F324575

General Info

Members Datasets Scaffolds Average Seq Length
213 163 210 189

Family's Representative Sequence

Representative Sequence 3300053125|Ga0500618_007589|Ga0500618_007589_1834_2478
Length 214
Sequence MQSIQNIFSPRPQYSRFRIVFNDMESHSPLMTEQNKDIADTVLRERAKLSHFIRRRVRNPVDAEDILQDVMYDFVRAYRLPEPIEQVSAWLFRVARNRIIDRFRKKKEEALPGGGFDGDEADSDYLDLVLPVEGEGPDAVYARSMLLEAMQQALDELPAQQREVFIAHELDGRSFKELSAETGISVNTLLSSKRYAVMFLRRRLQVIYDELDME

Samples

Sample ID Description Type Environment
1 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
2 2821131069 Duganella sp. 1224 Isolate Unclassified
3 2857564685 Duganella sp. R-74599 Isolate Unclassified
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
54 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
55 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
56 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
85 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
86 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
87 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
88 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
89 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
90 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
91 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
92 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
93 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
94 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
95 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
96 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
97 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
101 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
102 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
103 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
104 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
105 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
106 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
107 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
108 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
109 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
110 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
113 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
114 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
115 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
116 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
117 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
118 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
121 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
122 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
123 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
124 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
125 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
126 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
127 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
128 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
129 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
130 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
134 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
135 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
136 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
137 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
138 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
139 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
140 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
141 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
142 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
146 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
