F325479

General Info

Members Datasets Scaffolds Average Seq Length
214 168 428 255

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_1470947|Ga0436363_1470947_478_1353
Length 291
Sequence LGLSPTVKRRDRVDARHKAGMTAGPPPQNGAEIAMARGVGLFDLTGRLALVTGSSQGIGLAIARGLGEAGARIVLNGRHPEKLEKVAADLQNAGIEAHIAAFDVTDHSAVTQAIDEIERDVGRLDILVNNAGINRRSPFEGIKLDVWHEVMGTNLHSVFYVAQAAGRHMLARKRGKIINICSIMSELVRPTVVPYATAKGGLKMMTKGLCAEWAKHNIQVNGIGPGFFKTELNAPLIADEKFSSWVCGRTPAGRWAEVDELIGAAVFLASDASNYVNGHILYVDGGLTSVV

Samples

Sample ID Description Type Environment
1 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
7 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
60 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
66 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
67 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
102 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
105 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
106 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
110 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
111 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
112 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
113 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
116 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
117 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
124 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
125 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
126 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
127 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
128 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
129 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
130 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
131 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
135 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
136 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
137 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
138 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
139 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
140 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
141 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
142 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
148 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
149 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
150 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
151 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
152 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
153 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
154 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
155 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
156 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
157 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
158 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
159 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
160 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
161 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
162 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
163 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
164 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
165 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
166 2858950400 Achromobacter sp. K91 Isolate Unclassified
167 2909042592 Labrys sp. LIt4 Isolate Nodule
168 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.93
Metatranscriptomes 0
Isolates 6.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.21
Nodule 1.4
Rhizoplane 7.01
Rhizosphere 69.16
Stem 0
Stem Tuber 0.47
Unclassified 1.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436363_1470947 3300039450 Bacteria 6301
