F325542

General Info

Members Datasets Scaffolds Average Seq Length
214 123 428 187

Family's Representative Sequence

Representative Sequence 3300044765|Ga0466970_0257053|Ga0466970_0257053_204_863
Length 219
Sequence MLGAHWIPPGIESSGRSEQTLGEGSGAAGRKVSLGPLGRWSILRQATGRDKLGRGSAVQSRRSETLEPRTVTADKVVDSICPFCAVGCAQKVFVKDEKVVQIEGNPASPISRGRLCPKGSASLQLVTSPTRVDKVRYRRPHGTEWEDLDLDTAMDMIADRVIATRKQFWQWEDDQGRRTRRTTGFASLGGATLDNEENYLMKKLYTALGAIQIENQARI

Samples

Sample ID Description Type Environment
1 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
7 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
13 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
14 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
19 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
20 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
21 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
22 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
23 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
24 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
25 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
26 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
27 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
30 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
31 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
32 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
33 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
50 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
51 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
52 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
53 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
54 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
55 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
56 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
57 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
58 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
59 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
60 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
61 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
62 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
63 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
64 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
65 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
66 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
67 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
68 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
69 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
70 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
71 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
72 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
73 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
74 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
75 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
76 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
77 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
78 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
79 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
80 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
81 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
82 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
83 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
84 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
85 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
86 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
87 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
88 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
89 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
90 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
91 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
92 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
93 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
94 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
