F324539

General Info

Members Datasets Scaffolds Average Seq Length
213 141 426 117

Family's Representative Sequence

Representative Sequence 3300049742|Ga0501080_0168480|Ga0501080_0168480_525_944
Length 139
Sequence VIVGVGIDVCDIGRFATAMARTPGLGPRLFTPAELTRGTASLAARFAAKEAIAKALGAPSGLLWHDAEILSDRSGRPTLTVRGTVAERARLLGVSGWHISLSHDAGVASAMVVAEGWGAPSIEAASAAGLGPPFAPPPE

Samples

Sample ID Description Type Environment
1 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
2 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
7 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
8 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
9 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
10 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
11 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
12 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
13 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
14 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
15 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
16 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
17 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
18 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
19 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
20 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
21 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
22 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
23 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
24 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
25 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
26 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
27 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
28 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
29 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
30 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
31 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
32 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
33 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
34 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
35 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
36 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
37 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
38 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
39 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
40 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
41 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
42 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
43 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
44 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
45 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
46 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
47 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
48 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
49 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
50 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
51 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
52 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
53 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
54 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
55 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
56 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
57 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
58 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
59 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
60 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
61 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
62 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
63 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
64 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
65 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
66 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
67 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
68 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
69 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
70 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
71 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
72 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
73 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
74 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
75 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
76 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
77 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
78 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
79 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
80 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
81 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
82 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
83 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
99 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
100 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
101 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
102 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
103 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
104 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
105 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
106 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
107 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
108 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
109 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
110 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
113 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
114 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
115 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
116 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
117 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
118 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
119 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
120 2643221561 Nocardioides sp. Root151 Isolate Unclassified
121 2643221613 Oerskovia sp. Root22 Isolate Unclassified
122 2643221696 Nocardioides sp. Root140 Isolate Unclassified
123 2643221721 Oerskovia sp. Root918 Isolate Unclassified
124 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
125 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
126 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
127 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
128 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
129 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
130 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
131 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
132 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
133 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
134 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
135 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
136 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
137 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
138 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
139 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
140 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
141 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.73
Metatranscriptomes 0.94
Isolates 10.33