2 JGI25159J45721_1001140 3300002987 Bacteria 11360
3 JGI25151J46595_10000275 3300003187 Bacteria 59285
4 rootL2_10020344 3300003322 Bacteria 1630
5 rootL2_10120179 3300003322 Bacteria 1391
6 rootL2_10302117 3300003322 Bacteria 2133
7 JGI25160J50197_1000079 3300003354 Bacteria 101859
8 JGI25160J50197_1006917 3300003354 Bacteria 4515
9 JGI25161J50226_1000060 3300003374 Bacteria 101859
10 Ga0055541_1000153 3300003841 Bacteria 34054
11 Ga0055543_1000086 3300004625 Bacteria 81231
12 Ga0065165_1000208 3300005262 Bacteria 101897
13 Ga0065704_10070709 3300005289 Bacteria 17247
14 Ga0065704_10071845 3300005289 Bacteria 9773
15 Ga0070658_10302638 3300005327 Bacteria 1363
16 Ga0070676_10117789 3300005328 Bacteria 1663
17 Ga0070683_100186234 3300005329 Bacteria 1970
18 Ga0070683_100357797 3300005329 Bacteria 1390
19 Ga0070670_100445694 3300005331 Bacteria 1147
20 Ga0068869_100331466 3300005334 Bacteria 1237
21 Ga0070682_100187309 3300005337 Bacteria 1450
22 Ga0068868_100027814 3300005338 Bacteria 4316
23 Ga0070689_100118732 3300005340 Bacteria 2111
24 Ga0070661_100265181 3300005344 Bacteria 1329
25 Ga0070692_10110483 3300005345 Bacteria 1520
26 Ga0070671_100143433 3300005355 Bacteria 2016
27 Ga0070688_100109633 3300005365 Bacteria 1834
28 Ga0070659_100039073 3300005366 Bacteria 3703
29 Ga0070701_10135550 3300005438 Bacteria 1403
30 Ga0070700_100047340 3300005441 Bacteria 2661
31 Ga0070708_100055214 3300005445 Plasmid 3531
32 Ga0070663_100026390 3300005455 Bacteria 3934
33 Ga0070685_10006255 3300005466 Bacteria 6065
34 Ga0070698_100043698 3300005471 Bacteria 4593
35 Ga0068853_100020834 3300005539 Bacteria 5455
36 Ga0070665_100022511 3300005548 Bacteria 6343
37 Ga0070664_100193965 3300005564 Bacteria 1810
38 Ga0070664_100229805 3300005564 Bacteria 1662
39 Ga0070664_100462878 3300005564 Bacteria 1165
40 Ga0068856_100194060 3300005614 Bacteria 2045
41 Ga0068856_100380600 3300005614 Bacteria 1430
42 Ga0068852_100019963 3300005616 Bacteria 5320
43 Ga0068852_100229850 3300005616 Bacteria 1768
44 Ga0068859_100336965 3300005617 Bacteria 1603
45 Ga0068870_10039703 3300005840 Bacteria 2436
46 Ga0068858_100261041 3300005842 Bacteria 1646
47 Ga0068858_100402280 3300005842 Bacteria 1316
48 Ga0081540_1011782 3300005983 Bacteria 5815
49 Ga0075365_10045446 3300006038 Bacteria 2881
50 Ga0075369_10012723 3300006186 Bacteria 3324
51 Ga0075369_10037028 3300006186 Bacteria 2077
52 Ga0097620_100336968 3300006931 Bacteria 1603
53 Ga0105240_10051473 3300009093 Bacteria 5180
54 Ga0111539_10087261 3300009094 Bacteria 3665
55 Ga0105245_10014104 3300009098 Bacteria 6962
56 Ga0105245_10101758 3300009098 Bacteria 2660
57 Ga0105247_10069938 3300009101 Bacteria 2192
58 Ga0105243_10128979 3300009148 Bacteria 2143
59 Ga0105241_10222121 3300009174 Bacteria 1589
60 Ga0105242_10296369 3300009176 Bacteria 1474
61 Ga0105237_10299625 3300009545 Bacteria 1611
62 Ga0105238_10148847 3300009551 Bacteria 2317
63 Ga0105249_10024183 3300009553 Bacteria 5459
64 Ga0105033_107615 3300009986 Bacteria 940
65 Ga0105239_10053983 3300010375 Bacteria 4406
66 Ga0105239_10908749 3300010375 Bacteria 1011
67 Ga0105239_11025229 3300010375 Bacteria 949
68 Ga0105246_10026301 3300011119 Bacteria 3800
69 Ga0105246_10143420 3300011119 Bacteria 1799
70 Ga0105246_10362371 3300011119 Bacteria 1192
71 Ga0157378_10711635 3300013297 Bacteria 1024
72 Ga0163163_10165294 3300014325 Bacteria 2259
73 Ga0157377_10027764 3300014745 Bacteria 3041
74 Ga0157379_10210580 3300014968 Bacteria 1760
75 Ga0183361_10005 3300016635 Bacteria 413599
76 Ga0213874_10016522 3300021377 Bacteria 1966
77 Ga0213876_10119100 3300021384 Bacteria 1401
78 Ga0209566_100228 3300025225 Bacteria 54872
79 Ga0209130_1000152 3300025284 Bacteria 105768