95 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
96 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
97 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
98 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
99 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
100 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
101 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
102 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
103 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
104 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
105 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
106 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
107 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
115 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
116 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
117 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
118 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
121 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
122 2858868258 Micromonospora sp. MH33 Isolate Unclassified
123 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.66
Metatranscriptomes 1.4
Isolates 0.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 14.49
Rhizosphere 84.58
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466970_0257053 3300044765 Bacteria 979
2 JGI25407J50210_10039611 3300003373 Bacteria 1208
3 Ga0070680_100002056 3300005336 Bacteria 14837
4 Ga0068868_100811903 3300005338 Bacteria 845
5 Ga0070667_100989312 3300005367 Bacteria 785
6 Ga0070708_100012581 3300005445 Bacteria 6908
7 Ga0070678_100452406 3300005456 Bacteria 1125
8 Ga0070681_10000146 3300005458 Bacteria 53666
9 Ga0070707_100004737 3300005468 Bacteria 12751
10 Ga0070699_100564167 3300005518 Bacteria 1037
11 Ga0070679_100001508 3300005530 Bacteria 20697
12 Ga0070679_100438149 3300005530 Bacteria 1252
13 Ga0070686_101236081 3300005544 Bacteria 622
14 Ga0068854_100161917 3300005578 Bacteria 1734
15 Ga0070702_100230807 3300005615 Bacteria 1243
16 Ga0068852_100699497 3300005616 Bacteria 1023
17 Ga0081538_10012179 3300005981 Bacteria 6911
18 Ga0081538_10016021 3300005981 Bacteria 5769
19 Ga0081539_10030431 3300005985 Bacteria 3350
20 Ga0075435_100574841 3300007076 Bacteria 977
21 Ga0105245_10112499 3300009098 Bacteria 2534
22 Ga0105243_10054896 3300009148 Bacteria 3164
23 Ga0105242_10337965 3300009176 Bacteria 1387
24 Ga0105033_100625 3300009986 Bacteria 2736
25 Ga0157314_1004766 3300012500 Bacteria 1008
26 Ga0157371_10878258 3300013102 Bacteria 679
27 Ga0157370_10104025 3300013104 Bacteria 2658
28 Ga0157369_10377109 3300013105 Bacteria 1472
29 Ga0157369_10400247 3300013105 Bacteria 1424
30 Ga0157374_10568594 3300013296 Bacteria 1142
31 Ga0157372_10078573 3300013307 Bacteria 3729
32 Ga0157372_10334201 3300013307 Bacteria 1765
33 Ga0157372_10361119 3300013307 Bacteria 1692
34 Ga0157372_10362718 3300013307 Bacteria 1688
35 Ga0157380_10135486 3300014326 Bacteria 2107
36 Ga0182008_10312733 3300014497 Bacteria 825
37 Ga0157377_10200877 3300014745 Bacteria 1265
38 Ga0157377_10398502 3300014745 Bacteria 937
39 Ga0157379_10605915 3300014968 Bacteria 1023
40 Ga0157379_10811861 3300014968 Bacteria 883
41 Ga0206352_10957305 3300020078 Bacteria 811
42 Ga0206353_11074931 3300020082 Bacteria 720
43 Ga0206353_11402915 3300020082 Bacteria 782
44 Ga0207684_10048219 3300025910 Bacteria 3612
45 Ga0207707_10000180 3300025912 Bacteria 66035
46 Ga0207660_10001800 3300025917 Bacteria 14299
47 Ga0207652_10000114 3300025921 Bacteria 88058
48 Ga0207646_10157412 3300025922 Bacteria 2049
49 Ga0207646_10719744 3300025922 Bacteria 892
50 Ga0207687_10122910 3300025927 Bacteria 1944
51 Ga0207687_10382431 3300025927 Bacteria 1154
52 Ga0207686_10066235 3300025934 Bacteria 2306
53 Ga0207661_10602566 3300025944 Bacteria 1008
54 Ga0207677_10193331 3300026023 Bacteria 1611
55 Ga0207678_10512021 3300026067 Bacteria 1047
56 Ga0207708_10017793 3300026075 Bacteria 5349
57 Ga0207648_10485492 3300026089 Bacteria 1129
58 Ga0207675_100260211 3300026118 Bacteria 1681