Biome Distribution

Category Percentage (%)
Aerial Root 0.94
Bulb 0
Endosphere 1.88
Nodule 0
Rhizoplane 6.57
Rhizosphere 76.53
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501080_0168480 3300049742 Bacteria 2021
2 Ga0007423J48922_100268 3300003285 Bacteria 2955
3 Ga0070682_100758903 3300005337 Bacteria 784
4 Ga0070668_102283668 3300005347 Bacteria 500
5 Ga0070667_100258298 3300005367 Bacteria 1559
6 Ga0075364_10126809 3300006051 Bacteria 1712
7 Ga0075367_10487205 3300006178 Bacteria 782
8 Ga0207664_10526538 3300025929 Bacteria 1059
9 Ga0207658_10207965 3300025986 Bacteria 1638
10 Ga0207708_10079034 3300026075 Bacteria 2526
11 Ga0207648_11022090 3300026089 Bacteria 774
12 Ga0207675_100138161 3300026118 Bacteria 2313
13 Ga0207683_10666993 3300026121 Bacteria 964
14 Ga0307517_10068932 3300028786 Bacteria 3213
15 Ga0314311_1032588 3300030733 Bacteria 1160
16 Ga0316179_1009982 3300030734 Bacteria 764
17 Ga0316181_1099827 3300030744 Bacteria 725
18 Ga0307509_10010929 3300031507 Bacteria 11063
19 Ga0307408_100245586 3300031548 Bacteria 1474
20 Ga0307516_10392024 3300031730 Bacteria 1049
21 Ga0307405_10696190 3300031731 Bacteria 841
22 Ga0307413_10530591 3300031824 Bacteria 951
23 Ga0307413_10921587 3300031824 Bacteria 744
24 Ga0307413_10973728 3300031824 Bacteria 725
25 Ga0307413_11628455 3300031824 Bacteria 574
26 Ga0307410_10133760 3300031852 Bacteria 1825
27 Ga0307410_10788923 3300031852 Bacteria 807
28 Ga0307410_11848862 3300031852 Bacteria 537
29 Ga0307406_10695000 3300031901 Bacteria 849
30 Ga0307406_10708442 3300031901 Bacteria 841
31 Ga0307409_100094589 3300031995 Bacteria 2459
32 Ga0307409_100770243 3300031995 Bacteria 967
33 Ga0307416_100023427 3300032002 Bacteria 4480
34 Ga0307416_100179891 3300032002 Bacteria 1981
35 Ga0307416_101505902 3300032002 Bacteria 778
36 Ga0307414_10338580 3300032004 Bacteria 1287
37 Ga0307411_10077802 3300032005 Bacteria 2272
38 Ga0307415_101379501 3300032126 Bacteria 670
39 Ga0373943_0645915 3300035170 Bacteria 625
40 Ga0373946_0692805 3300035171 Bacteria 532
41 Ga0372808_049802 3300036459 Bacteria 600
42 Ga0395901_0024562 3300038443 Bacteria 6188
43 Ga0451789_0550630 3300041443 Bacteria 1044
44 Ga0451791_0171072 3300041451 Bacteria 1367
45 Ga0451791_1096317 3300041451 Bacteria 1014
46 Ga0451793_0441183 3300041452 Bacteria 2034
47 Ga0451793_1314313 3300041452 Bacteria 1057
48 Ga0451797_1461800 3300041453 Bacteria 1125
49 Ga0451795_1160042 3300041456 Bacteria 1946
50 Ga0451807_0683576 3300041486 Bacteria 511
51 Ga0451837_0510645 3300041494 Bacteria 752
52 Ga0451837_1218452 3300041494 Bacteria 813
53 Ga0451839_0299405 3300041496 Bacteria 535
54 Ga0451839_0869251 3300041496 Bacteria 1607
55 Ga0451839_0907982 3300041496 Bacteria 1202
56 Ga0451849_0139025 3300041505 Bacteria 1619
57 Ga0451843_1393816 3300041509 Bacteria 841
58 Ga0439456_170651 3300042013 Bacteria 511
59 Ga0450888_037635 3300042126 Bacteria 665
60 Ga0451577_0967080 3300042876 Bacteria 765
61 Ga0466972_0076912 3300044658 Bacteria 1590
62 Ga0466972_0184649 3300044658 Bacteria 978
63 Ga0466966_0031425 3300044684 Bacteria 3443
64 Ga0466966_0210461 3300044684 Bacteria 1175
65 Ga0466961_0394995 3300044693 Bacteria 839
66 Ga0466963_0023309 3300044694 Bacteria 3929
67 Ga0466963_0035713 3300044694 Bacteria 3239
68 Ga0466971_0247434 3300044719 Bacteria 849
69 Ga0466970_0024647 3300044765 Bacteria 3147
70 Ga0466970_0108766 3300044765 Bacteria 1513
71 Ga0466970_0211169 3300044765 Bacteria 1081
72 Ga0466970_0596012 3300044765 Bacteria 641
73 Ga0466957_0004726 3300044842 Bacteria 7625
74 Ga0466957_0587809 3300044842 Bacteria 779
75 Ga0466960_0012495 3300044901 Bacteria 3585
76 Ga0466959_0073360 3300045049 Bacteria 2476
77 Ga0466959_0107118 3300045049 Bacteria 1998
78 Ga0466958_0487960 3300045836 Bacteria 799
79 Ga0466967_0057425 3300045976 Bacteria 3436