147 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
148 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
149 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
150 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
151 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
154 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
155 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
156 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
157 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
158 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
159 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
160 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
161 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
162 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
163 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.59
Metatranscriptomes 0
Isolates 1.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.39
Nodule 0
Rhizoplane 3.29
Rhizosphere 79.81
Stem 0
Stem Tuber 0
Unclassified 7.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000777 3300002773 Bacteria 16076
2 JGI25153J46596_10000277 3300003215 Bacteria 39318
3 rootL2_10081369 3300003322 Unclassified 3071
4 rootL2_10149185 3300003322 Bacteria 2974
5 Ga0055526_1008820 3300003771 Bacteria 4958
6 Ga0070658_10000010 3300005327 Bacteria 297212
7 Ga0070658_10769349 3300005327 Bacteria 836
8 Ga0070682_100140352 3300005337 Bacteria 1646
9 Ga0070671_100075003 3300005355 Bacteria 2825
10 Ga0070667_100039230 3300005367 Bacteria 3969
11 Ga0070711_100707945 3300005439 Unclassified 848
12 Ga0070663_100007980 3300005455 Bacteria 6488
13 Ga0068867_100081258 3300005459 Bacteria 2443
14 Ga0070684_100102627 3300005535 Bacteria 2557
15 Ga0068853_100027025 3300005539 Bacteria 4822
16 Ga0070686_100026898 3300005544 Bacteria 3476
17 Ga0070696_100008885 3300005546 Bacteria 6722
18 Ga0070665_100093143 3300005548 Bacteria 3018
19 Ga0068855_100004429 3300005563 Bacteria 17159
20 Ga0068855_100420747 3300005563 Unclassified 1461
21 Ga0068855_101794117 3300005563 Bacteria 623
22 Ga0068857_100007732 3300005577 Bacteria 9260
23 Ga0068857_100014136 3300005577 Bacteria 6952
24 Ga0068854_100038822 3300005578 Bacteria 3351
25 Ga0068856_100003181 3300005614 Bacteria 16719
26 Ga0068852_100081626 3300005616 Unclassified 2871
27 Ga0068852_100107395 3300005616 Bacteria 2532
28 Ga0068859_101144842 3300005617 Bacteria 856
29 Ga0068851_10047743 3300005834 Bacteria 2169
30 Ga0075363_100329865 3300006048 Bacteria 889
31 Ga0075366_10089860 3300006195 Bacteria 1839
32 Ga0097621_100000208 3300006237 Bacteria 38489
33 Ga0097621_100016938 3300006237 Bacteria 5524
34 Ga0075370_10001858 3300006353 Bacteria 9458
35 Ga0068871_100000534 3300006358 Bacteria 25966
36 Ga0075431_100059710 3300006847 Bacteria 3935
37 Ga0097620_101144908 3300006931 Bacteria 856
38 Ga0075435_100224408 3300007076 Bacteria 1596
39 Ga0099795_10007681 3300007788 Bacteria 3027
40 Ga0105240_10027677 3300009093 Bacteria 7419
41 Ga0111539_10000177 3300009094 Bacteria 74071
42 Ga0111539_11285628 3300009094 Bacteria 849
43 Ga0105245_10009948 3300009098 Bacteria 8282
44 Ga0105241_10008004 3300009174 Bacteria 7775
45 Ga0105241_10065757 3300009174 Unclassified 2802
46 Ga0105242_10053134 3300009176 Bacteria 3307
47 Ga0105248_10002388 3300009177 Bacteria 20857
48 Ga0105237_10370053 3300009545 Bacteria 1438
49 Ga0105238_10001926 3300009551 Bacteria 20836
50 Ga0099796_10010201 3300010159 Bacteria 2574
51 Ga0105239_10001479 3300010375 Bacteria 31248
52 Ga0157370_10032838 3300013104 Bacteria 5066
53 Ga0157374_10012827 3300013296 Bacteria 7299
54 Ga0157374_11039282 3300013296 Bacteria 839
55 Ga0157378_10144759 3300013297 Bacteria 2210