59 Ga0207683_10407814 3300026121 Bacteria 1251
60 Ga0207683_10416655 3300026121 Bacteria 1237
61 Ga0207683_10601011 3300026121 Bacteria 1018
62 Ga0307408_100076483 3300031548 Bacteria 2490
63 Ga0307408_100136259 3300031548 Bacteria 1921
64 Ga0307408_100325344 3300031548 Bacteria 1296
65 Ga0307405_10058360 3300031731 Bacteria 2428
66 Ga0307413_10103284 3300031824 Bacteria 1889
67 Ga0307413_10336456 3300031824 Bacteria 1159
68 Ga0307410_10069431 3300031852 Bacteria 2437
69 Ga0307406_10004324 3300031901 Bacteria 7729
70 Ga0307406_10023933 3300031901 Bacteria 3641
71 Ga0307406_10097579 3300031901 Bacteria 1993
72 Ga0307406_10956258 3300031901 Bacteria 732
73 Ga0307407_10017909 3300031903 Bacteria 3568
74 Ga0307407_10102779 3300031903 Bacteria 1777
75 Ga0307409_100003207 3300031995 Bacteria 8802
76 Ga0307409_100080220 3300031995 Bacteria 2632
77 Ga0307409_100135154 3300031995 Bacteria 2114
78 Ga0307409_100299246 3300031995 Bacteria 1496
79 Ga0307416_100000825 3300032002 Bacteria 16263
80 Ga0307416_100038734 3300032002 Bacteria 3680
81 Ga0307416_100075652 3300032002 Bacteria 2818
82 Ga0307414_10042733 3300032004 Bacteria 3082
83 Ga0307411_10036221 3300032005 Bacteria 3089
84 Ga0307411_10552714 3300032005 Bacteria 982
85 Ga0307411_10672852 3300032005 Bacteria 898
86 Ga0307415_100016789 3300032126 Bacteria 4374
87 Ga0307415_100057789 3300032126 Bacteria 2667
88 Ga0307415_100126780 3300032126 Bacteria 1925
89 Ga0395899_0029637 3300037312 Bacteria 4116
90 Ga0395900_0017543 3300037418 Bacteria 7304
91 Ga0395900_0186592 3300037418 Bacteria 2105
92 Ga0395898_0103702 3300037466 Bacteria 2728
93 Ga0395898_0111370 3300037466 Bacteria 2623
94 Ga0395898_0213108 3300037466 Bacteria 1842
95 Ga0395905_0003990 3300037471 Bacteria 15517
96 Ga0395905_0140004 3300037471 Bacteria 2276
97 Ga0395901_0028523 3300038443 Bacteria 5740
98 Ga0395901_0078230 3300038443 Bacteria 3453
99 Ga0395901_0124886 3300038443 Bacteria 2704
100 Ga0395901_1068060 3300038443 Bacteria 779
101 Ga0436365_0578852 3300039437 Bacteria 1385
102 Ga0451798_0209261 3300041458 Bacteria 692
103 Ga0439450_000925 3300042008 Bacteria 4074
104 Ga0439455_0000150 3300042012 Bacteria 7614
105 Ga0439455_0039282 3300042012 Bacteria 1206
106 Ga0439463_000883 3300042016 Bacteria 8249
107 Ga0450913_000385 3300042117 Bacteria 1785
108 Ga0450923_074158 3300042125 Bacteria 758
109 Ga0450900_002587 3300042136 Bacteria 1932
110 Ga0450904_004156 3300042139 Bacteria 1517
111 Ga0450905_002300 3300042142 Bacteria 2452
112 Ga0439444_0000043 3300042437 Bacteria 9044
113 Ga0439464_0001446 3300042439 Bacteria 5592
114 Ga0439464_0066076 3300042439 Bacteria 1064
115 Ga0439460_0000632 3300042461 Bacteria 7717
116 Ga0450916_003353 3300042530 Bacteria 1759
117 Ga0439440_0009913 3300042993 Bacteria 1980
118 Ga0466969_0043977 3300044656 Bacteria 2224
119 Ga0466969_0108809 3300044656 Bacteria 1299
120 Ga0466965_0020836 3300044683 Bacteria 3155
121 Ga0466965_0168097 3300044683 Bacteria 1152
122 Ga0466966_0003038 3300044684 Bacteria 11079
123 Ga0466966_0015837 3300044684 Bacteria 4982
124 Ga0466966_0068676 3300044684 Bacteria 2224
125 Ga0466966_0368293 3300044684 Bacteria 863
126 Ga0466961_0002687 3300044693 Bacteria 11034
127 Ga0466961_0017490 3300044693 Bacteria 4606
128 Ga0466961_0032652 3300044693 Bacteria 3345
129 Ga0466961_0074374 3300044693 Bacteria 2154
130 Ga0466961_0086159 3300044693 Bacteria 1986
131 Ga0466963_0309879 3300044694 Bacteria 1110
132 Ga0466963_0509536 3300044694 Bacteria 850
133 Ga0466964_0020258 3300044706 Bacteria 2560
134 Ga0466964_0283606 3300044706 Bacteria 829
135 Ga0466971_0043617 3300044719 Bacteria 2015
136 Ga0466971_0229074 3300044719 Bacteria 882
137 Ga0466971_0346827 3300044719 Bacteria 718
138 Ga0466968_0125044 3300044735 Bacteria 1166
139 Ga0466968_0351741 3300044735 Bacteria 716
140 Ga0466970_0053283 3300044765 Bacteria 2160
141 Ga0466970_0056526 3300044765 Bacteria 2097
142 Ga0466970_0243141 3300044765 Bacteria 1007
143 Ga0466970_0390874 3300044765 Bacteria 793
144 Ga0466957_0045459 3300044842 Bacteria 2663
