F325464

General Info

Members Datasets Scaffolds Average Seq Length
214 108 211 236

Family's Representative Sequence

Representative Sequence 3300038726|Ga0400490_55744|Ga0400490_55744_73713_74546
Length 277
Sequence MVREAGVDPGGAEIGYDPVEPYRNYHPSKWCNQDRDEMSALICQRILLKLSGEALMGDGDFGIDPGVLRRVAEEIRDLVDAGVQIGIVIGGGNIFRGAGLAQGGLDRVRGDQMGMLATVMNSLAMQDMLTRIGVGSDVYSALSMPDVCEAFTVRAARHCLAEGRVAILAAGTGNPYFTTDSAASLRAVEIKADLLIKATKVNGVYSADPVKDPQAVFYSRLTYDRALAENLQVMDATAIVLCRDNGMPLRIMNINDPGALMRLMHGEAIGSLVEKGD

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
3 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
4 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
15 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
16 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
17 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
18 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
19 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
20 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
21 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
22 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
23 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
24 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
25 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
26 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
27 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
34 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
35 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
36 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
37 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
38 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
39 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
40 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
41 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
42 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
43 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
44 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
45 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
46 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
47 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
48 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
49 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
50 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
51 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
52 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
53 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
54 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
55 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
56 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
57 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
58 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
59 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
60 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
61 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
62 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
63 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
64 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
65 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
66 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
67 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
68 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
69 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
70 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
71 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
72 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
73 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
74 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
75 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
