F325662

General Info

Members Datasets Scaffolds Average Seq Length
214 141 183 145

Family's Representative Sequence

Representative Sequence 3300048921|Ga0496118_0125244|Ga0496118_0125244_789_1274
Length 161
Sequence MSGLESLYQELILDHARQRHGFGLRDAPAAESHQLNPTCGDEVTLQLHPGPDGRLAPIAWEGHGCSISQASSSCLSDLAAGLTPAELQALVDEFRTVIRSRGTLEFDEERFGDAAAFSGVSRYIARVKCAMLPWVAAEEAISRLPCAGAPPPPGRRLVRRG

Samples

Sample ID Description Type Environment
1 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
2 2643221566 Microbacterium sp. Root166 Isolate Unclassified
3 2643221572 Leifsonia sp. Root60 Isolate Unclassified
4 2643221597 Microbacterium sp. Root180 Isolate Unclassified
5 2643221616 Leifsonia sp. Root227 Isolate Unclassified
6 2643221630 Microbacterium sp. Root322 Isolate Unclassified
7 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
8 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
9 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
10 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
11 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
12 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
13 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
14 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
15 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
16 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
17 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
18 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
19 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
20 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
21 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
22 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
23 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
24 2928153084 Leifsonia sp. 563 Isolate Unclassified
25 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
26 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
27 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
28 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
29 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
30 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
31 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
32 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
33 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
34 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
35 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
36 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
37 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
38 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
39 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
40 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
41 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
54 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
63 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
64 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
66 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
69 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
75 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
76 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
77 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
78 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
86 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
87 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
88 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
89 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
90 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
91 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
92 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
93 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
96 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
97 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
98 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
99 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
102 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
103 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
104 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
105 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
106 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
107 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
108 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
109 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
110 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
111 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
112 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
113 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
114 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
115 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
116 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
117 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
118 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