80 Ga0466967_0646769 3300045976 Bacteria 1045
81 Ga0466967_0753030 3300045976 Bacteria 966
82 Ga0466967_0983599 3300045976 Bacteria 840
83 Ga0466967_1696141 3300045976 Bacteria 629
84 Ga0495592_0036350 3300046454 Bacteria 3710
85 Ga0495651_0027543 3300046462 Bacteria 4427
86 Ga0495639_0141904 3300046475 Bacteria 1155
87 Ga0495664_0018596 3300046477 Bacteria 3985
88 Ga0495628_0030735 3300046516 Bacteria 4347
89 Ga0495652_0000728 3300046529 Bacteria 38187
90 Ga0495586_0088096 3300046535 Bacteria 1712
91 Ga0495587_0823604 3300046536 Bacteria 506
92 Ga0495645_0185760 3300046543 Bacteria 1420
93 Ga0495634_0027185 3300046642 Bacteria 3982
94 Ga0495635_0001851 3300046663 Bacteria 14330
95 Ga0495646_0181687 3300046680 Bacteria 1154
96 Ga0495624_0825884 3300046690 Bacteria 547
97 Ga0495600_0052722 3300046809 Bacteria 2656
98 Ga0495602_0711085 3300048088 Bacteria 681
99 Ga0496103_0888055 3300048906 Bacteria 559
100 Ga0496104_0304368 3300048907 Bacteria 1506
101 Ga0496109_1092659 3300048912 Bacteria 735
102 Ga0496113_0359245 3300048916 Bacteria 1169
103 Ga0496114_0100966 3300048917 Bacteria 2462
104 Ga0496114_0186639 3300048917 Bacteria 1812
105 Ga0496117_0252266 3300048920 Bacteria 961
106 Ga0496118_0044599 3300048921 Bacteria 3470
107 Ga0496119_0161052 3300048922 Bacteria 1193
108 Ga0496125_0000086 3300048928 Bacteria 216489
109 Ga0496125_0004973 3300048928 Bacteria 15032
110 Ga0496126_0025964 3300048929 Bacteria 5624
111 Ga0501031_0189697 3300049568 Bacteria 1342
112 Ga0501032_0000229 3300049569 Bacteria 46549
113 Ga0501032_0029410 3300049569 Bacteria 3770
114 Ga0501033_0000497 3300049570 Bacteria 37043
115 Ga0501033_0599168 3300049570 Bacteria 756
116 Ga0501034_0006947 3300049571 Bacteria 12098
117 Ga0501034_0708352 3300049571 Bacteria 905
118 Ga0501036_0002252 3300049572 Bacteria 15060
119 Ga0501036_0083264 3300049572 Bacteria 2704
120 Ga0501036_0573921 3300049572 Bacteria 937
121 Ga0501037_0577179 3300049573 Bacteria 757
122 Ga0501038_0000090 3300049574 Bacteria 77766
123 Ga0501038_0192014 3300049574 Bacteria 1643
124 Ga0501038_0397098 3300049574 Bacteria 1067
125 Ga0501039_0007123 3300049575 Bacteria 8520
126 Ga0501039_0122678 3300049575 Bacteria 2037
127 Ga0501039_0171124 3300049575 Bacteria 1708
128 Ga0501040_0068423 3300049576 Bacteria 2449
129 Ga0501040_0120089 3300049576 Bacteria 1844
130 Ga0501040_0575062 3300049576 Bacteria 814
131 Ga0501041_0109625 3300049577 Bacteria 1712
132 Ga0501041_0236792 3300049577 Bacteria 1147
133 Ga0501041_0430931 3300049577 Bacteria 837
134 Ga0501042_0367453 3300049578 Bacteria 1041
135 Ga0501042_0405241 3300049578 Bacteria 988
136 Ga0501042_0643924 3300049578 Bacteria 770
137 Ga0501043_0002200 3300049579 Bacteria 16615
138 Ga0501043_0337528 3300049579 Bacteria 1147
139 Ga0501043_1038633 3300049579 Bacteria 582
140 Ga0501046_0000349 3300049580 Bacteria 46299
141 Ga0501047_0000278 3300049581 Bacteria 59271
142 Ga0501047_0004143 3300049581 Bacteria 13651
143 Ga0501047_1049018 3300049581 Bacteria 628
144 Ga0501048_0000105 3300049582 Bacteria 46603
145 Ga0501048_0047229 3300049582 Bacteria 3072
146 Ga0501048_0196023 3300049582 Bacteria 1432
147 Ga0501048_0309170 3300049582 Bacteria 1125
148 Ga0501048_0320405 3300049582 Bacteria 1104
149 Ga0501068_0017580 3300049584 Bacteria 4138
150 Ga0501069_0000273 3300049585 Bacteria 23416
151 Ga0501070_0003508 3300049586 Bacteria 13570
152 Ga0501070_0006178 3300049586 Bacteria 10205
153 Ga0501070_0018604 3300049586 Bacteria 5828
154 Ga0501071_0006652 3300049587 Bacteria 7510
155 Ga0501071_0421152 3300049587 Bacteria 1020
156 Ga0501071_1595413 3300049587 Bacteria 504
157 Ga0501072_0184376 3300049588 Bacteria 1665
158 Ga0501072_0339924 3300049588 Bacteria 1192
159 Ga0501073_0015229 3300049589 Bacteria 5578
160 Ga0501074_0002543 3300049590 Bacteria 12722
161 Ga0501074_0426023 3300049590 Bacteria 941
