F324833

General Info

Members Datasets Scaffolds Average Seq Length
214 133 428 238

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10030807|Ga0070666_100308075
Length 243
Sequence MIERHLMKLRARDEISPEEEAAIRASVSGTRRVPADQLVARAYERLDACTFLLSGFACRAKDLEDGRRQITELHTPGDYVDLHSFTLKYLEHNVLALSDCELAVVPHAALRKITEQLPHLTRVYWFATCLDAAIHREWELSLGRRSAVERMAHLFCELQVRMGLVDLVDREGEAVAYQLSLTQAELAECLGLTSVHVNRTLMQLREERLLEFRSGRVTIHDLPGLRAMAGFDPAYLYLDREPR

Samples

Sample ID Description Type Environment
1 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
86 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
89 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
90 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
97 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
98 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
99 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
100 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
101 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
104 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
105 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
106 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
107 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
108 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
109 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
110 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
111 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
112 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
113 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
114 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
115 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
116 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
117 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
118 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
119 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
120 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
121 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
122 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
123 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
124 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
125 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
126 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
127 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
128 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
129 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
130 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
131 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
132 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
133 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.73
Metatranscriptomes 0.47
Isolates 2.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.14
Nodule 1.4
Rhizoplane 5.14
Rhizosphere 83.18
Stem 0
Stem Tuber 0
Unclassified 13.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070666_10030807 3300005335 Bacteria 3537
2 JGI24738J21930_10026685 3300002075 Bacteria 1185
3 Ga0070658_10024702 3300005327 Bacteria 4818
4 Ga0070658_10066686 3300005327 Bacteria 2940
5 Ga0070658_10289475 3300005327 Bacteria 1395
6 Ga0070676_10199549 3300005328 Bacteria 1311
7 Ga0070683_100012475 3300005329 Bacteria 7385
8 Ga0070683_100665834 3300005329 Bacteria 997
9 Ga0070670_100010498 3300005331 Bacteria 7906
10 Ga0070680_100018322 3300005336 Bacteria 5531
11 Ga0070689_100298302 3300005340 Bacteria 1341
12 Ga0070689_100353296 3300005340 Bacteria 1233
13 Ga0070661_100079960 3300005344 Bacteria 2412
14 Ga0070661_100200757 3300005344 Bacteria 1524