80 Ga0209130_1001711 3300025284 Bacteria 13227
81 Ga0209025_1000212 3300025294 Bacteria 139086
82 Ga0209758_1002963 3300025297 Bacteria 16285
83 Ga0209758_1047234 3300025297 Unclassified 1543
84 Ga0207426_1000017 3300025302 Bacteria 577913
85 Ga0207426_1000366 3300025302 Bacteria 80234
86 Ga0207710_10047094 3300025900 Bacteria 1926
87 Ga0207688_10002556 3300025901 Bacteria 9838
88 Ga0207647_10071919 3300025904 Bacteria 2086
89 Ga0207645_10158143 3300025907 Bacteria 1481
90 Ga0207643_10017813 3300025908 Bacteria 3889
91 Ga0207684_10218257 3300025910 Unclassified 1646
92 Ga0207654_10286193 3300025911 Bacteria 1116
93 Ga0207693_10314839 3300025915 Bacteria 1225
94 Ga0207663_10252167 3300025916 Bacteria 1299
95 Ga0207657_10154957 3300025919 Bacteria 1864
96 Ga0207649_10235685 3300025920 Bacteria 1311
97 Ga0207646_10172932 3300025922 Bacteria 1950
98 Ga0207681_10128075 3300025923 Bacteria 1873
99 Ga0207659_10450255 3300025926 Bacteria 1084
100 Ga0207687_10051805 3300025927 Bacteria 2862
101 Ga0207687_10278958 3300025927 Bacteria 1339
102 Ga0207700_10056283 3300025928 Bacteria 2960
103 Ga0207644_10098205 3300025931 Bacteria 2195
104 Ga0207706_10204650 3300025933 Bacteria 1731
105 Ga0207711_10186482 3300025941 Bacteria 1889
106 Ga0207689_10007908 3300025942 Bacteria 9287
107 Ga0207689_10176447 3300025942 Bacteria 1762
108 Ga0207661_10369680 3300025944 Bacteria 1296
109 Ga0207651_10418001 3300025960 Bacteria 1144
110 Ga0207668_10030910 3300025972 Bacteria 3523
111 Ga0207703_10663720 3300026035 Bacteria 990
112 Ga0207678_10000665 3300026067 Bacteria 31567
113 Ga0207678_10064785 3300026067 Bacteria 3140
114 Ga0207708_10066558 3300026075 Bacteria 2755
115 Ga0207702_10216165 3300026078 Bacteria 1784
116 Ga0207702_10402424 3300026078 Bacteria 1320
117 Ga0207676_10263445 3300026095 Bacteria 1557
118 Ga0207674_10082605 3300026116 Bacteria 3213
119 Ga0207674_10184989 3300026116 Bacteria 2034
120 Ga0207683_10050422 3300026121 Bacteria 3646
121 Ga0207683_10314200 3300026121 Bacteria 1435
122 Ga0209974_10002849 3300027876 Bacteria 6272
123 Ga0268266_10042959 3300028379 Bacteria 3861
124 Ga0307515_10000176 3300028794 Bacteria 157429
125 Ga0265338_10002036 3300028800 Bacteria 31293
126 Ga0307511_10007154 3300030521 Bacteria 11244
127 Ga0307509_10002463 3300031507 Bacteria 29929
128 Ga0307408_100000005 3300031548 Bacteria 529098
129 Ga0316576_10001644 3300031727 Bacteria 12225
130 Ga0316576_10008226 3300031727 Bacteria 6632
131 Ga0316576_10057832 3300031727 Bacteria 2835
132 Ga0316578_10041093 3300031728 Bacteria 2677
133 Ga0307516_10000348 3300031730 Bacteria 60054
134 Ga0307516_10427515 3300031730 Bacteria 982
135 Ga0307410_10572297 3300031852 Bacteria 939
136 Ga0307415_100139780 3300032126 Bacteria 1848
137 Ga0316580_10009432 3300032139 Bacteria 2934
138 Ga0316580_10039059 3300032139 Bacteria 1467
139 Ga0307510_10003186 3300033180 Bacteria 19042
140 Ga0316574_0235622 3300035398 Bacteria 1171
141 Ga0316582_0078908 3300036647 Bacteria 2146
142 Ga0316584_0125037 3300036712 Bacteria 1921
143 Ga0436365_0095350 3300039437 Bacteria 3081
144 Ga0436365_1378507 3300039437 Bacteria 8873
145 Ga0436361_0010089 3300039447 Bacteria 2495
146 Ga0436361_1119950 3300039447 Bacteria 1539
147 Ga0436363_0144656 3300039450 Bacteria 13585
148 Ga0439465_0150152 3300041413 Bacteria 832
149 Ga0439448_0133026 3300042005 Bacteria 858
150 Ga0451577_0025817 3300042876 Bacteria 5327
151 Ga0453683_0010157 3300044673 Bacteria 6251
152 Ga0453683_0037619 3300044673 Bacteria 3044
153 Ga0453684_0000328 3300044712 Bacteria 199181
154 Ga0453684_0003498 3300044712 Bacteria 35258
155 Ga0453684_0015209 3300044712 Bacteria 12207
156 Ga0453684_0055120 3300044712 Bacteria 5171
157 Ga0453684_0069990 3300044712 Bacteria 4446