119 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
120 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
124 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
125 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
126 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
127 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
128 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
129 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
130 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
131 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
132 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
133 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
134 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
135 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
136 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
137 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
138 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
139 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
140 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
141 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.24
Metatranscriptomes 3.27
Isolates 14.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.03
Nodule 0
Rhizoplane 7.48
Rhizosphere 45.79
Stem 0
Stem Tuber 0.47
Unclassified 25.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10001271 3300002067 Bacteria 8959
2 JGI25164J39214_1000531 3300002772 Bacteria 18002
3 JGI25165J46597_1000002 3300003214 Bacteria 765387
4 rootH1_10192033 3300003323 Bacteria 1388
5 Ga0006562J51391_1117499 3300003578 Bacteria 10400
6 Ga0006562J51391_1117500 3300003578 Bacteria 16320
7 Ga0055539_1000111 3300003752 Bacteria 90530
8 Ga0055533_1000001 3300003756 Bacteria 1863437
9 Ga0055525_1000200 3300003759 Bacteria 70185
10 Ga0055527_1000012 3300003760 Bacteria 348744
11 Ga0055542_1000017 3300003762 Bacteria 348744
12 Ga0055529_1000023 3300003763 Bacteria 314383
13 Ga0055541_1002305 3300003841 Bacteria 3844
14 Ga0070658_10720885 3300005327 Bacteria 866
15 Ga0070710_10039263 3300005437 Bacteria 2604
16 Ga0070684_100863762 3300005535 Bacteria 847
17 Ga0075369_10121671 3300006186 Bacteria 1182
18 Ga0075428_100000111 3300006844 Bacteria 69395
19 Ga0111539_10068665 3300009094 Bacteria 4185
20 Ga0105238_10922292 3300009551 Bacteria 892
21 Ga0157370_10108397 3300013104 Bacteria 2597
22 Ga0157370_10257568 3300013104 Bacteria 1613
23 Ga0157370_10288738 3300013104 Bacteria 1515
24 Ga0157370_10925550 3300013104 Bacteria 791
25 Ga0157369_10065677 3300013105 Bacteria 3905
26 Ga0157369_10176901 3300013105 Bacteria 2246
27 Ga0157369_10264238 3300013105 Bacteria 1794
28 Ga0157369_10778005 3300013105 Bacteria 984
29 Ga0157372_11001037 3300013307 Bacteria 968
30 Ga0163161_10358385 3300017792 Bacteria 1161
31 Ga0206349_1081556 3300020075 Bacteria 618
32 Ga0206355_1483218 3300020076 Bacteria 625
33 Ga0206354_11333688 3300020081 Bacteria 5259
34 Ga0206353_11421354 3300020082 Bacteria 14100
35 Ga0224712_10219246 3300022467 Bacteria 870
36 Ga0209566_100026 3300025225 Bacteria 367457
37 Ga0209674_100001 3300025226 Bacteria 4013750
38 Ga0209672_100003 3300025228 Bacteria 1560476
39 Ga0209147_100405 3300025229 Bacteria 29168
40 Ga0209563_100001 3300025230 Bacteria 4013775
41 Ga0209563_100463 3300025230 Bacteria 13996
42 Ga0207427_100034 3300025231 Bacteria 320342
43 Ga0209437_100591 3300025233 Bacteria 23035
44 Ga0209258_128750 3300025242 Bacteria 528
45 Ga0209646_1000041 3300025246 Bacteria 346024
46 Ga0209677_100001 3300025253 Bacteria 4013787
47 Ga0209677_100321 3300025253 Bacteria 30989
48 Ga0209148_1000004 3300025254 Bacteria 1844481
49 Ga0209233_1000001 3300025261 Bacteria 2992747
50 Ga0209233_1063653 3300025261 Bacteria 703
51 Ga0209455_1000022 3300025272 Bacteria 688910
52 Ga0209455_1002872 3300025272 Bacteria 6377
53 Ga0207692_10030039 3300025898 Bacteria 2588
54 Ga0207647_10029180 3300025904 Bacteria 3573
55 Ga0207705_10628581 3300025909 Bacteria 835
56 Ga0207639_12115226 3300026041 Bacteria 524
57 Ga0307405_10052202 3300031731 Bacteria 2541
58 Ga0307405_11524687 3300031731 Bacteria 588
59 Ga0307413_10499827 3300031824 Bacteria 976
60 Ga0307406_10015909 3300031901 Bacteria 4362
61 Ga0307406_10096939 3300031901 Bacteria 1999
62 Ga0307406_10418094 3300031901 Bacteria 1067
63 Ga0307412_10555854 3300031911 Bacteria 965
64 Ga0307412_10976806 3300031911 Bacteria 747
65 Ga0307412_12006556 3300031911 Bacteria 536
66 Ga0307409_101586028 3300031995 Bacteria 683
67 Ga0307414_10078421 3300032004 Bacteria 2408
68 Ga0307414_10102160 3300032004 Bacteria 2160
69 Ga0307414_10506439 3300032004 Bacteria 1069
70 Ga0307414_10843972 3300032004 Bacteria 837
71 Ga0307415_101435986 3300032126 Bacteria 658
72 Ga0395899_0035810 3300037312 Bacteria 3725
73 Ga0395900_0002216 3300037418 Bacteria 21707
74 Ga0395900_0271121 3300037418 Bacteria 1692
75 Ga0395900_0514599 3300037418 Bacteria 1145
76 Ga0395898_0001754 3300037466 Bacteria 28472
77 Ga0395901_0064552 3300038443 Bacteria 3812