76 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
77 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
78 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
79 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
80 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
81 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
82 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
83 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
84 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
85 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
86 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
87 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
88 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
89 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
90 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
99 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
100 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
101 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
102 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
103 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
105 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
106 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
107 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
108 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.17
Metatranscriptomes 22.43
Isolates 1.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.47
Nodule 0
Rhizoplane 1.87
Rhizosphere 78.5
Stem 0
Stem Tuber 0
Unclassified 19.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1016030 3300001904 Bacteria 1197
2 JGI24740J21852_10007013 3300001979 Bacteria 4620
3 Ga0070658_10000008 3300005327 Bacteria 319912
4 Ga0070683_100075968 3300005329 Bacteria 3140
5 Ga0070680_100055588 3300005336 Bacteria 3235
6 Ga0070674_100126575 3300005356 Bacteria 1899
7 Ga0068867_100101141 3300005459 Bacteria 2202
8 Ga0070699_100387750 3300005518 Bacteria 1262
9 Ga0070679_100136501 3300005530 Bacteria 2433
10 Ga0068855_100032146 3300005563 Bacteria 6265
11 Ga0068866_10024774 3300005718 Bacteria 2813
12 Ga0075428_100417445 3300006844 Bacteria 1438
13 Ga0075430_100138184 3300006846 Bacteria 2029
14 Ga0075436_100033858 3300006914 Bacteria 3521
15 Ga0105240_10025649 3300009093 Bacteria 7742
16 Ga0105240_10059252 3300009093 Bacteria 4779
17 Ga0105241_10028441 3300009174 Bacteria 4167
18 Ga0105237_10118641 3300009545 Bacteria 2639
19 Ga0099796_10077679 3300010159 Bacteria 1211
20 Ga0157370_10249210 3300013104 Bacteria 1643
21 Ga0157369_10029001 3300013105 Bacteria 6119
22 Ga0157378_10009314 3300013297 Bacteria 8553
23 Ga0157372_10659567 3300013307 Bacteria 1218
24 Ga0213872_10048977 3300021361 Bacteria 1920
25 Ga0207695_10065887 3300025913 Bacteria 3722
26 Ga0207695_10102042 3300025913 Bacteria 2862
27 Ga0207664_10091768 3300025929 Bacteria 2492
28 Ga0207669_10056509 3300025937 Bacteria 2384
29 Ga0207667_10030157 3300025949 Bacteria 5869
30 Ga0207667_10322570 3300025949 Bacteria 1577
31 Ga0207640_10293419 3300025981 Bacteria 1283
32 Ga0207648_10009133 3300026089 Bacteria 9529
33 Ga0307515_10465829 3300028794 Bacteria 877
34 Ga0307408_100029217 3300031548 Bacteria 3817
35 Ga0316575_10007618 3300031665 Bacteria 3922
36 Ga0316575_10027860 3300031665 Bacteria 2199
37 Ga0316576_10018679 3300031727 Bacteria 4738
38 Ga0316576_10041797 3300031727 Bacteria 3302
39 Ga0316576_10044169 3300031727 Bacteria 3218
40 Ga0316576_10087369 3300031727 Bacteria 2320
41 Ga0316576_10204904 3300031727 Bacteria 1485
42 Ga0316578_10001009 3300031728 Bacteria 10775
43 Ga0316578_10002446 3300031728 Bacteria 8151
44 Ga0316578_10004591 3300031728 Bacteria 6543
45 Ga0316578_10007695 3300031728 Bacteria 5427
46 Ga0316578_10011061 3300031728 Bacteria 4705