158 Ga0466960_0141579 3300044901 Bacteria 1278
159 Ga0451576_0000594 3300045051 Bacteria 76242
160 Ga0451576_0014337 3300045051 Bacteria 8828
161 Ga0451576_0249714 3300045051 Bacteria 1854
162 Ga0495590_0189187 3300046457 Bacteria 754
163 Ga0495607_0000134 3300046501 Bacteria 78370
164 Ga0495643_0110155 3300046522 Bacteria 1401
165 Ga0495597_0122185 3300046542 Bacteria 1085
166 Ga0495645_0165821 3300046543 Bacteria 1524
167 Ga0495649_0018648 3300046694 Bacteria 3901
168 Ga0495687_001390 3300047443 Bacteria 22369
169 Ga0495626_0016360 3300048091 Bacteria 3770
170 Ga0496101_0047645 3300048904 Bacteria 3078
171 Ga0496102_0183520 3300048905 Bacteria 1971
172 Ga0496106_0121656 3300048909 Bacteria 2041
173 Ga0496107_0058189 3300048910 Bacteria 2795
174 Ga0496108_0178902 3300048911 Bacteria 1836
175 Ga0496109_0155061 3300048912 Bacteria 2145
176 Ga0496109_0578174 3300048912 Bacteria 1059
177 Ga0496110_0126614 3300048913 Bacteria 2305
178 Ga0496110_0183126 3300048913 Bacteria 1902
179 Ga0496111_0176994 3300048914 Bacteria 1586
180 Ga0496111_0385470 3300048914 Bacteria 1036
181 Ga0496114_0001052 3300048917 Bacteria 20732
182 Ga0496114_0072102 3300048917 Bacteria 2904
183 Ga0496114_0294244 3300048917 Bacteria 1433
184 Ga0496114_0319633 3300048917 Bacteria 1371
185 Ga0496119_0111808 3300048922 Bacteria 1515
186 Ga0496121_0040006 3300048924 Bacteria 4120
187 Ga0496121_0205395 3300048924 Bacteria 1400
188 Ga0501033_0012900 3300049570 Bacteria 6374
189 Ga0501036_0098755 3300049572 Bacteria 2469
190 Ga0501042_0223362 3300049578 Bacteria 1358
191 Ga0501046_0036982 3300049580 Bacteria 3925
192 Ga0501044_0159922 3300049823 Bacteria 2230
193 Ga0501045_0032832 3300049824 Bacteria 3762
194 nmdc:mga0yw44_1332_c1 3300050492 Bacteria 9765
195 nmdc:mga07m45_236253_c1 3300050496 Bacteria 1063
196 nmdc:mga0sz30_16991_c1 3300050516 Bacteria 2897
197 Ga0495601_0014648 3300053077 Bacteria 4727
198 Ga0495595_0038921 3300053084 Unclassified 2168
199 Ga0495619_0017027 3300053085 Unclassified 4607
200 Ga0500643_032455 3300053087 Bacteria 1586
201 Ga0500660_015491 3300053100 Bacteria 4096
202 2511234009 2511231000 Bacteria 4488346
203 2585157019 2582581281 Bacteria 4487904
204 2585161538 2582581282 Bacteria 4495830
205 2585993892 2585427633 Bacteria 6413184
206 2586004819 2585427634 Bacteria 6455027
207 2765572467 2765235839 Bacteria 5314748
208 2821444443 2821443989 Bacteria 7658172
209 2844539176 2844533157 Bacteria 7517899
210 2855022110 2855020534 Bacteria 3204685
211 2857578368 2857576091 Bacteria 5465855
212 2858951377 2858950400 Bacteria 6783797
213 2909047165 2909042592 Bacteria 6499737
214 2954389919 2954380949 Bacteria 10050426
215 Ga0436363_1470947
216 JGI25159J45721_1001140
217 JGI25151J46595_10000275
218 rootL2_10020344
219 rootL2_10120179
220 rootL2_10302117
221 JGI25160J50197_1000079
222 JGI25160J50197_1006917
223 JGI25161J50226_1000060
224 Ga0055541_1000153
225 Ga0055543_1000086
226 Ga0065165_1000208
227 Ga0065704_10070709
228 Ga0065704_10071845
229 Ga0070658_10302638
230 Ga0070676_10117789
231 Ga0070683_100186234
232 Ga0070683_100357797
233 Ga0070670_100445694
234 Ga0068869_100331466
235 Ga0070682_100187309
236 Ga0068868_100027814
237 Ga0070689_100118732
238 Ga0070661_100265181
239 Ga0070692_10110483
240 Ga0070671_100143433
241 Ga0070688_100109633
242 Ga0070659_100039073
243 Ga0070701_10135550
244 Ga0070700_100047340
245 Ga0070708_100055214
246 Ga0070663_100026390
247 Ga0070685_10006255
248 Ga0070698_100043698
249 Ga0068853_100020834
250 Ga0070665_100022511
251 Ga0070664_100193965
252 Ga0070664_100229805
253 Ga0070664_100462878
254 Ga0068856_100194060
255 Ga0068856_100380600
256 Ga0068852_100019963
257 Ga0068852_100229850
258 Ga0068859_100336965
259 Ga0068870_10039703