15 Ga0070692_10057072 3300005345 Bacteria 2046
16 Ga0070675_100054640 3300005354 Bacteria 3286
17 Ga0070671_100001217 3300005355 Bacteria 19279
18 Ga0070671_100012814 3300005355 Bacteria 6761
19 Ga0070671_100111829 3300005355 Bacteria 2294
20 Ga0070673_100310409 3300005364 Bacteria 1391
21 Ga0070659_100012429 3300005366 Bacteria 6314
22 Ga0070659_100328262 3300005366 Unclassified 1280
23 Ga0070659_100481856 3300005366 Bacteria 1056
24 Ga0070667_100018847 3300005367 Bacteria 5723
25 Ga0070678_100099586 3300005456 Bacteria 2249
26 Ga0070662_100005722 3300005457 Bacteria 7963
27 Ga0070679_100254798 3300005530 Bacteria 1710
28 Ga0070684_100085858 3300005535 Bacteria 2791
29 Ga0068853_100017103 3300005539 Bacteria 5981
30 Ga0070672_100036843 3300005543 Bacteria 3729
31 Ga0070672_100304791 3300005543 Bacteria 1351
32 Ga0068855_100211906 3300005563 Bacteria 2176
33 Ga0068855_100237720 3300005563 Bacteria 2037
34 Ga0070664_100159162 3300005564 Unclassified 1997
35 Ga0070664_100781894 3300005564 Unclassified 892
36 Ga0068857_100162336 3300005577 Bacteria 2028
37 Ga0068856_100624352 3300005614 Unclassified 1098
38 Ga0068864_100026816 3300005618 Bacteria 4859
39 Ga0068864_100027303 3300005618 Bacteria 4820
40 Ga0068864_100117667 3300005618 Unclassified 2372
41 Ga0068864_100147904 3300005618 Bacteria 2125
42 Ga0068851_10122821 3300005834 Unclassified 1397
43 Ga0068863_100025597 3300005841 Bacteria 5626
44 Ga0068863_100029236 3300005841 Bacteria 5261
45 Ga0068858_100003328 3300005842 Bacteria 16003
46 Ga0068858_100676233 3300005842 Bacteria 1004
47 Ga0068860_100072849 3300005843 Bacteria 3265
48 Ga0068860_100117101 3300005843 Bacteria 2549
49 Ga0068860_100268568 3300005843 Unclassified 1664
50 Ga0068862_100313130 3300005844 Bacteria 1447
51 Ga0075368_10001227 3300006042 Bacteria 8104
52 Ga0075364_10002194 3300006051 Bacteria 10946
53 Ga0075362_10026078 3300006177 Bacteria 2494
54 Ga0075366_10001944 3300006195 Bacteria 10448
55 Ga0097621_100001916 3300006237 Bacteria 14215
56 Ga0097621_100397023 3300006237 Unclassified 1234
57 Ga0068871_100119769 3300006358 Bacteria 2222
58 Ga0068871_100135829 3300006358 Bacteria 2089
59 Ga0079104_1008877 3300006946 Bacteria 3457
60 Ga0079104_1017843 3300006946 Bacteria 2029
61 Ga0105243_10566188 3300009148 Unclassified 1088
62 Ga0105248_10033961 3300009177 Bacteria 5701
63 Ga0105248_10046753 3300009177 Bacteria 4852
64 Ga0105248_10258312 3300009177 Bacteria 1961
65 Ga0105237_10024822 3300009545 Bacteria 6133
66 Ga0157327_1002343 3300012512 Bacteria 1296
67 Ga0157370_10170177 3300013104 Bacteria 2025
68 Ga0163162_10143008 3300013306 Bacteria 2507
69 Ga0157375_10016248 3300013308 Bacteria 6677
70 Ga0157380_10251391 3300014326 Unclassified 1600
71 Ga0206353_11904113 3300020082 Bacteria 4019
72 Ga0213876_10077295 3300021384 Bacteria 1758
73 Ga0207680_10080684 3300025903 Unclassified 2043
74 Ga0207680_10161793 3300025903 Unclassified 1502
75 Ga0207647_10261478 3300025904 Bacteria 991
76 Ga0207705_10011620 3300025909 Bacteria 6363
77 Ga0207705_10029641 3300025909 Bacteria 3901
78 Ga0207705_10287184 3300025909 Unclassified 1260
79 Ga0207671_10016531 3300025914 Bacteria 5730
80 Ga0207662_10103923 3300025918 Bacteria 1763
81 Ga0207657_10038692 3300025919 Bacteria 4243
82 Ga0207657_10057912 3300025919 Bacteria 3337
83 Ga0207657_10378770 3300025919 Bacteria 1114
84 Ga0207649_10189942 3300025920 Bacteria 1444
85 Ga0207652_10232711 3300025921 Bacteria 1661
86 Ga0207681_10142234 3300025923 Unclassified 1788
87 Ga0207681_10239085 3300025923 Bacteria 1413
88 Ga0207681_10686818 3300025923 Bacteria 850
89 Ga0207659_10103253 3300025926 Unclassified 2154