47 Ga0307405_10151156 3300031731 Bacteria 1633
48 Ga0316577_10000665 3300031733 Bacteria 14376
49 Ga0316577_10002327 3300031733 Bacteria 9381
50 Ga0316577_10018285 3300031733 Bacteria 3875
51 Ga0307412_10379027 3300031911 Bacteria 1145
52 Ga0307409_100118238 3300031995 Bacteria 2238
53 Ga0307416_100393997 3300032002 Bacteria 1420
54 Ga0316583_10000163 3300032133 Bacteria 16443
55 Ga0316585_10000093 3300032137 Bacteria 15840
56 Ga0316585_10001923 3300032137 Bacteria 5549
57 Ga0316585_10014591 3300032137 Bacteria 2350
58 Ga0316580_10005545 3300032139 Bacteria 3689
59 Ga0316593_10000004 3300032168 Bacteria 21105
60 Ga0316593_10000190 3300032168 Bacteria 9414
61 Ga0316593_10000286 3300032168 Bacteria 8533
62 Ga0316593_10001295 3300032168 Bacteria 5440
63 Ga0316593_10001437 3300032168 Bacteria 5250
64 Ga0316593_10002122 3300032168 Bacteria 4612
65 Ga0316593_10002314 3300032168 Bacteria 4479
66 Ga0316593_10003091 3300032168 Bacteria 4072
67 Ga0316593_10003161 3300032168 Bacteria 4043
68 Ga0316593_10003409 3300032168 Bacteria 3940
69 Ga0316593_10005245 3300032168 Bacteria 3400
70 Ga0316593_10007552 3300032168 Bacteria 2991
71 Ga0316593_10007974 3300032168 Bacteria 2934
72 Ga0316593_10009523 3300032168 Bacteria 2747
73 Ga0316593_10013663 3300032168 Bacteria 2408
74 Ga0316593_10026174 3300032168 Bacteria 1863
75 Ga0316593_10032518 3300032168 Bacteria 1704
76 Ga0316593_10053268 3300032168 Bacteria 1371
77 Ga0316592_1000306 3300033524 Bacteria 6306
78 Ga0316592_1000357 3300033524 Bacteria 6031
79 Ga0316592_1000364 3300033524 Bacteria 6002
80 Ga0316592_1000683 3300033524 Bacteria 4980
81 Ga0316592_1001028 3300033524 Bacteria 4333
82 Ga0316586_1000183 3300033527 Bacteria 5252
83 Ga0316586_1000241 3300033527 Bacteria 4745
84 Ga0316586_1000378 3300033527 Bacteria 4208
85 Ga0316586_1001213 3300033527 Bacteria 2865
86 Ga0316588_1000027 3300033528 Bacteria 10874
87 Ga0316588_1002938 3300033528 Bacteria 3036
88 Ga0316588_1015552 3300033528 Bacteria 1677
89 Ga0316588_1018322 3300033528 Bacteria 1567
90 Ga0316588_1030108 3300033528 Bacteria 1271
91 Ga0316587_1000154 3300033529 Bacteria 5590
92 Ga0316587_1000249 3300033529 Bacteria 4841
93 Ga0316587_1000417 3300033529 Bacteria 4199
94 Ga0316587_1001120 3300033529 Bacteria 3163
95 Ga0316587_1002363 3300033529 Bacteria 2507
96 Ga0316587_1019345 3300033529 Bacteria 1151
97 Ga0316596_1000202 3300033541 Bacteria 8784
98 Ga0316596_1000313 3300033541 Bacteria 7790
99 Ga0316596_1000893 3300033541 Bacteria 5629
100 Ga0316596_1001651 3300033541 Bacteria 4591
101 Ga0316596_1002389 3300033541 Bacteria 4000
102 Ga0316596_1003469 3300033541 Bacteria 3461
103 Ga0316596_1004163 3300033541 Bacteria 3221
104 Ga0316596_1006177 3300033541 Bacteria 2775
105 Ga0316596_1031630 3300033541 Bacteria 1375
106 Ga0316596_1041396 3300033541 Bacteria 1211
107 Ga0373934_0088251 3300035086 Bacteria 1249
108 Ga0316574_0006915 3300035398 Bacteria 6175
109 Ga0316574_0014654 3300035398 Bacteria 4535
110 Ga0316574_0016752 3300035398 Bacteria 4276
111 Ga0316574_0022647 3300035398 Bacteria 3744
112 Ga0316574_0076595 3300035398 Bacteria 2119
113 Ga0316574_0089447 3300035398 Bacteria 1961
114 Ga0316574_0109131 3300035398 Bacteria 1773
115 Ga0316574_0138548 3300035398 Bacteria 1567
116 Ga0316574_0230471 3300035398 Bacteria 1185
117 Ga0316574_0338971 3300035398 Bacteria 953
118 Ga0373933_0164704 3300035724 Bacteria 1409
119 Ga0373937_0016107 3300036401 Bacteria 6632
120 Ga0316582_0001475 3300036647 Bacteria 10362
121 Ga0316582_0008784 3300036647 Bacteria 5447
122 Ga0316582_0008791 3300036647 Bacteria 5444
123 Ga0316582_0009692 3300036647 Bacteria 5239
124 Ga0316582_0016405 3300036647 Bacteria 4258
125 Ga0316582_0214496 3300036647 Bacteria 1315
126 Ga0316584_0001895 3300036712 Bacteria 13003