260 Ga0068858_100261041
261 Ga0068858_100402280
262 Ga0081540_1011782
263 Ga0075365_10045446
264 Ga0075369_10012723
265 Ga0075369_10037028
266 Ga0097620_100336968
267 Ga0105240_10051473
268 Ga0111539_10087261
269 Ga0105245_10014104
270 Ga0105245_10101758
271 Ga0105247_10069938
272 Ga0105243_10128979
273 Ga0105241_10222121
274 Ga0105242_10296369
275 Ga0105237_10299625
276 Ga0105238_10148847
277 Ga0105249_10024183
278 Ga0105033_107615
279 Ga0105239_10053983
280 Ga0105239_10908749
281 Ga0105239_11025229
282 Ga0105246_10026301
283 Ga0105246_10143420
284 Ga0105246_10362371
285 Ga0157378_10711635
286 Ga0163163_10165294
287 Ga0157377_10027764
288 Ga0157379_10210580
289 Ga0183361_10005
290 Ga0213874_10016522
291 Ga0213876_10119100
292 Ga0209566_100228
293 Ga0209130_1000152
294 Ga0209130_1001711
295 Ga0209025_1000212
296 Ga0209758_1002963
297 Ga0209758_1047234
298 Ga0207426_1000017
299 Ga0207426_1000366
300 Ga0207710_10047094
301 Ga0207688_10002556
302 Ga0207647_10071919
303 Ga0207645_10158143
304 Ga0207643_10017813
305 Ga0207684_10218257
306 Ga0207654_10286193
307 Ga0207693_10314839
308 Ga0207663_10252167
309 Ga0207657_10154957
310 Ga0207649_10235685
311 Ga0207646_10172932
312 Ga0207681_10128075
313 Ga0207659_10450255
314 Ga0207687_10051805
315 Ga0207687_10278958
316 Ga0207700_10056283
317 Ga0207644_10098205
318 Ga0207706_10204650
319 Ga0207711_10186482
320 Ga0207689_10007908
321 Ga0207689_10176447
322 Ga0207661_10369680
323 Ga0207651_10418001
324 Ga0207668_10030910
325 Ga0207703_10663720
326 Ga0207678_10000665
327 Ga0207678_10064785
328 Ga0207708_10066558
329 Ga0207702_10216165
330 Ga0207702_10402424
331 Ga0207676_10263445
332 Ga0207674_10082605
333 Ga0207674_10184989
334 Ga0207683_10050422
335 Ga0207683_10314200
336 Ga0209974_10002849
337 Ga0268266_10042959
338 Ga0307515_10000176
339 Ga0265338_10002036
340 Ga0307511_10007154
341 Ga0307509_10002463
342 Ga0307408_100000005
343 Ga0316576_10001644
344 Ga0316576_10008226
345 Ga0316576_10057832
346 Ga0316578_10041093
347 Ga0307516_10000348
348 Ga0307516_10427515
349 Ga0307410_10572297
350 Ga0307415_100139780
351 Ga0316580_10009432
352 Ga0316580_10039059
353 Ga0307510_10003186
354 Ga0316574_0235622
355 Ga0316582_0078908
356 Ga0316584_0125037
357 Ga0436365_0095350
358 Ga0436365_1378507
359 Ga0436361_0010089
360 Ga0436361_1119950
361 Ga0436363_0144656
362 Ga0439465_0150152
363 Ga0439448_0133026
364 Ga0451577_0025817
365 Ga0453683_0010157
366 Ga0453683_0037619
367 Ga0453684_0000328
368 Ga0453684_0003498
369 Ga0453684_0015209
370 Ga0453684_0055120
371 Ga0453684_0069990
372 Ga0466960_0141579
373 Ga0451576_0000594
374 Ga0451576_0014337
375 Ga0451576_0249714
376 Ga0495590_0189187
377 Ga0495607_0000134
378 Ga0495643_0110155
379 Ga0495597_0122185
380 Ga0495645_0165821
381 Ga0495649_0018648
382 Ga0495687_001390
383 Ga0495626_0016360
384 Ga0496101_0047645
385 Ga0496102_0183520
386 Ga0496106_0121656
387 Ga0496107_0058189
388 Ga0496108_0178902
389 Ga0496109_0155061
390 Ga0496109_0578174
391 Ga0496110_0126614
392 Ga0496110_0183126
393 Ga0496111_0176994
394 Ga0496111_0385470
395 Ga0496114_0001052
396 Ga0496114_0072102
397 Ga0496114_0294244
398 Ga0496114_0319633
399 Ga0496119_0111808
400 Ga0496121_0040006
401 Ga0496121_0205395
402 Ga0501033_0012900
403 Ga0501036_0098755
404 Ga0501042_0223362
405 Ga0501046_0036982
406 Ga0501044_0159922
407 Ga0501045_0032832
408 nmdc:mga0yw44_1332_c1
409 nmdc:mga07m45_236253_c1
410 nmdc:mga0sz30_16991_c1
411 Ga0495601_0014648
412 Ga0495595_0038921
413 Ga0495619_0017027
414 Ga0500643_032455
415 Ga0500660_015491
416 2511234009
417 2585157019
418 2585161538
419 2585993892
420 2586004819
421 2765572467
422 2821444443
423 2844539176
424 2855022110
425 2857578368
426 2858951377
427 2909047165
428 2954389919