145 Ga0466957_0117074 3300044842 Bacteria 1696
146 Ga0466960_0160626 3300044901 Bacteria 1206
147 Ga0466959_0002085 3300045049 Bacteria 12641
148 Ga0466959_0007879 3300045049 Bacteria 7497
149 Ga0466959_0033276 3300045049 Bacteria 3813
150 Ga0466959_0493376 3300045049 Bacteria 828
151 Ga0451576_0227539 3300045051 Bacteria 1947
152 Ga0466958_0026023 3300045836 Bacteria 3455
153 Ga0466958_0075676 3300045836 Bacteria 2065
154 Ga0466958_0089879 3300045836 Bacteria 1899
155 Ga0466967_0014432 3300045976 Bacteria 6154
156 Ga0466967_0041230 3300045976 Bacteria 3979
157 Ga0466967_0121377 3300045976 Bacteria 2415
158 Ga0466967_0130981 3300045976 Bacteria 2328
159 Ga0466967_0163479 3300045976 Bacteria 2091
160 Ga0466967_0313057 3300045976 Bacteria 1512
161 Ga0466967_0333227 3300045976 Bacteria 1466
162 Ga0466967_0825685 3300045976 Bacteria 921
163 Ga0466967_0897794 3300045976 Bacteria 881
164 Ga0466967_0903819 3300045976 Bacteria 878
165 Ga0496100_0198878 3300048903 Bacteria 1459
166 Ga0496101_0085188 3300048904 Bacteria 2341
167 Ga0496102_0029386 3300048905 Bacteria 4919
168 Ga0496102_0044516 3300048905 Bacteria 4028
169 Ga0496103_0029442 3300048906 Bacteria 3337
170 Ga0496105_0018683 3300048908 Bacteria 5580
171 Ga0496105_0074882 3300048908 Bacteria 2797
172 Ga0496105_0772707 3300048908 Bacteria 732
173 Ga0496105_0993554 3300048908 Bacteria 628
174 Ga0496106_0083172 3300048909 Bacteria 2462
175 Ga0496106_0185545 3300048909 Bacteria 1652
176 Ga0496106_0238225 3300048909 Bacteria 1454
177 Ga0496107_0048272 3300048910 Bacteria 3066
178 Ga0496107_0065495 3300048910 Bacteria 2634
179 Ga0496108_0751593 3300048911 Bacteria 843
180 Ga0496109_0009924 3300048912 Bacteria 8130
181 Ga0496109_0129133 3300048912 Bacteria 2358
182 Ga0496109_0137581 3300048912 Bacteria 2283
183 Ga0496109_0169889 3300048912 Bacteria 2045
184 Ga0496111_0038323 3300048914 Bacteria 3434
185 Ga0496111_0200477 3300048914 Bacteria 1484
186 Ga0496111_0289716 3300048914 Bacteria 1214
187 Ga0496112_0007135 3300048915 Bacteria 9890
188 Ga0496113_0021179 3300048916 Bacteria 4584
189 Ga0496113_0204990 3300048916 Bacteria 1568
190 Ga0496114_0014321 3300048917 Bacteria 6362
191 Ga0496114_0299564 3300048917 Bacteria 1419
192 Ga0496115_0005411 3300048918 Bacteria 9284
193 Ga0496115_0068360 3300048918 Bacteria 2876
194 Ga0496115_0259783 3300048918 Bacteria 1428
195 Ga0501033_0003154 3300049570 Bacteria 13699
196 Ga0501037_0033606 3300049573 Bacteria 3787
197 Ga0501038_0005109 3300049574 Bacteria 12195
198 Ga0501039_0124087 3300049575 Bacteria 2025
199 Ga0501043_0039623 3300049579 Bacteria 3703
200 Ga0501047_0009529 3300049581 Bacteria 9179
201 Ga0501067_0039583 3300049583 Bacteria 2617
202 Ga0501067_0158063 3300049583 Bacteria 1262
203 Ga0501068_0017823 3300049584 Bacteria 4111
204 Ga0501068_0660389 3300049584 Bacteria 683
205 Ga0501069_0038349 3300049585 Bacteria 2645
206 Ga0501069_0050696 3300049585 Bacteria 2308
207 Ga0501080_1498463 3300049742 Bacteria 573
208 Ga0501035_0637518 3300049822 Bacteria 865
209 Ga0501044_0027893 3300049823 Bacteria 5960
210 nmdc:mga0qj67_576392_c1 3300050509 Bacteria 901
211 Ga0466962_0029986 3300061719 Bacteria 2604
212 Ga0466962_0459059 3300061719 Bacteria 642
213 2858869199 2858868258 Bacteria 7683772
214 2863073957 2863067949 Bacteria 8541735
215 Ga0466970_0257053
216 JGI25407J50210_10039611
217 Ga0070680_100002056
218 Ga0068868_100811903
219 Ga0070667_100989312
220 Ga0070708_100012581
221 Ga0070678_100452406
222 Ga0070681_10000146
223 Ga0070707_100004737
224 Ga0070699_100564167
225 Ga0070679_100001508
226 Ga0070679_100438149
227 Ga0070686_101236081
228 Ga0068854_100161917
229 Ga0070702_100230807
230 Ga0068852_100699497
231 Ga0081538_10012179
232 Ga0081538_10016021
233 Ga0081539_10030431
234 Ga0075435_100574841
235 Ga0105245_10112499
236 Ga0105243_10054896
237 Ga0105242_10337965
238 Ga0105033_100625
239 Ga0157314_1004766
240 Ga0157371_10878258
241 Ga0157370_10104025
242 Ga0157369_10377109
243 Ga0157369_10400247
244 Ga0157374_10568594
245 Ga0157372_10078573
246 Ga0157372_10334201
247 Ga0157372_10361119