127 Ga0316584_0003199 3300036712 Bacteria 10599
128 Ga0316584_0016490 3300036712 Bacteria 5295
129 Ga0316584_0020680 3300036712 Bacteria 4775
130 Ga0316584_0020850 3300036712 Bacteria 4759
131 Ga0316584_0021423 3300036712 Bacteria 4697
132 Ga0316584_0157019 3300036712 Bacteria 1691
133 Ga0395900_0057106 3300037418 Bacteria 4018
134 Ga0400484_12544 3300038725 Bacteria 3652
135 Ga0400484_43627 3300038725 Bacteria 12060
136 Ga0400490_17851 3300038726 Bacteria 80099
137 Ga0400490_27081 3300038726 Bacteria 3564
138 Ga0400490_29153 3300038726 Bacteria 26709
139 Ga0400490_55744 3300038726 Bacteria 86921
140 Ga0400491_00300 3300038727 Bacteria 3484
141 Ga0400491_05008 3300038727 Bacteria 4683
142 Ga0400485_02127 3300038735 Bacteria 1855
143 Ga0400485_11431 3300038735 Bacteria 142174
144 Ga0400488_05280 3300038741 Bacteria 1962
145 Ga0400488_25962 3300038741 Bacteria 1609
146 Ga0400488_33004 3300038741 Bacteria 10792
147 Ga0400488_45939 3300038741 Bacteria 2377
148 Ga0400486_14851 3300038742 Bacteria 63108
149 Ga0400486_18012 3300038742 Bacteria 99609
150 Ga0400486_27665 3300038742 Bacteria 3890
151 Ga0400483_053742 3300039062 Bacteria 1025
152 Ga0400483_094390 3300039062 Bacteria 5771
153 Ga0400483_108094 3300039062 Bacteria 15316
154 Ga0400483_121666 3300039062 Bacteria 18159
155 Ga0400483_156207 3300039062 Bacteria 6820
156 Ga0400483_179710 3300039062 Bacteria 3419
157 Ga0400483_192031 3300039062 Bacteria 23073
158 Ga0400483_199751 3300039062 Bacteria 3481
159 Ga0400483_241642 3300039062 Bacteria 19322
160 Ga0400483_261563 3300039062 Bacteria 5905
161 Ga0400483_265980 3300039062 Bacteria 1352
162 Ga0400487_01399 3300039110 Bacteria 1472
163 Ga0400487_12605 3300039110 Bacteria 1723
164 Ga0400487_14076 3300039110 Bacteria 135338
165 Ga0400487_21307 3300039110 Bacteria 8144
166 Ga0400487_36315 3300039110 Bacteria 3714
167 Ga0400487_39014 3300039110 Bacteria 12775
168 Ga0400487_54961 3300039110 Bacteria 48611
169 Ga0436360_1163113 3300039438 Bacteria 8239
170 Ga0436361_0933239 3300039447 Bacteria 822
171 Ga0436363_1642796 3300039450 Bacteria 14852
172 Ga0451855_0659034 3300041511 Bacteria 2427
173 Ga0439455_0029771 3300042012 Bacteria 1351
174 Ga0451577_0060824 3300042876 Bacteria 3367
175 Ga0466969_0000561 3300044656 Bacteria 20372
176 Ga0466966_0001572 3300044684 Bacteria 14664
177 Ga0466961_0000806 3300044693 Bacteria 19537
178 Ga0466964_0007340 3300044706 Bacteria 4121
179 Ga0453684_0163458 3300044712 Bacteria 2630
180 Ga0466971_0008239 3300044719 Bacteria 4547
181 Ga0466968_0139898 3300044735 Bacteria 1106
182 Ga0466970_0000141 3300044765 Bacteria 33348
183 Ga0466959_0006624 3300045049 Bacteria 8043
184 Ga0451576_0144074 3300045051 Bacteria 2484
185 Ga0466958_0040185 3300045836 Bacteria 2811
186 Ga0495623_0115131 3300046679 Bacteria 1625
187 Ga0495675_0302218 3300047444 Bacteria 950
188 Ga0496102_0021186 3300048905 Bacteria 5748
189 Ga0496103_0169109 3300048906 Bacteria 1403
190 Ga0496104_0481934 3300048907 Bacteria 1152
191 Ga0496118_0048388 3300048921 Bacteria 3285
192 Ga0501033_0019388 3300049570 Bacteria 5143
193 Ga0501034_0001323 3300049571 Bacteria 33486
194 Ga0501036_0037607 3300049572 Bacteria 4094
195 Ga0501037_0003162 3300049573 Bacteria 11959
196 Ga0501038_0290383 3300049574 Bacteria 1285
197 Ga0501039_0248064 3300049575 Bacteria 1400
198 Ga0501043_0018874 3300049579 Bacteria 5412
199 Ga0501046_0377550 3300049580 Bacteria 1026
200 Ga0501067_0206555 3300049583 Bacteria 1094
201 Ga0501071_0437385 3300049587 Bacteria 1001
202 Ga0501073_0496919 3300049589 Bacteria 843
203 Ga0501080_0001047 3300049742 Bacteria 22739
204 Ga0501080_0231737 3300049742 Bacteria 1688
205 Ga0501083_0162941 3300049744 Bacteria 1458
206 Ga0501035_0156725 3300049822 Bacteria 1973
207 Ga0501044_0018581 3300049823 Bacteria 7448