78 Ga0451789_0215221 3300041443 Bacteria 789
79 Ga0451791_1932075 3300041451 Bacteria 582
80 Ga0451793_0656360 3300041452 Bacteria 1088
81 Ga0451797_0154552 3300041453 Bacteria 780
82 Ga0451797_0323798 3300041453 Bacteria 994
83 Ga0451797_1334581 3300041453 Bacteria 558
84 Ga0451797_1427460 3300041453 Bacteria 665
85 Ga0451800_1481175 3300041459 Bacteria 574
86 Ga0451806_741756 3300041462 Bacteria 561
87 Ga0451806_765434 3300041462 Bacteria 904
88 Ga0451853_2824283 3300041512 Bacteria 1208
89 Ga0466972_0023417 3300044658 Bacteria 3071
90 Ga0466972_0034440 3300044658 Bacteria 2481
91 Ga0466972_0053006 3300044658 Bacteria 1954
92 Ga0466965_0134789 3300044683 Bacteria 1282
93 Ga0466965_0150875 3300044683 Bacteria 1214
94 Ga0466965_0224412 3300044683 Bacteria 1002
95 Ga0466966_0043920 3300044684 Bacteria 2863
96 Ga0466966_0366461 3300044684 Bacteria 865
97 Ga0466961_0043996 3300044693 Bacteria 2858
98 Ga0466961_0172172 3300044693 Bacteria 1346
99 Ga0466968_0079184 3300044735 Bacteria 1441
100 Ga0466970_0178164 3300044765 Bacteria 1179
101 Ga0466970_0224232 3300044765 Bacteria 1049
102 Ga0466957_0072548 3300044842 Bacteria 2132
103 Ga0466960_0263194 3300044901 Bacteria 961
104 Ga0466960_0558788 3300044901 Bacteria 676
105 Ga0466960_0911736 3300044901 Bacteria 536
106 Ga0466959_0045457 3300045049 Bacteria 3233
107 Ga0466959_0187908 3300045049 Bacteria 1443
108 Ga0466959_0529412 3300045049 Bacteria 795
109 Ga0451576_0337896 3300045051 Bacteria 1576
110 Ga0466958_0032719 3300045836 Bacteria 3095
111 Ga0466958_0055416 3300045836 Bacteria 2406
112 Ga0495670_0033782 3300046691 Bacteria 2546
113 Ga0495672_0156556 3300047320 Bacteria 1176
114 Ga0495672_0217440 3300047320 Bacteria 945
115 Ga0495686_0100890 3300047472 Bacteria 1741
116 Ga0495686_0185667 3300047472 Bacteria 1202
117 Ga0496100_0148408 3300048903 Bacteria 1669
118 Ga0496103_0194460 3300048906 Bacteria 1304
119 Ga0496104_0033673 3300048907 Bacteria 4775
120 Ga0496105_0024675 3300048908 Bacteria 4886
121 Ga0496107_0073266 3300048910 Bacteria 2491
122 Ga0496114_0014188 3300048917 Bacteria 6392
123 Ga0496116_0083812 3300048919 Bacteria 1966
124 Ga0496117_0000120 3300048920 Bacteria 171697
125 Ga0496117_0005824 3300048920 Bacteria 12765
126 Ga0496117_0006688 3300048920 Bacteria 11531
127 Ga0496117_0010357 3300048920 Bacteria 8516
128 Ga0496117_0067359 3300048920 Bacteria 2423
129 Ga0496117_0067368 3300048920 Bacteria 2423
130 Ga0496117_0140091 3300048920 Bacteria 1450
131 Ga0496118_0125244 3300048921 Bacteria 1665
132 Ga0496118_0143248 3300048921 Bacteria 1510
133 Ga0496118_0599730 3300048921 Bacteria 527
134 Ga0496119_0213364 3300048922 Bacteria 992
135 Ga0496120_0131216 3300048923 Bacteria 1283
136 Ga0496122_0005842 3300048925 Bacteria 14450
137 Ga0496122_0026357 3300048925 Bacteria 5014
138 Ga0496122_0027864 3300048925 Bacteria 4816
139 Ga0496122_0082856 3300048925 Bacteria 2226
140 Ga0496122_0347581 3300048925 Bacteria 776
141 Ga0496123_0042509 3300048926 Bacteria 3135
142 Ga0496123_0186131 3300048926 Bacteria 1079
143 Ga0496123_0480043 3300048926 Bacteria 547
144 Ga0496125_0004502 3300048928 Bacteria 16030
145 Ga0496125_0018004 3300048928 Bacteria 6715
146 Ga0496125_0020486 3300048928 Bacteria 6206
147 Ga0496125_0134885 3300048928 Bacteria 1729
148 Ga0496125_0366370 3300048928 Bacteria 855
149 Ga0496125_0461367 3300048928 Bacteria 725
150 Ga0496126_0002004 3300048929 Bacteria 28815
151 Ga0496126_0002538 3300048929 Bacteria 24425
152 Ga0496126_0099013 3300048929 Bacteria 2554
153 Ga0496126_0101707 3300048929 Bacteria 2513
154 Ga0496126_0320213 3300048929 Bacteria 1275
155 Ga0496126_0912291 3300048929 Bacteria 665
156 Ga0501034_0000467 3300049571 Bacteria 66746
157 Ga0501034_0782506 3300049571 Bacteria 848
158 Ga0501038_0077845 3300049574 Bacteria 2799
159 Ga0501038_0627859 3300049574 Bacteria 811
160 Ga0501070_0000133 3300049586 Bacteria 67036
161 Ga0501035_0020729 3300049822 Bacteria 6041
162 nmdc:mga00v17_1466_c3 3300050491 Bacteria 5032
163 nmdc:mga00v17_552637_c1 3300050491 Bacteria 744
164 nmdc:mga08y16_152798_c1 3300050511 Bacteria 2399
165 nmdc:mga08y16_74536_c1 3300050511 Bacteria 3536
166 nmdc:mga0rr50_1341803_c1 3300050513 Bacteria 606
167 Ga0500635_0000023 3300053080 Bacteria 108024
168 Ga0500643_000354 3300053087 Bacteria 36422
169 Ga0500556_0000100 3300053104 Bacteria 78417
170 Ga0500655_050047 3300053133 Bacteria 832
171 Ga0500559_0000084 3300053136 Bacteria 74001
172 Ga0500559_0015753 3300053136 Bacteria 3193
173 Ga0500568_0000100 3300053139 Bacteria 78717
174 Ga0500573_0000229 3300053140 Bacteria 23111
175 Ga0500573_0027262 3300053140 Bacteria 3285
176 Ga0500573_0114473 3300053140 Bacteria 1506
177 Ga0500573_0183343 3300053140 Bacteria 1124
178 Ga0500573_0191682 3300053140 Bacteria 1091
179 Ga0500577_0026519 3300053142 Bacteria 1975
180 Ga0500616_0000183 3300053153 Bacteria 103074
181 Ga0500616_0003826 3300053153 Bacteria 11142
182 Ga0500620_270393 3300053155 Bacteria 560
183 Ga0500645_018191 3300053730 Bacteria 2196