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

47

241

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

53

288

0.94

PF08659

KR

KR domain

48

226

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ibo-assembly1.cif.gz_C crystal structure of a putative gluconate dehydrogenase from agrobacterium tumefaciens (target efi-506446) 0.9688 2 241
4g81-assembly1.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9666 4 241
4ibo-assembly1.cif.gz_C crystal structure of a putative gluconate dehydrogenase from agrobacterium tumefaciens (target efi-506446) 0.961 2 241
3svt-assembly1.cif.gz_B structure of a short-chain type dehydrogenase/reductase from mycobacterium ulcerans 0.9553 6 240
6le3-assembly1.cif.gz_F crystal structure of gluconate 5-dehydrogenase from lentibacter algarum 0.953 4 239
ID Description Score Start End Superfamily
4iboB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.967 2 241 3.40.50.720
af_Q0JDU3_1_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9654 74 237 3.40.50.720
4iboB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9591 2 241 3.40.50.720
af_I1LJY0_35_302_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9571 3 239 3.40.50.720
1wntC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9559 5 239 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7X8Y593-F1-model_v4 SDR family oxidoreductase 0.9882 1 241
AF-A0A832SLJ7-F1-model_v4 SDR family oxidoreductase 0.9871 65 241 GO:0016616
AF-A0A0K3LER9-F1-model_v4 5-keto-D-gluconate-5-reductase (Gluconate 5-dehydrogenase (EC 1.1.1.69)) 0.9865 76 241 GO:0008874
AF-A0A7X8Y593-F1-model_v4 SDR family oxidoreductase 0.9841 1 241
AF-A0A7V4LZP1-F1-model_v4 SDR family oxidoreductase 0.9834 75 239 GO:0016616

Map