115 3300049741 Ga0501079_0480236 Ga0501079_0480236_450_875 141
116 3300049742 Ga0501080_0002083 Ga0501080_0002083_1194_1628 141
117 3300049744 Ga0501083_0006139 Ga0501083_0006139_4855_5289 141
118 3300049823 Ga0501044_0136529 Ga0501044_0136529_192_626 141
119 3300049823 Ga0501044_1244111 Ga0501044_1244111_29_463 141
120 3300053087 Ga0500643_012827 Ga0500643_012827_2520_2954 141
121 3300053087 Ga0500643_038590 Ga0500643_038590_608_1042 141
122 3300060353 Ga0501082_0350791 Ga0501082_0350791_388_822 141
123 3300005327 Ga0070658_10090733 Ga0070658_100907332 142
124 3300005327 Ga0070658_10976079 Ga0070658_109760791 142
125 3300009174 Ga0105241_10061198 Ga0105241_100611985 142
126 3300009551 Ga0105238_10168801 Ga0105238_101688013 142
127 3300021361 Ga0213872_10047453 Ga0213872_100474532 142
128 3300025321 Ga0207656_10316983 Ga0207656_103169832 142
129 3300025911 Ga0207654_10136903 Ga0207654_101369032 142
130 3300025925 Ga0207650_10060051 Ga0207650_100600512 142
131 3300026088 Ga0207641_10518576 Ga0207641_105185762 142
132 3300037312 Ga0395899_0000013 Ga0395899_0000013_237051_237485 142
133 3300037853 Ga0436364_1025470 Ga0436364_1025470_108_545 142
134 3300038443 Ga0395901_0616000 Ga0395901_0616000_263_697 142
135 3300039447 Ga0436361_0247502 Ga0436361_0247502_234_668 142
136 3300039447 Ga0436361_0417388 Ga0436361_0417388_117_551 142
137 3300039447 Ga0436361_0960944 Ga0436361_0960944_1263_1697 142
138 3300039447 Ga0436361_0995372 Ga0436361_0995372_762_1196 142
139 3300044684 Ga0466966_0149490 Ga0466966_0149490_869_1303 142
140 3300044693 Ga0466961_0077279 Ga0466961_0077279_1413_1847 142
141 3300044719 Ga0466971_0289502 Ga0466971_0289502_283_717 142
142 3300048927 Ga0496124_0433163 Ga0496124_0433163_127_561 142
143 3300049513 Ga0501290_097780 Ga0501290_097780_67_501 142
144 3300049522 Ga0501299_016090 Ga0501299_016090_554_988 142
145 3300049569 Ga0501032_0075321 Ga0501032_0075321_1459_1887 142
146 3300049570 Ga0501033_0025887 Ga0501033_0025887_2658_3086 142
147 3300049571 Ga0501034_0101694 Ga0501034_0101694_1332_1760 142
148 3300049572 Ga0501036_0002829 Ga0501036_0002829_2168_2596 142
149 3300049573 Ga0501037_0032091 Ga0501037_0032091_2077_2505 142
150 3300049574 Ga0501038_0028917 Ga0501038_0028917_2726_3154 142
151 3300049575 Ga0501039_0048297 Ga0501039_0048297_1158_1586 142
152 3300049579 Ga0501043_0059802 Ga0501043_0059802_899_1327 142
153 3300049582 Ga0501048_0009262 Ga0501048_0009262_5431_5859 142
154 3300049582 Ga0501048_0593367 Ga0501048_0593367_345_782 142
155 3300049583 Ga0501067_0009519 Ga0501067_0009519_3967_4395 142
156 3300049584 Ga0501068_0067881 Ga0501068_0067881_1539_1967 142
157 3300049585 Ga0501069_0001900 Ga0501069_0001900_5601_6029 142
158 3300049586 Ga0501070_0016439 Ga0501070_0016439_2727_3155 142
159 3300049587 Ga0501071_0020855 Ga0501071_0020855_2629_3057 142
160 3300049590 Ga0501074_0023154 Ga0501074_0023154_2495_2923 142
161 3300049663 Ga0501223_005410 Ga0501223_005410_1483_1917 142
162 3300049686 Ga0501257_000362 Ga0501257_000362_2575_3009 142
163 3300049741 Ga0501079_0093531 Ga0501079_0093531_1824_2252 142
164 3300049742 Ga0501080_0078531 Ga0501080_0078531_644_1072 142
165 3300049744 Ga0501083_0001750 Ga0501083_0001750_3289_3717 142
166 3300049776 Ga0501280_001435 Ga0501280_001435_3823_4257 142
167 3300049822 Ga0501035_0046577 Ga0501035_0046577_1236_1664 142
168 3300049823 Ga0501044_0498268 Ga0501044_0498268_666_1103 142
169 3300053156 Ga0500622_0018626 Ga0500622_0018626_1621_2058 142
170 3300053730 Ga0500645_011932 Ga0500645_011932_298_735 142
171 3300054114 Ga0501084_0106352 Ga0501084_0106352_361_789 142
172 3300060353 Ga0501082_0052191 Ga0501082_0052191_1350_1778 142
173 3300005355 Ga0070671_101042557 Ga0070671_1010425571 143
174 3300025931 Ga0207644_10859159 Ga0207644_108591592 143
175 3300031548 Ga0307408_100000027 Ga0307408_10000002725 143
176 3300042439 Ga0439464_0000151 Ga0439464_0000151_4408_4845 143
177 3300048925 Ga0496122_0389260 Ga0496122_0389260_237_674 143
178 3300048928 Ga0496125_0053514 Ga0496125_0053514_641_1078 143
179 3300048929 Ga0496126_0012397 Ga0496126_0012397_3446_3883 143
180 3300049515 Ga0501292_000044 Ga0501292_000044_15364_15801 143
181 3300049517 Ga0501294_000023 Ga0501294_000023_8237_8674 143
182 3300049520 Ga0501297_036423 Ga0501297_036423_89_526 143
183 3300049523 Ga0501300_001297 Ga0501300_001297_3204_3641 143
184 3300049524 Ga0501301_004058 Ga0501301_004058_151_588 143
185 3300049652 Ga0501202_039757 Ga0501202_039757_332_769 143
186 3300049663 Ga0501223_000435 Ga0501223_000435_8191_8628 143
187 3300049664 Ga0501224_000414 Ga0501224_000414_1786_2223 143
188 3300049665 Ga0501227_002992 Ga0501227_002992_2782_3219 143
189 3300049668 Ga0501233_010299 Ga0501233_010299_1076_1513 143
190 3300049670 Ga0501236_003879 Ga0501236_003879_24_539 143
191 3300049688 Ga0501259_000029 Ga0501259_000029_10774_11211 143
192 3300049690 Ga0501261_000026 Ga0501261_000026_13062_13499 143
193 3300049704 Ga0501221_017970 Ga0501221_017970_547_984 143
194 3300049708 Ga0501245_054016 Ga0501245_054016_143_580 143
195 3300049775 Ga0501279_000001 Ga0501279_000001_283679_284116 143
196 3300049776 Ga0501280_000077 Ga0501280_000077_12649_13086 143
197 3300049777 Ga0501281_00027 Ga0501281_00027_8206_8721 143
198 3300049778 Ga0501282_000422 Ga0501282_000422_2670_3107 143
199 3300050005 Ga0501284_03707 Ga0501284_03707_43_480 143
200 3300003320 rootH2_10075715 rootH2_100757153 144
201 3300033180 Ga0307510_10134717 Ga0307510_101347171 144
202 3300039437 Ga0436365_0083694 Ga0436365_0083694_1658_2104 144
203 3300044735 Ga0466968_0090016 Ga0466968_0090016_688_1125 144
204 3300049530 Ga0501314_000379 Ga0501314_000379_576_1034 144
205 3300049533 Ga0501317_003054 Ga0501317_003054_579_1037 144
206 3300049649 Ga0501198_002836 Ga0501198_002836_355_813 144
207 3300049663 Ga0501223_008192 Ga0501223_008192_1554_2012 144
208 3300049664 Ga0501224_000010 Ga0501224_000010_33717_34175 144
209 3300049669 Ga0501235_005886 Ga0501235_005886_1848_2306 144
210 3300049704 Ga0501221_089459 Ga0501221_089459_42_500 144
211 3300049705 Ga0501225_0009357 Ga0501225_0009357_14_472 144
212 3300049707 Ga0501234_003650 Ga0501234_003650_1340_1798 144
213 3300049708 Ga0501245_003072 Ga0501245_003072_581_1039 144
214 3300049853 Ga0501226_000036 Ga0501226_000036_47586_48044 144