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053080 Ga0500635_0000023 Ga0500635_0000023_48603_49043 132
2 3300032004 Ga0307414_10843972 Ga0307414_108439722 135
3 iso_pu_bacteria 2857733635 2857734213 137
4 iso_pu_bacteria 2808606306 2808629522 139
5 3300041443 Ga0451789_0215221 Ga0451789_0215221_209_640 140
6 3300041451 Ga0451791_1932075 Ga0451791_1932075_77_508 140
7 iso_pu_bacteria 2643221542 2643734603 140
8 iso_pu_bacteria 2643221566 2643847433 140
9 iso_pu_bacteria 2643221597 2643997427 140
10 iso_pu_bacteria 2643221630 2644172728 140
11 iso_pu_bacteria 2643221724 2644678998 140
12 iso_pu_bacteria 2728369380 2730228510 140
13 iso_pu_bacteria 2747842429 2747953412 140
14 iso_pu_bacteria 2852663356 2852666185 140
15 iso_pu_bacteria 2946080515 2946082084 140
16 iso_pu_bacteria 8004182704 8004183311 140
17 3300053155 Ga0500620_270393 Ga0500620_270393_83_508 141
18 iso_pu_bacteria 2643221572 2643876067 141
19 iso_pu_bacteria 2643221669 2644383122 141
20 iso_pu_bacteria 2844841374 2844842051 141
21 iso_pu_bacteria 2857729791 2857733566 141
22 iso_pu_bacteria 2895660088 2895660267 141
23 iso_pu_bacteria 2919055335 2919057689 141
24 iso_pu_bacteria 2919523602 2919524094 141
25 iso_pu_bacteria 2928121344 2928124632 141
26 iso_pu_bacteria 2928153084 2928155741 141
27 iso_pu_bacteria 2939660829 2939661802 141
28 iso_pu_bacteria 2946041624 2946042840 141
29 iso_pu_bacteria 8057345674 8057348359 141
30 3300005437 Ga0070710_10039263 Ga0070710_100392632 142
31 3300013104 Ga0157370_10257568 Ga0157370_102575682 142
32 3300017792 Ga0163161_10358385 Ga0163161_103583851 142
33 3300025898 Ga0207692_10030039 Ga0207692_100300392 142
34 3300041452 Ga0451793_0656360 Ga0451793_0656360_394_825 142
35 3300041453 Ga0451797_0154552 Ga0451797_0154552_162_596 142
36 3300041453 Ga0451797_0323798 Ga0451797_0323798_12_443 142
37 3300041462 Ga0451806_741756 Ga0451806_741756_58_492 142
38 3300047320 Ga0495672_0156556 Ga0495672_0156556_670_1101 142
39 3300047320 Ga0495672_0217440 Ga0495672_0217440_238_672 142
40 3300047472 Ga0495686_0100890 Ga0495686_0100890_31_465 142
41 3300048920 Ga0496117_0010357 Ga0496117_0010357_563_997 142
42 3300048926 Ga0496123_0042509 Ga0496123_0042509_684_1118 142
43 3300048928 Ga0496125_0134885 Ga0496125_0134885_1240_1674 142
44 3300048929 Ga0496126_0320213 Ga0496126_0320213_655_1086 142
45 3300053087 Ga0500643_000354 Ga0500643_000354_18490_18921 142
46 3300053104 Ga0500556_0000100 Ga0500556_0000100_68339_68773 142
47 3300053133 Ga0500655_050047 Ga0500655_050047_307_741 142
48 3300053136 Ga0500559_0000084 Ga0500559_0000084_13236_13664 142
49 3300053139 Ga0500568_0000100 Ga0500568_0000100_9677_10111 142
50 3300053142 Ga0500577_0026519 Ga0500577_0026519_1082_1519 142
51 iso_pu_bacteria 2844852863 2844855873 142
52 iso_pu_bacteria 8056037122 8056039750 142
53 3300041462 Ga0451806_765434 Ga0451806_765434_264_707 143
54 3300048928 Ga0496125_0366370 Ga0496125_0366370_182_637 143
55 3300053153 Ga0500616_0003826 Ga0500616_0003826_6194_6631 143
56 iso_pu_bacteria 2643221616 2644095668 143
57 iso_pu_bacteria 2852646457 2852648526 143
58 iso_pu_bacteria 2857723135 2857724402 143
59 iso_pu_bacteria 2884763398 2884765038 143