90 Ga0207659_10168860 3300025926 Unclassified 1724
91 Ga0207659_10182798 3300025926 Bacteria 1662
92 Ga0207644_10032758 3300025931 Bacteria 3628
93 Ga0207644_10078708 3300025931 Bacteria 2430
94 Ga0207690_10029885 3300025932 Bacteria 3469
95 Ga0207706_10002707 3300025933 Bacteria 17263
96 Ga0207706_10124992 3300025933 Bacteria 2262
97 Ga0207670_10372340 3300025936 Bacteria 1136
98 Ga0207691_10000892 3300025940 Bacteria 29583
99 Ga0207711_10038956 3300025941 Bacteria 4042
100 Ga0207711_10163541 3300025941 Bacteria 2016
101 Ga0207679_10079004 3300025945 Bacteria 2508
102 Ga0207679_10253181 3300025945 Unclassified 1498
103 Ga0207651_10109291 3300025960 Bacteria 2071
104 Ga0207640_10179404 3300025981 Bacteria 1586
105 Ga0207703_10151546 3300026035 Bacteria 2022
106 Ga0207639_10033999 3300026041 Bacteria 3765
107 Ga0207678_10138114 3300026067 Bacteria 2080
108 Ga0207702_10265477 3300026078 Unclassified 1617
109 Ga0207702_10864467 3300026078 Bacteria 895
110 Ga0207641_10058067 3300026088 Bacteria 3292
111 Ga0207641_10133307 3300026088 Unclassified 2233
112 Ga0207676_10053293 3300026095 Bacteria 3166
113 Ga0207676_10180237 3300026095 Unclassified 1849
114 Ga0207676_10393275 3300026095 Bacteria 1293
115 Ga0207674_10074820 3300026116 Bacteria 3398
116 Ga0207683_10066010 3300026121 Plasmid 3190
117 Ga0207698_10051175 3300026142 Bacteria 3156
118 Ga0209281_1010546 3300027111 Bacteria 2109
119 Ga0268265_10169815 3300028380 Bacteria 1863
120 Ga0268264_10053926 3300028381 Bacteria 3356
121 Ga0307405_10069808 3300031731 Bacteria 2254
122 Ga0307405_10071010 3300031731 Bacteria 2239
123 Ga0307410_10070204 3300031852 Bacteria 2426
124 Ga0307412_10034405 3300031911 Bacteria 3229
125 Ga0307409_100163655 3300031995 Bacteria 1949
126 Ga0307409_100293630 3300031995 Bacteria 1508
127 Ga0307416_100505885 3300032002 Bacteria 1273
128 Ga0307414_10261682 3300032004 Bacteria 1444
129 Ga0307414_10343842 3300032004 Bacteria 1278
130 Ga0307411_10068483 3300032005 Bacteria 2393
131 Ga0307411_10468763 3300032005 Bacteria 1058
132 Ga0307411_10540590 3300032005 Bacteria 992
133 Ga0307411_10643471 3300032005 Unclassified 917
134 Ga0307415_100070092 3300032126 Bacteria 2461
135 Ga0373943_0004063 3300035170 Bacteria 6645
136 Ga0373947_0100138 3300035725 Bacteria 1820
137 Ga0395899_0000140 3300037312 Bacteria 109989
138 Ga0395899_0013813 3300037312 Bacteria 6172
139 Ga0395899_0102221 3300037312 Unclassified 2068
140 Ga0395900_0000075 3300037418 Bacteria 183525
141 Ga0395900_0031436 3300037418 Bacteria 5454
142 Ga0395900_0032873 3300037418 Bacteria 5336
143 Ga0395900_0056048 3300037418 Bacteria 4057
144 Ga0395900_0099128 3300037418 Bacteria 2994
145 Ga0395900_0692907 3300037418 Bacteria 953
146 Ga0395898_0000055 3300037466 Bacteria 278557
147 Ga0395898_0003591 3300037466 Bacteria 17291
148 Ga0395898_0071242 3300037466 Bacteria 3359
149 Ga0395898_0077070 3300037466 Bacteria 3218
150 Ga0395898_0339584 3300037466 Bacteria 1432
151 Ga0395905_0000089 3300037471 Bacteria 152196
152 Ga0395905_0013793 3300037471 Bacteria 7735
153 Ga0395905_0052732 3300037471 Bacteria 3807
154 Ga0395905_0078554 3300037471 Bacteria 3092
155 Ga0395905_0204014 3300037471 Bacteria 1853
156 Ga0395905_0331876 3300037471 Bacteria 1411
157 Ga0395905_0739500 3300037471 Unclassified 886
158 Ga0395905_0755438 3300037471 Bacteria 875
159 Ga0395901_0000885 3300038443 Bacteria 32947
160 Ga0395901_0013494 3300038443 Bacteria 8307
161 Ga0395901_0025952 3300038443 Bacteria 6016
162 Ga0395901_0106273 3300038443 Plasmid 2946
163 Ga0395901_0125582 3300038443 Bacteria 2696
164 Ga0395901_0424866 3300038443 Unclassified 1362