208 nmdc:mga0qj67_116317_c1 3300050509 Bacteria 2161
209 nmdc:mga0rr50_74882_c1 3300050513 Bacteria 2593
210 nmdc:mga08x19_35130_c1 3300050514 Bacteria 3170
211 Ga0500636_0148497 3300053177 Bacteria 1290

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006914 Ga0075436_100033858 Ga0075436_1000338583 211
2 3300039450 Ga0436363_1642796 Ga0436363_1642796_8004_8720 211
3 3300050513 nmdc:mga0rr50_74882_c1 nmdc:mga0rr50_74882_c1_1209_1925 211
4 3300050514 nmdc:mga08x19_35130_c1 nmdc:mga08x19_35130_c1_987_1703 211
5 3300005336 Ga0070680_100055588 Ga0070680_1000555882 212
6 3300005530 Ga0070679_100136501 Ga0070679_1001365013 212
7 3300009093 Ga0105240_10025649 Ga0105240_100256494 212
8 3300010159 Ga0099796_10077679 Ga0099796_100776791 212
9 3300013307 Ga0157372_10659567 Ga0157372_106595672 212
10 3300021361 Ga0213872_10048977 Ga0213872_100489772 212
11 3300025913 Ga0207695_10102042 Ga0207695_101020421 212
12 3300035086 Ga0373934_0088251 Ga0373934_0088251_194_919 212
13 3300035724 Ga0373933_0164704 Ga0373933_0164704_296_1021 212
14 3300036401 Ga0373937_0016107 Ga0373937_0016107_3560_4285 212
15 3300037418 Ga0395900_0057106 Ga0395900_0057106_432_1169 212
16 3300039438 Ga0436360_1163113 Ga0436360_1163113_4190_4915 212
17 3300039447 Ga0436361_0933239 Ga0436361_0933239_22_747 212
18 3300044656 Ga0466969_0000561 Ga0466969_0000561_13881_14609 212
19 3300044684 Ga0466966_0001572 Ga0466966_0001572_12324_13052 212
20 3300044693 Ga0466961_0000806 Ga0466961_0000806_3949_4677 212
21 3300044706 Ga0466964_0007340 Ga0466964_0007340_1678_2406 212
22 3300044719 Ga0466971_0008239 Ga0466971_0008239_1574_2302 212
23 3300044735 Ga0466968_0139898 Ga0466968_0139898_99_827 212
24 3300044765 Ga0466970_0000141 Ga0466970_0000141_8457_9185 212
25 3300045049 Ga0466959_0006624 Ga0466959_0006624_4086_4814 212
26 3300045836 Ga0466958_0040185 Ga0466958_0040185_625_1353 212
27 3300046679 Ga0495623_0115131 Ga0495623_0115131_592_1317 212
28 3300047444 Ga0495675_0302218 Ga0495675_0302218_166_891 212
29 3300048905 Ga0496102_0021186 Ga0496102_0021186_3242_3967 212
30 3300048906 Ga0496103_0169109 Ga0496103_0169109_505_1230 212
31 3300048921 Ga0496118_0048388 Ga0496118_0048388_232_957 212
32 3300053177 Ga0500636_0148497 Ga0500636_0148497_52_768 212
33 3300025949 Ga0207667_10322570 Ga0207667_103225701 214
34 3300005563 Ga0068855_100032146 Ga0068855_1000321465 216
35 3300009093 Ga0105240_10059252 Ga0105240_100592523 216
36 3300013104 Ga0157370_10249210 Ga0157370_102492102 216
37 3300013105 Ga0157369_10029001 Ga0157369_100290015 216
38 3300025913 Ga0207695_10065887 Ga0207695_100658873 216
39 3300025929 Ga0207664_10091768 Ga0207664_100917682 216
40 3300025949 Ga0207667_10030157 Ga0207667_100301575 216
41 3300038726 Ga0400490_27081 Ga0400490_27081_1951_2673 216
42 3300038727 Ga0400491_05008 Ga0400491_05008_3128_3850 216
43 3300031665 Ga0316575_10007618 Ga0316575_100076183 219
44 3300031728 Ga0316578_10011061 Ga0316578_100110615 219
45 3300032168 Ga0316593_10000190 Ga0316593_100001903 219
46 3300032168 Ga0316593_10001437 Ga0316593_100014373 219
47 3300032168 Ga0316593_10002122 Ga0316593_100021224 219
48 3300032168 Ga0316593_10005245 Ga0316593_100052453 219
49 3300032168 Ga0316593_10007974 Ga0316593_100079742 219
50 3300032168 Ga0316593_10013663 Ga0316593_100136632 219
51 3300033528 Ga0316588_1015552 Ga0316588_10155522 219
52 3300033529 Ga0316587_1001120 Ga0316587_10011202 219
53 3300033541 Ga0316596_1031630 Ga0316596_10316302 219
54 3300033541 Ga0316596_1041396 Ga0316596_10413962 219
55 3300035398 Ga0316574_0076595 Ga0316574_0076595_1221_1943 219
56 3300038741 Ga0400488_05280 Ga0400488_05280_16_684 219
57 3300009174 Ga0105241_10028441 Ga0105241_100284414 224
58 3300031727 Ga0316576_10087369 Ga0316576_100873692 225
59 3300036712 Ga0316584_0020680 Ga0316584_0020680_334_1056 225