248 Ga0157372_10362718
249 Ga0157380_10135486
250 Ga0182008_10312733
251 Ga0157377_10200877
252 Ga0157377_10398502
253 Ga0157379_10605915
254 Ga0157379_10811861
255 Ga0206352_10957305
256 Ga0206353_11074931
257 Ga0206353_11402915
258 Ga0207684_10048219
259 Ga0207707_10000180
260 Ga0207660_10001800
261 Ga0207652_10000114
262 Ga0207646_10157412
263 Ga0207646_10719744
264 Ga0207687_10122910
265 Ga0207687_10382431
266 Ga0207686_10066235
267 Ga0207661_10602566
268 Ga0207677_10193331
269 Ga0207678_10512021
270 Ga0207708_10017793
271 Ga0207648_10485492
272 Ga0207675_100260211
273 Ga0207683_10407814
274 Ga0207683_10416655
275 Ga0207683_10601011
276 Ga0307408_100076483
277 Ga0307408_100136259
278 Ga0307408_100325344
279 Ga0307405_10058360
280 Ga0307413_10103284
281 Ga0307413_10336456
282 Ga0307410_10069431
283 Ga0307406_10004324
284 Ga0307406_10023933
285 Ga0307406_10097579
286 Ga0307406_10956258
287 Ga0307407_10017909
288 Ga0307407_10102779
289 Ga0307409_100003207
290 Ga0307409_100080220
291 Ga0307409_100135154
292 Ga0307409_100299246
293 Ga0307416_100000825
294 Ga0307416_100038734
295 Ga0307416_100075652
296 Ga0307414_10042733
297 Ga0307411_10036221
298 Ga0307411_10552714
299 Ga0307411_10672852
300 Ga0307415_100016789
301 Ga0307415_100057789
302 Ga0307415_100126780
303 Ga0395899_0029637
304 Ga0395900_0017543
305 Ga0395900_0186592
306 Ga0395898_0103702
307 Ga0395898_0111370
308 Ga0395898_0213108
309 Ga0395905_0003990
310 Ga0395905_0140004
311 Ga0395901_0028523
312 Ga0395901_0078230
313 Ga0395901_0124886
314 Ga0395901_1068060
315 Ga0436365_0578852
316 Ga0451798_0209261
317 Ga0439450_000925
318 Ga0439455_0000150
319 Ga0439455_0039282
320 Ga0439463_000883
321 Ga0450913_000385
322 Ga0450923_074158
323 Ga0450900_002587
324 Ga0450904_004156
325 Ga0450905_002300
326 Ga0439444_0000043
327 Ga0439464_0001446
328 Ga0439464_0066076
329 Ga0439460_0000632
330 Ga0450916_003353
331 Ga0439440_0009913
332 Ga0466969_0043977
333 Ga0466969_0108809
334 Ga0466965_0020836
335 Ga0466965_0168097
336 Ga0466966_0003038
337 Ga0466966_0015837
338 Ga0466966_0068676
339 Ga0466966_0368293
340 Ga0466961_0002687
341 Ga0466961_0017490
342 Ga0466961_0032652
343 Ga0466961_0074374
344 Ga0466961_0086159
345 Ga0466963_0309879
346 Ga0466963_0509536
347 Ga0466964_0020258
348 Ga0466964_0283606
349 Ga0466971_0043617
350 Ga0466971_0229074
351 Ga0466971_0346827
352 Ga0466968_0125044
353 Ga0466968_0351741
354 Ga0466970_0053283
355 Ga0466970_0056526
356 Ga0466970_0243141
357 Ga0466970_0390874
358 Ga0466957_0045459
359 Ga0466957_0117074
360 Ga0466960_0160626
361 Ga0466959_0002085
362 Ga0466959_0007879
363 Ga0466959_0033276
364 Ga0466959_0493376
365 Ga0451576_0227539
366 Ga0466958_0026023
367 Ga0466958_0075676
368 Ga0466958_0089879
369 Ga0466967_0014432
370 Ga0466967_0041230
371 Ga0466967_0121377
372 Ga0466967_0130981
373 Ga0466967_0163479
374 Ga0466967_0313057
375 Ga0466967_0333227
376 Ga0466967_0825685
377 Ga0466967_0897794
378 Ga0466967_0903819
379 Ga0496100_0198878
380 Ga0496101_0085188
381 Ga0496102_0029386
382 Ga0496102_0044516
383 Ga0496103_0029442
384 Ga0496105_0018683
385 Ga0496105_0074882
386 Ga0496105_0772707
387 Ga0496105_0993554
388 Ga0496106_0083172
389 Ga0496106_0185545
390 Ga0496106_0238225
391 Ga0496107_0048272
392 Ga0496107_0065495
393 Ga0496108_0751593
394 Ga0496109_0009924
395 Ga0496109_0129133
396 Ga0496109_0137581
397 Ga0496109_0169889
398 Ga0496111_0038323
399 Ga0496111_0200477
400 Ga0496111_0289716
401 Ga0496112_0007135
402 Ga0496113_0021179
403 Ga0496113_0204990
404 Ga0496114_0014321
405 Ga0496114_0299564
406 Ga0496115_0005411
407 Ga0496115_0068360
408 Ga0496115_0259783
409 Ga0501033_0003154
410 Ga0501037_0033606
411 Ga0501038_0005109
412 Ga0501039_0124087
413 Ga0501043_0039623
414 Ga0501047_0009529
415 Ga0501067_0039583
416 Ga0501067_0158063
417 Ga0501068_0017823
418 Ga0501068_0660389
419 Ga0501069_0038349
420 Ga0501069_0050696
421 Ga0501080_1498463
422 Ga0501035_0637518
423 Ga0501044_0027893
424 nmdc:mga0qj67_576392_c1
425 Ga0466962_0029986
426 Ga0466962_0459059
427 2858869199
428 2863073957