60 iso_pu_bacteria 2945968032 2945970538 143
61 3300006844 Ga0075428_100000111 Ga0075428_10000011133 144
62 3300009094 Ga0111539_10068665 Ga0111539_100686654 144
63 3300013104 Ga0157370_10108397 Ga0157370_101083973 144
64 3300025246 Ga0209646_1000041 Ga0209646_1000041146 144
65 3300031731 Ga0307405_11524687 Ga0307405_115246872 144
66 3300031824 Ga0307413_10499827 Ga0307413_104998272 144
67 3300031901 Ga0307406_10015909 Ga0307406_100159092 144
68 3300031901 Ga0307406_10418094 Ga0307406_104180942 144
69 3300031911 Ga0307412_10555854 Ga0307412_105558542 144
70 3300031995 Ga0307409_101586028 Ga0307409_1015860282 144
71 3300032004 Ga0307414_10102160 Ga0307414_101021603 144
72 3300032126 Ga0307415_101435986 Ga0307415_1014359861 144
73 3300041453 Ga0451797_1427460 Ga0451797_1427460_58_501 144
74 3300041512 Ga0451853_2824283 Ga0451853_2824283_673_1125 144
75 3300044658 Ga0466972_0053006 Ga0466972_0053006_900_1334 144
76 3300044683 Ga0466965_0150875 Ga0466965_0150875_670_1104 144
77 3300044765 Ga0466970_0178164 Ga0466970_0178164_183_617 144
78 3300044901 Ga0466960_0911736 Ga0466960_0911736_71_505 144
79 3300045051 Ga0451576_0337896 Ga0451576_0337896_815_1267 144
80 3300045836 Ga0466958_0055416 Ga0466958_0055416_736_1170 144
81 3300048920 Ga0496117_0000120 Ga0496117_0000120_83654_84094 144
82 3300048925 Ga0496122_0005842 Ga0496122_0005842_2397_2837 144
83 3300048925 Ga0496122_0026357 Ga0496122_0026357_75_509 144
84 3300048926 Ga0496123_0186131 Ga0496123_0186131_115_555 144
85 3300048928 Ga0496125_0461367 Ga0496125_0461367_78_512 144
86 3300049571 Ga0501034_0000467 Ga0501034_0000467_63743_64177 144
87 3300049571 Ga0501034_0782506 Ga0501034_0782506_26_466 144
88 3300049574 Ga0501038_0077845 Ga0501038_0077845_1308_1748 144
89 3300049574 Ga0501038_0627859 Ga0501038_0627859_188_631 144
90 3300050491 nmdc:mga00v17_1466_c3 nmdc:mga00v17_1466_c3_158_592 144
91 3300050511 nmdc:mga08y16_152798_c1 nmdc:mga08y16_152798_c1_35_487 144
92 3300050511 nmdc:mga08y16_74536_c1 nmdc:mga08y16_74536_c1_2913_3419 144
93 3300050513 nmdc:mga0rr50_1341803_c1 nmdc:mga0rr50_1341803_c1_35_487 144
94 3300053730 Ga0500645_018191 Ga0500645_018191_1370_1810 144
95 3300002067 JGI24735J21928_10001271 JGI24735J21928_100012714 145
96 3300002772 JGI25164J39214_1000531 JGI25164J39214_100053114 145
97 3300003214 JGI25165J46597_1000002 JGI25165J46597_1000002324 145
98 3300003323 rootH1_10192033 rootH1_101920332 145
99 3300003578 Ga0006562J51391_1117499 Ga0006562J51391_11174997 145
100 3300003578 Ga0006562J51391_1117500 Ga0006562J51391_11175004 145
101 3300003752 Ga0055539_1000111 Ga0055539_100011146 145
102 3300003756 Ga0055533_1000001 Ga0055533_1000001385 145
103 3300003759 Ga0055525_1000200 Ga0055525_100020041 145
104 3300003760 Ga0055527_1000012 Ga0055527_1000012205 145
105 3300003762 Ga0055542_1000017 Ga0055542_1000017205 145
106 3300003763 Ga0055529_1000023 Ga0055529_1000023172 145
107 3300003841 Ga0055541_1002305 Ga0055541_10023052 145
108 3300005327 Ga0070658_10720885 Ga0070658_107208852 145
109 3300005535 Ga0070684_100863762 Ga0070684_1008637622 145
110 3300006186 Ga0075369_10121671 Ga0075369_101216712 145
111 3300009551 Ga0105238_10922292 Ga0105238_109222922 145