56 Ga0157378_10161708 3300013297 Bacteria 2094
57 Ga0163162_10081253 3300013306 Bacteria 3312
58 Ga0163162_10110262 3300013306 Bacteria 2849
59 Ga0157372_10007930 3300013307 Bacteria 11286
60 Ga0157376_10213708 3300014969 Bacteria 1782
61 Ga0157376_10266124 3300014969 Bacteria 1608
62 Ga0157376_10764467 3300014969 Bacteria 976
63 Ga0163161_10548589 3300017792 Bacteria 947
64 Ga0213874_10001617 3300021377 Bacteria 4727
65 Ga0207425_1000402 3300025245 Bacteria 29179
66 Ga0209129_1000417 3300025258 Bacteria 32874
67 Ga0209455_1005239 3300025272 Bacteria 4053
68 Ga0209564_1000053 3300025295 Bacteria 351452
69 Ga0209758_1000231 3300025297 Bacteria 118366
70 Ga0207656_10186014 3300025321 Unclassified 999
71 Ga0207705_10000016 3300025909 Bacteria 377359
72 Ga0207654_10011721 3300025911 Bacteria 4476
73 Ga0207707_10043292 3300025912 Bacteria 3927
74 Ga0207695_10000329 3300025913 Bacteria 113344
75 Ga0207695_10046132 3300025913 Bacteria 4621
76 Ga0207671_10087526 3300025914 Unclassified 2342
77 Ga0207660_10019691 3300025917 Bacteria 4516
78 Ga0207652_10013300 3300025921 Bacteria 6665
79 Ga0207694_10000279 3300025924 Bacteria 48165
80 Ga0207694_10008684 3300025924 Bacteria 7670
81 Ga0207687_10051228 3300025927 Bacteria 2877
82 Ga0207711_10002427 3300025941 Bacteria 16638
83 Ga0207689_10060214 3300025942 Bacteria 3122
84 Ga0207661_10038746 3300025944 Bacteria 3738
85 Ga0207679_10063752 3300025945 Unclassified 2752
86 Ga0207667_10000547 3300025949 Bacteria 49567
87 Ga0207667_10036386 3300025949 Bacteria 5276
88 Ga0207667_10753736 3300025949 Bacteria 973
89 Ga0207640_10012559 3300025981 Bacteria 4828
90 Ga0207677_10890703 3300026023 Unclassified 802
91 Ga0207639_10008936 3300026041 Bacteria 6895
92 Ga0207639_10123664 3300026041 Bacteria 2130
93 Ga0207678_10348949 3300026067 Bacteria 1276
94 Ga0207702_10014804 3300026078 Bacteria 6470
95 Ga0207702_10489818 3300026078 Bacteria 1197
96 Ga0207648_10178581 3300026089 Bacteria 1878
97 Ga0207674_10004782 3300026116 Bacteria 16234
98 Ga0207674_10005747 3300026116 Bacteria 14717
99 Ga0207698_10022445 3300026142 Bacteria 4386
100 Ga0207698_10896735 3300026142 Unclassified 894
101 Ga0207428_10005935 3300027907 Bacteria 11308
102 Ga0268266_10033182 3300028379 Bacteria 4390
103 Ga0265318_10049097 3300028577 Bacteria 1588
104 Ga0265323_10050461 3300028653 Bacteria 1479
105 Ga0265336_10035215 3300028666 Bacteria 1545
106 Ga0307517_10190975 3300028786 Bacteria 1300
107 Ga0265338_10003658 3300028800 Bacteria 21412
108 Ga0265338_10128668 3300028800 Bacteria 2004
109 Ga0265328_10035354 3300031239 Bacteria 1848
110 Ga0265320_10055343 3300031240 Bacteria 1910
111 Ga0265331_10021475 3300031250 Bacteria 3304
112 Ga0265331_10027922 3300031250 Bacteria 2825
113 Ga0265327_10001422 3300031251 Bacteria 30463
114 Ga0265327_10016662 3300031251 Bacteria 4653
115 Ga0265316_10082017 3300031344 Bacteria 2472
116 Ga0307508_10135288 3300031616 Bacteria 2068
117 Ga0265314_10024946 3300031711 Bacteria 4520
118 Ga0265314_10340830 3300031711 Bacteria 828
119 Ga0373955_0015365 3300035172 Bacteria 3747
120 Ga0373955_0093630 3300035172 Bacteria 1716
121 Ga0373933_0063139 3300035724 Bacteria 2239
122 Ga0373937_0010234 3300036401 Bacteria 8185
123 Ga0395905_0027958 3300037471 Bacteria 5317
124 Ga0400489_53436 3300039093 Bacteria 5601
125 Ga0436363_0141791 3300039450 Bacteria 6171
126 Ga0451791_0067701 3300041451 Bacteria 806
127 Ga0451791_1837676 3300041451 Bacteria 1937
128 Ga0451802_0327626 3300041460 Bacteria 1126
129 Ga0451839_1343511 3300041496 Bacteria 1942
130 Ga0450919_002561 3300042121 Bacteria 2354
131 Ga0450920_008175 3300042122 Bacteria 1909
132 Ga0450918_000598 3300042531 Bacteria 7728
133 Ga0451577_0000013 3300042876 Bacteria 550689