60 3300031548 Ga0307408_100029217 Ga0307408_1000292173 226
61 3300032002 Ga0307416_100393997 Ga0307416_1003939972 226
62 3300041511 Ga0451855_0659034 Ga0451855_0659034_531_1238 227
63 3300049587 Ga0501071_0437385 Ga0501071_0437385_34_723 228
64 iso_pu_bacteria 2599185184 2599479465 230
65 iso_pu_bacteria 2928078545 2928082229 230
66 iso_pu_bacteria 2928147474 2928149195 230
67 3300006846 Ga0075430_100138184 Ga0075430_1001381842 231
68 3300050509 nmdc:mga0qj67_116317_c1 nmdc:mga0qj67_116317_c1_1099_1815 231
69 3300005356 Ga0070674_100126575 Ga0070674_1001265752 232
70 3300005459 Ga0068867_100101141 Ga0068867_1001011412 232
71 3300005518 Ga0070699_100387750 Ga0070699_1003877501 232
72 3300005718 Ga0068866_10024774 Ga0068866_100247744 232
73 3300013297 Ga0157378_10009314 Ga0157378_100093149 232
74 3300025937 Ga0207669_10056509 Ga0207669_100565093 232
75 3300026089 Ga0207648_10009133 Ga0207648_100091334 232
76 3300031727 Ga0316576_10041797 Ga0316576_100417974 232
77 3300031727 Ga0316576_10044169 Ga0316576_100441692 232
78 3300031727 Ga0316576_10204904 Ga0316576_102049042 232
79 3300031728 Ga0316578_10002446 Ga0316578_100024462 232
80 3300031728 Ga0316578_10004591 Ga0316578_100045913 232
81 3300031728 Ga0316578_10007695 Ga0316578_100076953 232
82 3300031733 Ga0316577_10018285 Ga0316577_100182853 232
83 3300032133 Ga0316583_10000163 Ga0316583_100001639 232
84 3300032137 Ga0316585_10001923 Ga0316585_100019235 232
85 3300032137 Ga0316585_10014591 Ga0316585_100145913 232
86 3300032168 Ga0316593_10000286 Ga0316593_100002867 232
87 3300032168 Ga0316593_10003409 Ga0316593_100034092 232
88 3300032168 Ga0316593_10009523 Ga0316593_100095231 232
89 3300032168 Ga0316593_10026174 Ga0316593_100261742 232
90 3300032168 Ga0316593_10032518 Ga0316593_100325182 232
91 3300032168 Ga0316593_10053268 Ga0316593_100532681 232
92 3300033524 Ga0316592_1000357 Ga0316592_10003575 232
93 3300033524 Ga0316592_1000683 Ga0316592_10006834 232
94 3300033524 Ga0316592_1001028 Ga0316592_10010284 232
95 3300033527 Ga0316586_1000241 Ga0316586_10002414 232
96 3300033527 Ga0316586_1000378 Ga0316586_10003783 232
97 3300033527 Ga0316586_1001213 Ga0316586_10012133 232
98 3300033528 Ga0316588_1000027 Ga0316588_10000277 232
99 3300033528 Ga0316588_1002938 Ga0316588_10029383 232
100 3300033528 Ga0316588_1018322 Ga0316588_10183221 232
101 3300033528 Ga0316588_1030108 Ga0316588_10301082 232
102 3300033529 Ga0316587_1000154 Ga0316587_10001545 232
103 3300033529 Ga0316587_1000417 Ga0316587_10004173 232
104 3300033529 Ga0316587_1002363 Ga0316587_10023633 232
105 3300033529 Ga0316587_1019345 Ga0316587_10193452 232
106 3300033541 Ga0316596_1000893 Ga0316596_10008935 232
107 3300033541 Ga0316596_1001651 Ga0316596_10016515 232
108 3300033541 Ga0316596_1006177 Ga0316596_10061773 232
109 3300035398 Ga0316574_0089447 Ga0316574_0089447_365_1093 232
110 3300035398 Ga0316574_0230471 Ga0316574_0230471_20_745 232
111 3300036647 Ga0316582_0001475 Ga0316582_0001475_3975_4700 232
112 3300036712 Ga0316584_0016490 Ga0316584_0016490_3737_4465 232
113 3300036712 Ga0316584_0021423 Ga0316584_0021423_3459_4184 232
114 3300031665 Ga0316575_10027860 Ga0316575_100278601 233
115 3300032168 Ga0316593_10003091 Ga0316593_100030912 233
116 3300033524 Ga0316592_1000306 Ga0316592_10003064 233
117 3300033527 Ga0316586_1000183 Ga0316586_10001833 233
118 3300033529 Ga0316587_1000249 Ga0316587_10002494 233
119 3300033541 Ga0316596_1000313 Ga0316596_10003136 233
120 3300038725 Ga0400484_12544 Ga0400484_12544_1321_2043 233
121 3300038725 Ga0400484_43627 Ga0400484_43627_9693_10415 233
122 3300038726 Ga0400490_17851 Ga0400490_17851_9297_10019 233
123 3300038726 Ga0400490_29153 Ga0400490_29153_5913_6635 233
124 3300038726 Ga0400490_55744 Ga0400490_55744_73713_74546 233
125 3300038727 Ga0400491_00300 Ga0400491_00300_1048_1770 233