165 Ga0395901_0591718 3300038443 Bacteria 1120
166 Ga0436365_1911625 3300039437 Bacteria 11812
167 Ga0439448_0017664 3300042005 Unclassified 2180
168 Ga0439455_0003209 3300042012 Bacteria 3095
169 Ga0439458_0000309 3300042157 Bacteria 12140
170 Ga0466966_0141948 3300044684 Bacteria 1467
171 Ga0466961_0048848 3300044693 Bacteria 2705
172 Ga0466963_0024575 3300044694 Bacteria 3835
173 Ga0466957_0051603 3300044842 Bacteria 2503
174 Ga0466958_0107899 3300045836 Bacteria 1737
175 Ga0466967_0021202 3300045976 Bacteria 5270
176 Ga0466967_0358999 3300045976 Bacteria 1411
177 Ga0495686_0049689 3300047472 Bacteria 2638
178 Ga0495686_0101646 3300047472 Bacteria 1733
179 Ga0496107_0167406 3300048910 Bacteria 1630
180 Ga0496108_0240257 3300048911 Unclassified 1575
181 Ga0496109_0054494 3300048912 Bacteria 3648
182 Ga0496109_0322283 3300048912 Bacteria 1458
183 Ga0496109_0384559 3300048912 Bacteria 1326
184 Ga0496110_0885834 3300048913 Unclassified 798
185 Ga0496112_0006638 3300048915 Bacteria 10187
186 Ga0496112_0008002 3300048915 Bacteria 9431
187 Ga0496112_0029910 3300048915 Bacteria 5269
188 Ga0496113_0002894 3300048916 Bacteria 10108
189 Ga0496122_0194878 3300048925 Bacteria 1191
190 Ga0496123_0014970 3300048926 Bacteria 6394
191 Ga0496123_0029063 3300048926 Bacteria 4080
192 Ga0496124_0000175 3300048927 Bacteria 128785
193 Ga0496124_0001397 3300048927 Bacteria 36152
194 Ga0496124_0066447 3300048927 Bacteria 3003
195 Ga0496124_0108196 3300048927 Bacteria 2242
196 Ga0501067_0021133 3300049583 Bacteria 3602
197 Ga0501069_0047536 3300049585 Bacteria 2382
198 Ga0501224_007319 3300049664 Bacteria 1608
199 Ga0501044_0003922 3300049823 Bacteria 16679
200 nmdc:mga03683_38863_c1 3300050489 Bacteria 1946
201 nmdc:mga00v17_2640_c1 3300050491 Bacteria 9195
202 nmdc:mga0k408_17859_c1 3300050493 Bacteria 3954
203 nmdc:mga0n895_203138_c1 3300050512 Unclassified 2012
204 Ga0500646_0056154 3300053090 Bacteria 1148
205 Ga0500595_001907 3300053119 Bacteria 10749
206 Ga0500568_0022345 3300053139 Bacteria 2707
207 Ga0500588_0046923 3300053146 Bacteria 1330
208 Ga0501082_0258141 3300060353 Bacteria 1516
209 2600224957 2599185359 Bacteria 4772316
210 2819713201 2818991466 Bacteria 4748179
211 2879164838 2879163058 Bacteria 4223965
212 2885431050 2885429604 Bacteria 3642894
213 2928527742 2928526807 Bacteria 4760224
214 2928971625 2928968154 Bacteria 4633371
215 Ga0070666_10030807
216 JGI24738J21930_10026685
217 Ga0070658_10024702
218 Ga0070658_10066686
219 Ga0070658_10289475
220 Ga0070676_10199549
221 Ga0070683_100012475
222 Ga0070683_100665834
223 Ga0070670_100010498
224 Ga0070680_100018322
225 Ga0070689_100298302
226 Ga0070689_100353296
227 Ga0070661_100079960
228 Ga0070661_100200757
229 Ga0070692_10057072
230 Ga0070675_100054640
231 Ga0070671_100001217
232 Ga0070671_100012814
233 Ga0070671_100111829
234 Ga0070673_100310409
235 Ga0070659_100012429
236 Ga0070659_100328262
237 Ga0070659_100481856
238 Ga0070667_100018847
239 Ga0070678_100099586
240 Ga0070662_100005722
241 Ga0070679_100254798
242 Ga0070684_100085858
243 Ga0068853_100017103
244 Ga0070672_100036843
245 Ga0070672_100304791
246 Ga0068855_100211906
247 Ga0068855_100237720
248 Ga0070664_100159162
249 Ga0070664_100781894
250 Ga0068857_100162336
251 Ga0068856_100624352
252 Ga0068864_100026816
253 Ga0068864_100027303
254 Ga0068864_100117667
255 Ga0068864_100147904
256 Ga0068851_10122821
257 Ga0068863_100025597
258 Ga0068863_100029236
259 Ga0068858_100003328
260 Ga0068858_100676233
261 Ga0068860_100072849
262 Ga0068860_100117101
263 Ga0068860_100268568
264 Ga0068862_100313130
265 Ga0075368_10001227
266 Ga0075364_10002194