134 Ga0451577_0221459 3300042876 Bacteria 1710
135 Ga0451577_0840296 3300042876 Bacteria 828
136 Ga0453683_0000059 3300044673 Bacteria 187158
137 Ga0453683_0282432 3300044673 Bacteria 1060
138 Ga0453684_0000237 3300044712 Bacteria 236999
139 Ga0453684_0000585 3300044712 Bacteria 135647
140 Ga0453684_0006932 3300044712 Bacteria 21228
141 Ga0466959_0589681 3300045049 Unclassified 748
142 Ga0451576_0000018 3300045051 Bacteria 550689
143 Ga0451576_0002004 3300045051 Bacteria 32259
144 Ga0495592_0026879 3300046454 Bacteria 4363
145 Ga0495650_0000086 3300046471 Bacteria 235224
146 Ga0495650_0006768 3300046471 Bacteria 7083
147 Ga0495664_0081018 3300046477 Bacteria 1946
148 Ga0495606_0016821 3300046507 Bacteria 5557
149 Ga0495608_0066518 3300046511 Bacteria 2359
150 Ga0495610_0003621 3300046512 Bacteria 11909
151 Ga0495610_0006895 3300046512 Bacteria 7695
152 Ga0495610_0098365 3300046512 Bacteria 1314
153 Ga0495628_0013716 3300046516 Bacteria 6810
154 Ga0495628_0170888 3300046516 Bacteria 1648
155 Ga0495631_0262860 3300046518 Bacteria 735
156 Ga0495632_0015544 3300046519 Bacteria 4261
157 Ga0495632_0091020 3300046519 Bacteria 1446
158 Ga0495648_0142585 3300046524 Bacteria 1259
159 Ga0495642_0120596 3300046528 Bacteria 1125
160 Ga0495652_0109650 3300046529 Bacteria 2222
161 Ga0495654_0023411 3300046530 Bacteria 3199
162 Ga0495587_0029410 3300046536 Bacteria 3335
163 Ga0495597_0280596 3300046542 Bacteria 649
164 Ga0495645_0006147 3300046543 Bacteria 8311
165 Ga0495633_0003857 3300046558 Bacteria 9801
166 Ga0495633_0246188 3300046558 Bacteria 816
167 Ga0495667_0117939 3300046559 Bacteria 1714
168 Ga0495625_0009768 3300046660 Bacteria 7983
169 Ga0495625_0026346 3300046660 Bacteria 4394
170 Ga0495635_0603463 3300046663 Bacteria 717
171 Ga0495623_0017101 3300046679 Bacteria 4685
172 Ga0495670_0025288 3300046691 Bacteria 2936
173 Ga0495671_0027855 3300046692 Bacteria 2914
174 Ga0495660_0031479 3300046810 Bacteria 2982
175 Ga0495660_0189427 3300046810 Bacteria 989
176 Ga0495672_0000078 3300047320 Bacteria 164474
177 Ga0495672_0004363 3300047320 Bacteria 11621
178 Ga0495673_0000005 3300047469 Bacteria 943364
179 Ga0495673_0048133 3300047469 Bacteria 1881
180 Ga0495684_0594552 3300047471 Bacteria 747
181 Ga0495686_0000044 3300047472 Bacteria 288079
182 Ga0495686_0001028 3300047472 Bacteria 33622
183 Ga0495686_0040695 3300047472 Bacteria 2963
184 Ga0495686_0069842 3300047472 Bacteria 2165
185 Ga0496100_0139389 3300048903 Bacteria 1717
186 Ga0496101_0147581 3300048904 Bacteria 1797
187 Ga0496102_0111679 3300048905 Bacteria 2548
188 Ga0496110_0306059 3300048913 Bacteria 1448
189 Ga0496117_0004060 3300048920 Bacteria 16440
190 Ga0496118_0009543 3300048921 Bacteria 9772
191 Ga0496126_0000375 3300048929 Bacteria 92390
192 Ga0496126_0012325 3300048929 Bacteria 8771
193 Ga0496126_0040369 3300048929 Bacteria 4326
194 Ga0495682_0127167 3300049460 Bacteria 912
195 nmdc:mga0k408_100208_c1 3300050493 Bacteria 1708
196 nmdc:mga09592_416869_c1 3300050508 Bacteria 1160
197 nmdc:mga06r32_94023_c1 3300050510 Bacteria 2933
198 nmdc:mga08y16_18562_c1 3300050511 Bacteria 7328
199 nmdc:mga08y16_938396_c1 3300050511 Bacteria 849
200 nmdc:mga0rr50_211997_c1 3300050513 Bacteria 1596
201 nmdc:mga0a205_65882_c1 3300050515 Bacteria 3500
202 Ga0495601_0155345 3300053077 Bacteria 1494
203 Ga0500651_0118683 3300053093 Bacteria 1608
204 Ga0500594_0009217 3300053118 Bacteria 2268
205 Ga0500618_007589 3300053125 Bacteria 3081
206 Ga0500658_0004010 3300053134 Bacteria 5529
207 Ga0500568_0007794 3300053139 Bacteria 5216
208 Ga0500586_001546 3300053145 Bacteria 4890
209 Ga0500616_0005889 3300053153 Bacteria 8200
210 Ga0500587_000606 3300053739 Bacteria 4484