126 3300038735 Ga0400485_11431 Ga0400485_11431_87846_88580 233
127 3300038741 Ga0400488_25962 Ga0400488_25962_464_1186 233
128 3300038741 Ga0400488_33004 Ga0400488_33004_415_1137 233
129 3300038742 Ga0400486_14851 Ga0400486_14851_13267_13995 233
130 3300038742 Ga0400486_18012 Ga0400486_18012_53636_54370 233
131 3300038742 Ga0400486_27665 Ga0400486_27665_1869_2591 233
132 3300039062 Ga0400483_053742 Ga0400483_053742_267_989 233
133 3300039062 Ga0400483_094390 Ga0400483_094390_4198_4920 233
134 3300039062 Ga0400483_121666 Ga0400483_121666_8123_8848 233
135 3300039062 Ga0400483_156207 Ga0400483_156207_1648_2370 233
136 3300039062 Ga0400483_179710 Ga0400483_179710_299_1021 233
137 3300039062 Ga0400483_192031 Ga0400483_192031_6186_6908 233
138 3300039062 Ga0400483_199751 Ga0400483_199751_916_1638 233
139 3300039062 Ga0400483_241642 Ga0400483_241642_4938_5660 233
140 3300039062 Ga0400483_265980 Ga0400483_265980_209_931 233
141 3300039110 Ga0400487_12605 Ga0400487_12605_988_1710 233
142 3300039110 Ga0400487_14076 Ga0400487_14076_25808_26557 233
143 3300039110 Ga0400487_21307 Ga0400487_21307_4086_4817 233
144 3300039110 Ga0400487_36315 Ga0400487_36315_1678_2406 233
145 3300039110 Ga0400487_39014 Ga0400487_39014_2565_3299 233
146 3300039110 Ga0400487_54961 Ga0400487_54961_15386_16108 233
147 3300001904 JGI24736J21556_1016030 JGI24736J21556_10160302 234
148 3300001979 JGI24740J21852_10007013 JGI24740J21852_100070132 234
149 3300005327 Ga0070658_10000008 Ga0070658_1000000892 234
150 3300005329 Ga0070683_100075968 Ga0070683_1000759683 234
151 3300006844 Ga0075428_100417445 Ga0075428_1004174452 234
152 3300009545 Ga0105237_10118641 Ga0105237_101186413 234
153 3300025981 Ga0207640_10293419 Ga0207640_102934192 234
154 3300028794 Ga0307515_10465829 Ga0307515_104658291 234
155 3300031727 Ga0316576_10018679 Ga0316576_100186792 234
156 3300031728 Ga0316578_10001009 Ga0316578_100010095 234
157 3300031731 Ga0307405_10151156 Ga0307405_101511562 234
158 3300031733 Ga0316577_10000665 Ga0316577_100006656 234
159 3300031733 Ga0316577_10002327 Ga0316577_100023277 234
160 3300031911 Ga0307412_10379027 Ga0307412_103790272 234
161 3300031995 Ga0307409_100118238 Ga0307409_1001182382 234
162 3300032137 Ga0316585_10000093 Ga0316585_1000009313 234
163 3300032139 Ga0316580_10005545 Ga0316580_100055452 234
164 3300032168 Ga0316593_10000004 Ga0316593_1000000414 234
165 3300032168 Ga0316593_10001295 Ga0316593_100012952 234
166 3300032168 Ga0316593_10002314 Ga0316593_100023144 234
167 3300032168 Ga0316593_10003161 Ga0316593_100031613 234
168 3300032168 Ga0316593_10007552 Ga0316593_100075522 234
169 3300033524 Ga0316592_1000364 Ga0316592_10003647 234
170 3300033541 Ga0316596_1000202 Ga0316596_10002023 234
171 3300033541 Ga0316596_1002389 Ga0316596_10023893 234
172 3300033541 Ga0316596_1003469 Ga0316596_10034693 234
173 3300033541 Ga0316596_1004163 Ga0316596_10041633 234
174 3300035398 Ga0316574_0006915 Ga0316574_0006915_4874_5596 234
175 3300035398 Ga0316574_0014654 Ga0316574_0014654_3703_4446 234
176 3300035398 Ga0316574_0016752 Ga0316574_0016752_3345_4067 234
177 3300035398 Ga0316574_0022647 Ga0316574_0022647_466_1182 234
178 3300035398 Ga0316574_0109131 Ga0316574_0109131_1015_1746 234
179 3300035398 Ga0316574_0138548 Ga0316574_0138548_226_969 234
180 3300035398 Ga0316574_0338971 Ga0316574_0338971_118_861 234
181 3300036647 Ga0316582_0008784 Ga0316582_0008784_1427_2149 234
182 3300036647 Ga0316582_0008791 Ga0316582_0008791_906_1622 234
183 3300036647 Ga0316582_0009692 Ga0316582_0009692_2976_3698 234
184 3300036647 Ga0316582_0016405 Ga0316582_0016405_3095_3844 234
185 3300036647 Ga0316582_0214496 Ga0316582_0214496_515_1255 234
186 3300036712 Ga0316584_0001895 Ga0316584_0001895_11911_12627 234