267 Ga0075362_10026078
268 Ga0075366_10001944
269 Ga0097621_100001916
270 Ga0097621_100397023
271 Ga0068871_100119769
272 Ga0068871_100135829
273 Ga0079104_1008877
274 Ga0079104_1017843
275 Ga0105243_10566188
276 Ga0105248_10033961
277 Ga0105248_10046753
278 Ga0105248_10258312
279 Ga0105237_10024822
280 Ga0157327_1002343
281 Ga0157370_10170177
282 Ga0163162_10143008
283 Ga0157375_10016248
284 Ga0157380_10251391
285 Ga0206353_11904113
286 Ga0213876_10077295
287 Ga0207680_10080684
288 Ga0207680_10161793
289 Ga0207647_10261478
290 Ga0207705_10011620
291 Ga0207705_10029641
292 Ga0207705_10287184
293 Ga0207671_10016531
294 Ga0207662_10103923
295 Ga0207657_10038692
296 Ga0207657_10057912
297 Ga0207657_10378770
298 Ga0207649_10189942
299 Ga0207652_10232711
300 Ga0207681_10142234
301 Ga0207681_10239085
302 Ga0207681_10686818
303 Ga0207659_10103253
304 Ga0207659_10168860
305 Ga0207659_10182798
306 Ga0207644_10032758
307 Ga0207644_10078708
308 Ga0207690_10029885
309 Ga0207706_10002707
310 Ga0207706_10124992
311 Ga0207670_10372340
312 Ga0207691_10000892
313 Ga0207711_10038956
314 Ga0207711_10163541
315 Ga0207679_10079004
316 Ga0207679_10253181
317 Ga0207651_10109291
318 Ga0207640_10179404
319 Ga0207703_10151546
320 Ga0207639_10033999
321 Ga0207678_10138114
322 Ga0207702_10265477
323 Ga0207702_10864467
324 Ga0207641_10058067
325 Ga0207641_10133307
326 Ga0207676_10053293
327 Ga0207676_10180237
328 Ga0207676_10393275
329 Ga0207674_10074820
330 Ga0207683_10066010
331 Ga0207698_10051175
332 Ga0209281_1010546
333 Ga0268265_10169815
334 Ga0268264_10053926
335 Ga0307405_10069808
336 Ga0307405_10071010
337 Ga0307410_10070204
338 Ga0307412_10034405
339 Ga0307409_100163655
340 Ga0307409_100293630
341 Ga0307416_100505885
342 Ga0307414_10261682
343 Ga0307414_10343842
344 Ga0307411_10068483
345 Ga0307411_10468763
346 Ga0307411_10540590
347 Ga0307411_10643471
348 Ga0307415_100070092
349 Ga0373943_0004063
350 Ga0373947_0100138
351 Ga0395899_0000140
352 Ga0395899_0013813
353 Ga0395899_0102221
354 Ga0395900_0000075
355 Ga0395900_0031436
356 Ga0395900_0032873
357 Ga0395900_0056048
358 Ga0395900_0099128
359 Ga0395900_0692907
360 Ga0395898_0000055
361 Ga0395898_0003591
362 Ga0395898_0071242
363 Ga0395898_0077070
364 Ga0395898_0339584
365 Ga0395905_0000089
366 Ga0395905_0013793
367 Ga0395905_0052732
368 Ga0395905_0078554
369 Ga0395905_0204014
370 Ga0395905_0331876
371 Ga0395905_0739500
372 Ga0395905_0755438
373 Ga0395901_0000885
374 Ga0395901_0013494
375 Ga0395901_0025952
376 Ga0395901_0106273
377 Ga0395901_0125582
378 Ga0395901_0424866
379 Ga0395901_0591718
380 Ga0436365_1911625
381 Ga0439448_0017664
382 Ga0439455_0003209
383 Ga0439458_0000309
384 Ga0466966_0141948
385 Ga0466961_0048848
386 Ga0466963_0024575
387 Ga0466957_0051603
388 Ga0466958_0107899
389 Ga0466967_0021202
390 Ga0466967_0358999
391 Ga0495686_0049689
392 Ga0495686_0101646
393 Ga0496107_0167406
394 Ga0496108_0240257
395 Ga0496109_0054494
396 Ga0496109_0322283
397 Ga0496109_0384559
398 Ga0496110_0885834
399 Ga0496112_0006638
400 Ga0496112_0008002
401 Ga0496112_0029910
402 Ga0496113_0002894
403 Ga0496122_0194878
404 Ga0496123_0014970
405 Ga0496123_0029063
406 Ga0496124_0000175
407 Ga0496124_0001397
408 Ga0496124_0066447
409 Ga0496124_0108196
410 Ga0501067_0021133
411 Ga0501069_0047536
412 Ga0501224_007319
413 Ga0501044_0003922
414 nmdc:mga03683_38863_c1
415 nmdc:mga00v17_2640_c1
416 nmdc:mga0k408_17859_c1
417 nmdc:mga0n895_203138_c1
418 Ga0500646_0056154
419 Ga0500595_001907
420 Ga0500568_0022345
421 Ga0500588_0046923
422 Ga0501082_0258141
423 2600224957
424 2819713201
425 2879164838
426 2885431050
427 2928527742
428 2928971625