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

44

142

0.97

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

36

144

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lb5-assembly1.cif.gz_A crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9901 5 140
3lb5-assembly1.cif.gz_B crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9891 4 140
3lb5-assembly2.cif.gz_C crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9826 4 140
3lb5-assembly1.cif.gz_A crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9752 5 140
3lb5-assembly1.cif.gz_B crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9745 4 140
ID Description Score Start End Superfamily
3lb5A00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9901 5 140 3.30.428.10
3lb5A00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9752 5 140 3.30.428.10
af_Q0IQH7_1_86_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.964 44 114 3.30.428.10
af_A0A140LH01_2_105_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9577 24 111 3.30.428.10
1y23D01 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9551 9 114 3.30.428.10
ID Description Score Start End GO Terms
AF-A6X0I6-F1-model_v4 HIT family protein (Histidine triad (HIT) protein) 1.001 2 140 GO:0003824
GO:0009117
AF-A6U8J1-F1-model_v4 Histidine triad (HIT) protein 0.9996 3 140 GO:0003824
GO:0009117
AF-A0A2S8U5G2-F1-model_v4 deleted 0.9992 2 140
AF-A0A7U8PL22-F1-model_v4 deleted 0.9992 2 140
AF-A0A4P6V022-F1-model_v4 HIT family protein 0.9991 3 144 GO:0003824
GO:0009117

Feature Viewer

pLDDT pTM Quality
95.23 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map