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005459 Ga0068867_100081258 Ga0068867_1000812581 171
2 3300009176 Ga0105242_10053134 Ga0105242_100531344 171
3 3300026089 Ga0207648_10178581 Ga0207648_101785813 171
4 3300035172 Ga0373955_0093630 Ga0373955_0093630_1067_1603 176
5 3300046454 Ga0495592_0026879 Ga0495592_0026879_1360_1896 176
6 3300046477 Ga0495664_0081018 Ga0495664_0081018_422_958 176
7 3300046511 Ga0495608_0066518 Ga0495608_0066518_1562_2098 176
8 3300046516 Ga0495628_0170888 Ga0495628_0170888_376_912 176
9 3300046529 Ga0495652_0109650 Ga0495652_0109650_930_1466 176
10 3300046536 Ga0495587_0029410 Ga0495587_0029410_2657_3193 176
11 3300046543 Ga0495645_0006147 Ga0495645_0006147_5591_6127 176
12 3300046559 Ga0495667_0117939 Ga0495667_0117939_1099_1635 176
13 3300046663 Ga0495635_0603463 Ga0495635_0603463_86_622 176
14 3300046679 Ga0495623_0017101 Ga0495623_0017101_1940_2476 176
15 3300053077 Ga0495601_0155345 Ga0495601_0155345_613_1149 176
16 3300031250 Ga0265331_10027922 Ga0265331_100279223 178
17 3300048929 Ga0496126_0012325 Ga0496126_0012325_4537_5094 178
18 3300014969 Ga0157376_10764467 Ga0157376_107644671 179
19 3300046519 Ga0495632_0091020 Ga0495632_0091020_650_1231 179
20 3300046810 Ga0495660_0031479 Ga0495660_0031479_319_900 179
21 3300047472 Ga0495686_0069842 Ga0495686_0069842_679_1260 179
22 3300028653 Ga0265323_10050461 Ga0265323_100504613 180
23 3300005367 Ga0070667_100039230 Ga0070667_1000392302 181
24 3300025942 Ga0207689_10060214 Ga0207689_100602141 181
25 3300048920 Ga0496117_0004060 Ga0496117_0004060_3328_3918 181
26 3300048921 Ga0496118_0009543 Ga0496118_0009543_6603_7193 181
27 3300048929 Ga0496126_0000375 Ga0496126_0000375_20732_21322 181
28 iso_pu_bacteria 2857564685 2857567339 181
29 3300021377 Ga0213874_10001617 Ga0213874_100016173 182
30 3300039093 Ga0400489_53436 Ga0400489_53436_2085_2639 182
31 3300039450 Ga0436363_0141791 Ga0436363_0141791_2454_3053 182
32 3300048905 Ga0496102_0111679 Ga0496102_0111679_50_640 182
33 iso_pu_bacteria 2821131069 2821133150 182
34 3300005337 Ga0070682_100140352 Ga0070682_1001403522 183
35 3300005355 Ga0070671_100075003 Ga0070671_1000750032 183
36 3300005544 Ga0070686_100026898 Ga0070686_1000268983 183
37 3300005548 Ga0070665_100093143 Ga0070665_1000931433 183
38 3300005616 Ga0068852_100081626 Ga0068852_1000816264 183
39 3300006237 Ga0097621_100016938 Ga0097621_1000169385 183
40 3300007788 Ga0099795_10007681 Ga0099795_100076814 183
41 3300010159 Ga0099796_10010201 Ga0099796_100102012 183
42 3300013297 Ga0157378_10161708 Ga0157378_101617082 183
43 3300017792 Ga0163161_10548589 Ga0163161_105485891 183
44 3300025911 Ga0207654_10011721 Ga0207654_100117214 183
45 3300025913 Ga0207695_10000329 Ga0207695_1000032988 183
46 3300025924 Ga0207694_10000279 Ga0207694_1000027934 183
47 3300025927 Ga0207687_10051228 Ga0207687_100512284 183
48 3300026023 Ga0207677_10890703 Ga0207677_108907031 183
49 3300026067 Ga0207678_10348949 Ga0207678_103489492 183
50 3300026142 Ga0207698_10896735 Ga0207698_108967352 183
51 3300028379 Ga0268266_10033182 Ga0268266_100331824 183
52 3300046528 Ga0495642_0120596 Ga0495642_0120596_325_885 183
53 3300046530 Ga0495654_0023411 Ga0495654_0023411_1302_1868 183
54 3300047472 Ga0495686_0001028 Ga0495686_0001028_31084_31650 183
55 3300005327 Ga0070658_10000010 Ga0070658_1000001069 184