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00027

cNMP_binding

Cyclic nucleotide-binding domain

30

116

0.96

PF13545

HTH_Crp_2

Crp-like helix-turn-helix domain

149

228

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5e44-assembly1.cif.gz_A-2 crystal structure of holo-fnr of a. fischeri 0.9048 20 227
4i2o-assembly1.cif.gz_B the structure of fixk2 from bradyrhizobium japonicum 0.8889 40 216
8qto-assembly1.cif.gz_A-2 crystal structure of holo-l28h-fnr of a. fischeri 0.8774 16 226
3i54-assembly2.cif.gz_C crystal structure of mtbcrp in complex with camp 0.8734 34 216
4cyd-assembly2.cif.gz_A glxr bound to camp 0.8537 20 216
ID Description Score Start End Superfamily
5e44A01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9 28 158 2.60.120.10
5cvrA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8987 40 158 2.60.120.10
4i2oB01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8825 40 158 2.60.120.10
af_E7F4S2_593_708_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8811 36 148 2.60.120.10
3etqA02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8761 28 141 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A4Q2XLP7-F1-model_v4 deleted 0.9758 28 183
AF-A0A4Q5QDY6-F1-model_v4 Crp/Fnr family transcriptional regulator 0.9722 42 234 GO:0003677
GO:0006355
AF-A0A4Q2XLP7-F1-model_v4 deleted 0.9697 28 183
AF-A0A7W6MM76-F1-model_v4 CRP-like cAMP-binding protein 0.9537 67 235 GO:0003677
GO:0006355
AF-A0A2W5RD86-F1-model_v4 deleted 0.9491 14 234

Map