112 3300013104 Ga0157370_10288738 Ga0157370_102887382 145
113 3300013104 Ga0157370_10925550 Ga0157370_109255502 145
114 3300013105 Ga0157369_10065677 Ga0157369_100656772 145
115 3300013105 Ga0157369_10176901 Ga0157369_101769012 145
116 3300013105 Ga0157369_10264238 Ga0157369_102642384 145
117 3300013105 Ga0157369_10778005 Ga0157369_107780052 145
118 3300013307 Ga0157372_11001037 Ga0157372_110010372 145
119 3300020075 Ga0206349_1081556 Ga0206349_10815562 145
120 3300020076 Ga0206355_1483218 Ga0206355_14832182 145
121 3300020081 Ga0206354_11333688 Ga0206354_113336884 145
122 3300020082 Ga0206353_11421354 Ga0206353_1142135412 145
123 3300022467 Ga0224712_10219246 Ga0224712_102192461 145
124 3300025225 Ga0209566_100026 Ga0209566_100026338 145
125 3300025226 Ga0209674_100001 Ga0209674_100001386 145
126 3300025228 Ga0209672_100003 Ga0209672_100003141 145
127 3300025229 Ga0209147_100405 Ga0209147_10040527 145
128 3300025230 Ga0209563_100001 Ga0209563_100001386 145
129 3300025230 Ga0209563_100463 Ga0209563_10046313 145
130 3300025231 Ga0207427_100034 Ga0207427_100034252 145
131 3300025233 Ga0209437_100591 Ga0209437_10059114 145
132 3300025242 Ga0209258_128750 Ga0209258_1287501 145
133 3300025253 Ga0209677_100001 Ga0209677_100001386 145
134 3300025253 Ga0209677_100321 Ga0209677_10032130 145
135 3300025254 Ga0209148_1000004 Ga0209148_1000004436 145
136 3300025261 Ga0209233_1000001 Ga0209233_10000012481 145
137 3300025261 Ga0209233_1063653 Ga0209233_10636531 145
138 3300025272 Ga0209455_1000022 Ga0209455_1000022548 145
139 3300025272 Ga0209455_1002872 Ga0209455_10028724 145
140 3300025904 Ga0207647_10029180 Ga0207647_100291802 145
141 3300025909 Ga0207705_10628581 Ga0207705_106285812 145
142 3300026041 Ga0207639_12115226 Ga0207639_121152261 145
143 3300031731 Ga0307405_10052202 Ga0307405_100522024 145
144 3300031901 Ga0307406_10096939 Ga0307406_100969392 145
145 3300031911 Ga0307412_10976806 Ga0307412_109768062 145
146 3300031911 Ga0307412_12006556 Ga0307412_120065561 145
147 3300032004 Ga0307414_10078421 Ga0307414_100784212 145
148 3300032004 Ga0307414_10506439 Ga0307414_105064392 145
149 3300037312 Ga0395899_0035810 Ga0395899_0035810_1282_1719 145
150 3300037418 Ga0395900_0002216 Ga0395900_0002216_10950_11387 145
151 3300037418 Ga0395900_0271121 Ga0395900_0271121_368_805 145
152 3300037418 Ga0395900_0514599 Ga0395900_0514599_507_944 145
153 3300037466 Ga0395898_0001754 Ga0395898_0001754_17058_17495 145
154 3300038443 Ga0395901_0064552 Ga0395901_0064552_2396_2833 145
155 3300041453 Ga0451797_1334581 Ga0451797_1334581_55_498 145
156 3300041459 Ga0451800_1481175 Ga0451800_1481175_120_557 145
157 3300044658 Ga0466972_0023417 Ga0466972_0023417_2596_3033 145
158 3300044658 Ga0466972_0034440 Ga0466972_0034440_1065_1502 145
159 3300044683 Ga0466965_0134789 Ga0466965_0134789_223_672 145
160 3300044683 Ga0466965_0224412 Ga0466965_0224412_52_498 145
161 3300044684 Ga0466966_0043920 Ga0466966_0043920_1960_2397 145
162 3300044684 Ga0466966_0366461 Ga0466966_0366461_183_620 145
163 3300044693 Ga0466961_0043996 Ga0466961_0043996_725_1162 145
164 3300044693 Ga0466961_0172172 Ga0466961_0172172_78_515 145