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04879

Molybdop_Fe4S4

Molybdopterin oxidoreductase Fe4S4 domain

74

128

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xko-assembly1.cif.gz_C crystal structure of the complex of ntca with its transcriptional co- activator pipx 0.7207 84 116
2xko-assembly1.cif.gz_D crystal structure of the complex of ntca with its transcriptional co- activator pipx 0.7205 84 116
5vrv-assembly3.cif.gz_E 2.05 angstrom resolution crystal structure of c-terminal domain (duf2156) of putative lysylphosphatidylglycerol synthetase from agrobacterium fabrum. 0.6888 38 54
1cc1-assembly1.cif.gz_L crystal structure of a reduced, active form of the ni-fe-se hydrogenase from desulfomicrobium baculatum 0.6615 25 55
4kl8-assembly2.cif.gz_M high-resolution structure of anaerobically purified dm. baculatum [nifese]-hydrogenase after crystallization under air 0.6491 25 55
ID Description Score Start End Superfamily
2iv2X01 Mainly Beta;Single Sheet;N-terminal domain of TfIIb;ADC-like domains 0.8113 25 78 2.20.25.90
2v45A01 Mainly Beta;Single Sheet;N-terminal domain of TfIIb;ADC-like domains 0.7859 23 80 2.20.25.90
2iv2X01 Mainly Beta;Single Sheet;N-terminal domain of TfIIb;ADC-like domains 0.7742 25 78 2.20.25.90
2v45A01 Mainly Beta;Single Sheet;N-terminal domain of TfIIb;ADC-like domains 0.7326 23 80 2.20.25.90
af_Q2FVV9_257_311_2.20.25.90 Mainly Beta;Single Sheet;N-terminal domain of TfIIb;ADC-like domains 0.7274 25 69 2.20.25.90
ID Description Score Start End GO Terms
AF-A0A535N8Z4-F1-model_v4 Dehydrogenase 0.8225 8 70 GO:0016491
GO:0030313
GO:0046872
GO:0051539
AF-A0A538GU26-F1-model_v4 Dehydrogenase 0.7645 2 67 GO:0016491
GO:0030313
GO:0046872
GO:0051539
AF-A0A535N8Z4-F1-model_v4 Dehydrogenase 0.7594 8 70 GO:0016491
GO:0030313
GO:0046872
GO:0051539
AF-A0A318NDT1-F1-model_v4 Dehydrogenase 0.7351 2 90 GO:0016491
GO:0030313
GO:0046872
GO:0051539
AF-A0A2V5QLJ2-F1-model_v4 Dehydrogenase 0.7182 9 88 GO:0009055
GO:0009061
GO:0016491
GO:0030151
GO:0030313
GO:0051539

Map