56 3300005439 Ga0070711_100707945 Ga0070711_1007079452 184
57 3300005535 Ga0070684_100102627 Ga0070684_1001026272 184
58 3300005546 Ga0070696_100008885 Ga0070696_1000088853 184
59 3300005563 Ga0068855_100004429 Ga0068855_1000044294 184
60 3300005563 Ga0068855_100420747 Ga0068855_1004207471 184
61 3300005563 Ga0068855_101794117 Ga0068855_1017941171 184
62 3300005577 Ga0068857_100014136 Ga0068857_1000141369 184
63 3300005578 Ga0068854_100038822 Ga0068854_1000388222 184
64 3300005614 Ga0068856_100003181 Ga0068856_10000318110 184
65 3300006237 Ga0097621_100000208 Ga0097621_10000020834 184
66 3300006358 Ga0068871_100000534 Ga0068871_10000053417 184
67 3300009094 Ga0111539_10000177 Ga0111539_1000017731 184
68 3300009094 Ga0111539_11285628 Ga0111539_112856282 184
69 3300013104 Ga0157370_10032838 Ga0157370_100328384 184
70 3300025909 Ga0207705_10000016 Ga0207705_10000016136 184
71 3300025912 Ga0207707_10043292 Ga0207707_100432923 184
72 3300025913 Ga0207695_10046132 Ga0207695_100461321 184
73 3300025914 Ga0207671_10087526 Ga0207671_100875264 184
74 3300025917 Ga0207660_10019691 Ga0207660_100196913 184
75 3300025921 Ga0207652_10013300 Ga0207652_100133002 184
76 3300025924 Ga0207694_10008684 Ga0207694_100086849 184
77 3300025944 Ga0207661_10038746 Ga0207661_100387463 184
78 3300025945 Ga0207679_10063752 Ga0207679_100637522 184
79 3300025949 Ga0207667_10000547 Ga0207667_1000054712 184
80 3300025949 Ga0207667_10036386 Ga0207667_100363862 184
81 3300025981 Ga0207640_10012559 Ga0207640_100125592 184
82 3300026041 Ga0207639_10008936 Ga0207639_100089364 184
83 3300026078 Ga0207702_10014804 Ga0207702_100148044 184
84 3300026116 Ga0207674_10004782 Ga0207674_100047829 184
85 3300027907 Ga0207428_10005935 Ga0207428_1000593510 184
86 3300050511 nmdc:mga08y16_18562_c1 nmdc:mga08y16_18562_c1_746_1303 184
87 3300050511 nmdc:mga08y16_938396_c1 nmdc:mga08y16_938396_c1_54_623 184
88 3300025272 Ga0209455_1005239 Ga0209455_10052393 185
89 3300046471 Ga0495650_0000086 Ga0495650_0000086_221768_222325 185
90 3300046507 Ga0495606_0016821 Ga0495606_0016821_2574_3131 185
91 3300046512 Ga0495610_0003621 Ga0495610_0003621_10229_10786 185
92 3300047320 Ga0495672_0000078 Ga0495672_0000078_141774_142331 185
93 3300047320 Ga0495672_0004363 Ga0495672_0004363_413_985 185
94 3300047469 Ga0495673_0048133 Ga0495673_0048133_717_1289 185
95 3300050515 nmdc:mga0a205_65882_c1 nmdc:mga0a205_65882_c1_2371_2928 185
96 iso_pu_bacteria 2643221644 2644243933 185
97 3300005455 Ga0070663_100007980 Ga0070663_1000079805 186
98 3300005539 Ga0068853_100027025 Ga0068853_1000270252 186
99 3300005577 Ga0068857_100007732 Ga0068857_1000077327 186
100 3300005616 Ga0068852_100107395 Ga0068852_1001073954 186
101 3300005834 Ga0068851_10047743 Ga0068851_100477434 186
102 3300009093 Ga0105240_10027677 Ga0105240_100276775 186
103 3300009098 Ga0105245_10009948 Ga0105245_100099485 186
104 3300009174 Ga0105241_10008004 Ga0105241_100080041 186
105 3300009174 Ga0105241_10065757 Ga0105241_100657572 186
106 3300009177 Ga0105248_10002388 Ga0105248_1000238812 186
107 3300009545 Ga0105237_10370053 Ga0105237_103700531 186
108 3300009551 Ga0105238_10001926 Ga0105238_1000192610 186
109 3300010375 Ga0105239_10001479 Ga0105239_1000147911 186
110 3300013296 Ga0157374_10012827 Ga0157374_100128273 186
111 3300013307 Ga0157372_10007930 Ga0157372_100079307 186