165 3300044735 Ga0466968_0079184 Ga0466968_0079184_976_1413 145
166 3300044765 Ga0466970_0224232 Ga0466970_0224232_475_912 145
167 3300044842 Ga0466957_0072548 Ga0466957_0072548_805_1242 145
168 3300044901 Ga0466960_0263194 Ga0466960_0263194_170_607 145
169 3300044901 Ga0466960_0558788 Ga0466960_0558788_176_613 145
170 3300045049 Ga0466959_0045457 Ga0466959_0045457_665_1102 145
171 3300045049 Ga0466959_0187908 Ga0466959_0187908_229_678 145
172 3300045049 Ga0466959_0529412 Ga0466959_0529412_128_565 145
173 3300045836 Ga0466958_0032719 Ga0466958_0032719_966_1403 145
174 3300046691 Ga0495670_0033782 Ga0495670_0033782_1218_1670 145
175 3300047472 Ga0495686_0185667 Ga0495686_0185667_25_462 145
176 3300048903 Ga0496100_0148408 Ga0496100_0148408_337_774 145
177 3300048906 Ga0496103_0194460 Ga0496103_0194460_852_1289 145
178 3300048907 Ga0496104_0033673 Ga0496104_0033673_2072_2509 145
179 3300048908 Ga0496105_0024675 Ga0496105_0024675_373_810 145
180 3300048910 Ga0496107_0073266 Ga0496107_0073266_263_700 145
181 3300048917 Ga0496114_0014188 Ga0496114_0014188_593_1030 145
182 3300048919 Ga0496116_0083812 Ga0496116_0083812_69_512 145
183 3300048920 Ga0496117_0005824 Ga0496117_0005824_10001_10444 145
184 3300048920 Ga0496117_0006688 Ga0496117_0006688_7100_7537 145
185 3300048920 Ga0496117_0067359 Ga0496117_0067359_71_514 145
186 3300048920 Ga0496117_0067368 Ga0496117_0067368_76_513 145
187 3300048920 Ga0496117_0140091 Ga0496117_0140091_76_519 145
188 3300048921 Ga0496118_0125244 Ga0496118_0125244_789_1274 145
189 3300048921 Ga0496118_0143248 Ga0496118_0143248_93_536 145
190 3300048921 Ga0496118_0599730 Ga0496118_0599730_32_469 145
191 3300048922 Ga0496119_0213364 Ga0496119_0213364_263_706 145
192 3300048923 Ga0496120_0131216 Ga0496120_0131216_792_1229 145
193 3300048925 Ga0496122_0027864 Ga0496122_0027864_1727_2170 145
194 3300048925 Ga0496122_0082856 Ga0496122_0082856_1081_1524 145
195 3300048925 Ga0496122_0347581 Ga0496122_0347581_209_646 145
196 3300048926 Ga0496123_0480043 Ga0496123_0480043_86_529 145
197 3300048928 Ga0496125_0004502 Ga0496125_0004502_5522_5965 145
198 3300048928 Ga0496125_0018004 Ga0496125_0018004_189_632 145
199 3300048928 Ga0496125_0020486 Ga0496125_0020486_4378_4821 145
200 3300048929 Ga0496126_0002004 Ga0496126_0002004_5180_5623 145
201 3300048929 Ga0496126_0002538 Ga0496126_0002538_5946_6392 145
202 3300048929 Ga0496126_0099013 Ga0496126_0099013_1934_2377 145
203 3300048929 Ga0496126_0101707 Ga0496126_0101707_1244_1681 145
204 3300048929 Ga0496126_0912291 Ga0496126_0912291_190_633 145
205 3300049586 Ga0501070_0000133 Ga0501070_0000133_53230_53667 145
206 3300049822 Ga0501035_0020729 Ga0501035_0020729_4028_4465 145
207 3300050491 nmdc:mga00v17_552637_c1 nmdc:mga00v17_552637_c1_85_528 145
208 3300053136 Ga0500559_0015753 Ga0500559_0015753_1151_1600 145
209 3300053140 Ga0500573_0000229 Ga0500573_0000229_17024_17476 145
210 3300053140 Ga0500573_0027262 Ga0500573_0027262_494_940 145
211 3300053140 Ga0500573_0114473 Ga0500573_0114473_223_675 145
212 3300053140 Ga0500573_0183343 Ga0500573_0183343_169_615 145
213 3300053140 Ga0500573_0191682 Ga0500573_0191682_369_836 145
214 3300053153 Ga0500616_0000183 Ga0500616_0000183_79892_80344 145