187 3300036712 Ga0316584_0003199 Ga0316584_0003199_5693_6463 234
188 3300036712 Ga0316584_0020850 Ga0316584_0020850_596_1318 234
189 3300036712 Ga0316584_0157019 Ga0316584_0157019_589_1320 234
190 3300038735 Ga0400485_02127 Ga0400485_02127_431_1150 234
191 3300038741 Ga0400488_45939 Ga0400488_45939_792_1511 234
192 3300039062 Ga0400483_108094 Ga0400483_108094_10338_11057 234
193 3300039062 Ga0400483_261563 Ga0400483_261563_4451_5170 234
194 3300039110 Ga0400487_01399 Ga0400487_01399_14_733 234
195 3300042012 Ga0439455_0029771 Ga0439455_0029771_469_1194 234
196 3300042876 Ga0451577_0060824 Ga0451577_0060824_117_848 234
197 3300044712 Ga0453684_0163458 Ga0453684_0163458_1215_1946 234
198 3300045051 Ga0451576_0144074 Ga0451576_0144074_132_863 234
199 3300048907 Ga0496104_0481934 Ga0496104_0481934_194_988 234
200 3300049570 Ga0501033_0019388 Ga0501033_0019388_3844_4575 234
201 3300049571 Ga0501034_0001323 Ga0501034_0001323_20914_21645 234
202 3300049572 Ga0501036_0037607 Ga0501036_0037607_1429_2160 234
203 3300049573 Ga0501037_0003162 Ga0501037_0003162_7622_8353 234
204 3300049574 Ga0501038_0290383 Ga0501038_0290383_193_924 234
205 3300049575 Ga0501039_0248064 Ga0501039_0248064_341_1072 234
206 3300049579 Ga0501043_0018874 Ga0501043_0018874_3732_4463 234
207 3300049580 Ga0501046_0377550 Ga0501046_0377550_147_869 234
208 3300049583 Ga0501067_0206555 Ga0501067_0206555_117_848 234
209 3300049589 Ga0501073_0496919 Ga0501073_0496919_65_796 234
210 3300049742 Ga0501080_0001047 Ga0501080_0001047_12185_12916 234
211 3300049742 Ga0501080_0231737 Ga0501080_0231737_866_1603 234
212 3300049744 Ga0501083_0162941 Ga0501083_0162941_387_1118 234
213 3300049822 Ga0501035_0156725 Ga0501035_0156725_1072_1803 234
214 3300049823 Ga0501044_0018581 Ga0501044_0018581_821_1552 234

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00696

AA_kinase

Amino acid kinase family

44

253

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bne-assembly1.cif.gz_A the structure of e. coli ump kinase in complex with ump 0.991 3 233
2bnf-assembly1.cif.gz_A the structure of e. coli ump kinase in complex with utp 0.9909 3 233
2bnd-assembly1.cif.gz_A the structure of e. coli ump kinase in complex with udp 0.9909 3 233
4a7x-assembly2.cif.gz_C crystal structure of uridylate kinase from helicobacter pylori 0.9861 4 234
7bes-assembly1.cif.gz_C-2 cryoem structure of mycobacterium tuberculosis ump kinase (umpk) in complex with udp and utp 0.9854 3 159
ID Description Score Start End Superfamily
af_P9WHK5_22_261_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.984 3 233 3.40.1160.10
af_A0A1D6G3Z5_82_358_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9735 2 233 3.40.1160.10
2jjxC00 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9694 1 234 3.40.1160.10
2jjxC00 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9654 1 234 3.40.1160.10
3ek5B00 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9645 3 234 3.40.1160.10
ID Description Score Start End GO Terms
AF-A0A2D8KIG7-F1-model_v4 UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) 0.9996 1 142 GO:0005524
GO:0006225
GO:0033862
AF-A0A1T5EKT0-F1-model_v4 Uridylate kinase (UK) (EC 2.7.4.22) (Uridine monophosphate kinase) (UMP kinase) (UMPK) 0.9986 1 234 GO:0005524
GO:0005737
GO:0006225
GO:0033862
GO:0044210
AF-A0A0Q4FVR5-F1-model_v4 Uridylate kinase (UK) (EC 2.7.4.22) (Uridine monophosphate kinase) (UMP kinase) (UMPK) 0.9982 1 234 GO:0005524
GO:0005737
GO:0006225
GO:0033862
GO:0044210
AF-A0A1H7TQT3-F1-model_v4 Uridylate kinase (UK) (EC 2.7.4.22) (Uridine monophosphate kinase) (UMP kinase) (UMPK) 0.9977 1 234 GO:0005524
GO:0005737
GO:0006225
GO:0033862
GO:0044210
AF-A0A4R1IWS2-F1-model_v4 deleted 0.9977 1 234

Feature Viewer

pLDDT pTM Quality
93.06 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map