112 3300014969 Ga0157376_10266124 Ga0157376_102661241 186
113 3300025321 Ga0207656_10186014 Ga0207656_101860142 186
114 3300025941 Ga0207711_10002427 Ga0207711_1000242711 186
115 3300025949 Ga0207667_10753736 Ga0207667_107537362 186
116 3300026041 Ga0207639_10123664 Ga0207639_101236643 186
117 3300026078 Ga0207702_10489818 Ga0207702_104898182 186
118 3300026116 Ga0207674_10005747 Ga0207674_100057479 186
119 3300026142 Ga0207698_10022445 Ga0207698_100224452 186
120 3300035172 Ga0373955_0015365 Ga0373955_0015365_760_1323 186
121 3300035724 Ga0373933_0063139 Ga0373933_0063139_1319_1882 186
122 3300046512 Ga0495610_0006895 Ga0495610_0006895_498_1058 186
123 3300046558 Ga0495633_0003857 Ga0495633_0003857_2833_3393 186
124 3300047469 Ga0495673_0000005 Ga0495673_0000005_224641_225201 186
125 3300047471 Ga0495684_0594552 Ga0495684_0594552_93_656 186
126 3300048913 Ga0496110_0306059 Ga0496110_0306059_246_806 186
127 3300053145 Ga0500586_001546 Ga0500586_001546_1565_2125 186
128 3300046471 Ga0495650_0006768 Ga0495650_0006768_4108_4671 187
129 3300046524 Ga0495648_0142585 Ga0495648_0142585_625_1188 187
130 3300046692 Ga0495671_0027855 Ga0495671_0027855_1247_1810 187
131 3300048903 Ga0496100_0139389 Ga0496100_0139389_38_613 187
132 3300048904 Ga0496101_0147581 Ga0496101_0147581_1131_1706 187
133 3300053118 Ga0500594_0009217 Ga0500594_0009217_817_1380 187
134 3300031250 Ga0265331_10021475 Ga0265331_100214754 188
135 3300031251 Ga0265327_10001422 Ga0265327_1000142228 188
136 3300036401 Ga0373937_0010234 Ga0373937_0010234_1192_1764 189
137 3300042121 Ga0450919_002561 Ga0450919_002561_882_1457 189
138 3300042122 Ga0450920_008175 Ga0450920_008175_332_907 189
139 3300042531 Ga0450918_000598 Ga0450918_000598_6364_6939 189
140 3300047472 Ga0495686_0040695 Ga0495686_0040695_41_631 189
141 3300003322 rootL2_10081369 rootL2_100813693 190
142 3300003322 rootL2_10149185 rootL2_101491852 190
143 3300013296 Ga0157374_11039282 Ga0157374_110392821 190
144 3300013306 Ga0163162_10110262 Ga0163162_101102622 190
145 3300014969 Ga0157376_10213708 Ga0157376_102137082 190
146 3300042876 Ga0451577_0221459 Ga0451577_0221459_1110_1682 190
147 3300044673 Ga0453683_0282432 Ga0453683_0282432_426_998 190
148 3300044712 Ga0453684_0006932 Ga0453684_0006932_15024_15596 190
149 3300045051 Ga0451576_0002004 Ga0451576_0002004_5500_6072 190
150 3300046558 Ga0495633_0246188 Ga0495633_0246188_68_646 190
151 3300046691 Ga0495670_0025288 Ga0495670_0025288_634_1212 190
152 3300053153 Ga0500616_0005889 Ga0500616_0005889_1487_2065 190
153 3300005327 Ga0070658_10769349 Ga0070658_107693491 191
154 3300013306 Ga0163162_10081253 Ga0163162_100812531 191
155 3300031251 Ga0265327_10016662 Ga0265327_100166623 191
156 3300031711 Ga0265314_10024946 Ga0265314_100249463 191
157 3300031711 Ga0265314_10340830 Ga0265314_103408301 191
158 3300041451 Ga0451791_1837676 Ga0451791_1837676_830_1423 191
159 3300041460 Ga0451802_0327626 Ga0451802_0327626_150_743 191
160 3300041496 Ga0451839_1343511 Ga0451839_1343511_1089_1682 191
161 3300042876 Ga0451577_0000013 Ga0451577_0000013_544553_545128 191
162 3300042876 Ga0451577_0840296 Ga0451577_0840296_161_736 191
163 3300044673 Ga0453683_0000059 Ga0453683_0000059_181022_181597 191
164 3300044712 Ga0453684_0000237 Ga0453684_0000237_17317_17892 191