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01592

NifU_N

NifU-like N terminal domain

7

130

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jzw-assembly4.cif.gz_D crystal structure of sufu from bacillus subtilis with cys persulfurated 0.9443 3 140
8odq-assembly1.cif.gz_C sufs-sufu complex from mycobacterium tuberculosis 0.9414 4 144
2qq4-assembly2.cif.gz_D crystal structure of iron-sulfur cluster biosynthesis protein iscu (ttha1736) from thermus thermophilus hb8 0.9403 2 141
6jzv-assembly4.cif.gz_D crystal structure of sufu from bacillus subtilis 0.9364 3 142
6jzw-assembly3.cif.gz_C crystal structure of sufu from bacillus subtilis with cys persulfurated 0.9296 3 143
ID Description Score Start End Superfamily
af_O53156_2_157_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9834 4 144 3.90.1010.10
2qq4B00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.951 2 141 3.90.1010.10
af_O53156_2_157_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9502 4 144 3.90.1010.10
2qq4B00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9376 2 141 3.90.1010.10
5xt5C00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.896 3 140 3.90.1010.10
ID Description Score Start End GO Terms
AF-A0A387BRQ1-F1-model_v4 SUF system NifU family Fe-S cluster assembly protein 0.9906 14 145 GO:0005506
GO:0016226
GO:0051536
AF-A0A1E2SJ12-F1-model_v4 Iron-sulfur cluster assembly scaffold protein 0.9901 1 144 GO:0005506
GO:0016226
GO:0051536
AF-A0A6I2ZSM4-F1-model_v4 SUF system NifU family Fe-S cluster assembly protein 0.9854 2 144 GO:0005506
GO:0016226
GO:0051536
AF-H0R601-F1-model_v4 Iron-sulfur cluster assembly protein IscU 0.9841 2 144 GO:0005506
GO:0016226
GO:0051536
AF-A0A2A4EBY3-F1-model_v4 Iron-sulfur cluster assembly scaffold protein 0.9837 1 143 GO:0005506
GO:0016226
GO:0051536

Feature Viewer

pLDDT pTM Quality
95.44 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map