165 3300044712 Ga0453684_0000585 Ga0453684_0000585_129511_130086 191
166 3300045051 Ga0451576_0000018 Ga0451576_0000018_5562_6137 191
167 3300046512 Ga0495610_0098365 Ga0495610_0098365_167_760 191
168 3300046516 Ga0495628_0013716 Ga0495628_0013716_1358_1933 191
169 3300046519 Ga0495632_0015544 Ga0495632_0015544_2012_2605 191
170 3300046660 Ga0495625_0026346 Ga0495625_0026346_1379_1972 191
171 3300047472 Ga0495686_0000044 Ga0495686_0000044_210909_211484 191
172 3300053739 Ga0500587_000606 Ga0500587_000606_2414_3007 191
173 3300007076 Ga0075435_100224408 Ga0075435_1002244082 192
174 3300013297 Ga0157378_10144759 Ga0157378_101447593 192
175 3300028800 Ga0265338_10003658 Ga0265338_1000365814 192
176 3300037471 Ga0395905_0027958 Ga0395905_0027958_3551_4132 192
177 3300041451 Ga0451791_0067701 Ga0451791_0067701_180_776 192
178 3300048929 Ga0496126_0040369 Ga0496126_0040369_377_958 192
179 3300050513 nmdc:mga0rr50_211997_c1 nmdc:mga0rr50_211997_c1_192_773 192
180 3300053125 Ga0500618_007589 Ga0500618_007589_1834_2478 192
181 3300005617 Ga0068859_101144842 Ga0068859_1011448422 193
182 3300006048 Ga0075363_100329865 Ga0075363_1003298651 193
183 3300006195 Ga0075366_10089860 Ga0075366_100898603 193
184 3300006847 Ga0075431_100059710 Ga0075431_1000597102 193
185 3300006931 Ga0097620_101144908 Ga0097620_1011449082 193
186 3300028577 Ga0265318_10049097 Ga0265318_100490972 193
187 3300028666 Ga0265336_10035215 Ga0265336_100352152 193
188 3300028786 Ga0307517_10190975 Ga0307517_101909753 193
189 3300028800 Ga0265338_10128668 Ga0265338_101286682 193
190 3300031239 Ga0265328_10035354 Ga0265328_100353542 193
191 3300031240 Ga0265320_10055343 Ga0265320_100553432 193
192 3300031344 Ga0265316_10082017 Ga0265316_100820175 193
193 3300031616 Ga0307508_10135288 Ga0307508_101352881 193
194 3300045049 Ga0466959_0589681 Ga0466959_0589681_66_659 193
195 3300046518 Ga0495631_0262860 Ga0495631_0262860_38_640 193
196 3300046542 Ga0495597_0280596 Ga0495597_0280596_28_627 193
197 3300046660 Ga0495625_0009768 Ga0495625_0009768_1052_1654 193
198 3300046810 Ga0495660_0189427 Ga0495660_0189427_147_746 193
199 3300049460 Ga0495682_0127167 Ga0495682_0127167_252_851 193
200 3300050493 nmdc:mga0k408_100208_c1 nmdc:mga0k408_100208_c1_286_888 193
201 3300050508 nmdc:mga09592_416869_c1 nmdc:mga09592_416869_c1_44_628 193
202 3300050510 nmdc:mga06r32_94023_c1 nmdc:mga06r32_94023_c1_1681_2265 193
203 3300053093 Ga0500651_0118683 Ga0500651_0118683_376_975 193
204 3300053134 Ga0500658_0004010 Ga0500658_0004010_4147_4749 193
205 3300053139 Ga0500568_0007794 Ga0500568_0007794_1861_2463 193
206 3300006353 Ga0075370_10001858 Ga0075370_100018585 194
207 3300002773 JGI25152J39213_1000777 JGI25152J39213_100077710 196
208 3300003215 JGI25153J46596_10000277 JGI25153J46596_1000027715 196
209 3300003771 Ga0055526_1008820 Ga0055526_10088202 196
210 3300025245 Ga0207425_1000402 Ga0207425_100040210 196
211 3300025258 Ga0209129_1000417 Ga0209129_100041715 196
212 3300025295 Ga0209564_1000053 Ga0209564_1000053135 196
213 3300025297 Ga0209758_1000231 Ga0209758_100023116 196

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08281

Sigma70_r4_2

Sigma-70, region 4

147

189

0.96

PF04542

Sigma70_r2

Sigma-70 region 2

41

109

0.89

Feature Viewer

pLDDT pTM Quality
77.9 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map