162 Ga0501075_0224248 3300049591 Bacteria 1434
163 Ga0501075_0454116 3300049591 Bacteria 977
164 Ga0501076_0106856 3300049592 Bacteria 2260
165 Ga0501076_0290299 3300049592 Bacteria 1340
166 Ga0501077_0540031 3300049593 Bacteria 748
167 Ga0501077_0567312 3300049593 Bacteria 729
168 Ga0501080_0000473 3300049742 Bacteria 31252
169 Ga0501080_0021437 3300049742 Bacteria 5981
170 Ga0501080_0520958 3300049742 Bacteria 1061
171 Ga0501081_0815441 3300049743 Bacteria 703
172 Ga0501083_0017167 3300049744 Bacteria 5048
173 Ga0501035_0000439 3300049822 Bacteria 46581
174 Ga0501035_0404711 3300049822 Bacteria 1135
175 Ga0501044_0006358 3300049823 Bacteria 13058
176 Ga0501044_0023490 3300049823 Bacteria 6558
177 Ga0501045_0045091 3300049824 Bacteria 3211
178 Ga0501045_0882279 3300049824 Bacteria 657
179 Ga0501045_1236015 3300049824 Bacteria 545
180 nmdc:mga00v17_146519_c1 3300050491 Bacteria 1515
181 Ga0495601_0041804 3300053077 Bacteria 2874
182 Ga0495601_0157869 3300053077 Bacteria 1481
183 Ga0495601_0614744 3300053077 Bacteria 697
184 Ga0495619_0214293 3300053085 Bacteria 1334
185 Ga0495619_0340856 3300053085 Bacteria 1037
186 Ga0500573_0072241 3300053140 Bacteria 1967
187 Ga0501084_0003909 3300054114 Bacteria 12131
188 Ga0501084_0064551 3300054114 Bacteria 3064
189 Ga0501082_0088076 3300060353 Bacteria 2679
190 Ga0501082_1124026 3300060353 Bacteria 687
191 Ga0530510_0344605 3300061734 Bacteria 1119
192 2643824183 2643221561 Bacteria 4984412
193 2644082346 2643221613 Bacteria 4622396
194 2644533487 2643221696 Bacteria 5431823
195 2644667031 2643221721 Bacteria 4486924
196 2729906643 2728369276 Bacteria 5610032
197 2738693759 2738541272 Bacteria 6848551
198 2739328141 2738543027 Bacteria 6409078
199 2760304688 2758568522 Bacteria 5953541
200 2760621497 2758568621 Bacteria 5967089
201 2774394600 2773857762 Bacteria 5971770
202 2804845498 2802429296 Bacteria 7227771
203 2809194550 2808606439 Bacteria 5952208
204 2812349296 2811994878 Bacteria 5992952
205 2819742293 2818991472 Bacteria 10089953
206 2839987139 2839986021 Bacteria 3685650
207 2932432234 2932431166 Bacteria 4215299
208 2935893576 2935890801 Bacteria 4593001
209 2984579032 2984576629 Bacteria 4248407
210 2990260351 2990256926 Bacteria 4252839
211 3006427987 3006425503 Bacteria 6491253
212 8025417202 8025413630 Bacteria 7014048
213 8056583214 8056579771 Bacteria 5840325
214 Ga0501080_0168480
215 Ga0007423J48922_100268
216 Ga0070682_100758903
217 Ga0070668_102283668
218 Ga0070667_100258298
219 Ga0075364_10126809
220 Ga0075367_10487205
221 Ga0207664_10526538
222 Ga0207658_10207965
223 Ga0207708_10079034
224 Ga0207648_11022090
225 Ga0207675_100138161
226 Ga0207683_10666993
227 Ga0307517_10068932
228 Ga0314311_1032588
229 Ga0316179_1009982
230 Ga0316181_1099827
231 Ga0307509_10010929
232 Ga0307408_100245586
233 Ga0307516_10392024
234 Ga0307405_10696190
235 Ga0307413_10530591
236 Ga0307413_10921587
237 Ga0307413_10973728
238 Ga0307413_11628455
239 Ga0307410_10133760
240 Ga0307410_10788923
241 Ga0307410_11848862
242 Ga0307406_10695000
243 Ga0307406_10708442
244 Ga0307409_100094589
245 Ga0307409_100770243
246 Ga0307416_100023427
247 Ga0307416_100179891
248 Ga0307416_101505902
249 Ga0307414_10338580
250 Ga0307411_10077802
251 Ga0307415_101379501
252 Ga0373943_0645915
253 Ga0373946_0692805
254 Ga0372808_049802
255 Ga0395901_0024562
256 Ga0451789_0550630
257 Ga0451791_0171072
258 Ga0451791_1096317
259 Ga0451793_0441183
260 Ga0451793_1314313
261 Ga0451797_1461800
262 Ga0451795_1160042
263 Ga0451807_0683576
264 Ga0451837_0510645
265 Ga0451837_1218452
266 Ga0451839_0299405
267 Ga0451839_0869251
268 Ga0451839_0907982
269 Ga0451849_0139025
270 Ga0451843_1393816
271 Ga0439456_170651
272 Ga0450888_037635
273 Ga0451577_0967080
274 Ga0466972_0076912
275 Ga0466972_0184649
276 Ga0466966_0031425
277 Ga0466966_0210461
278 Ga0466961_0394995
279 Ga0466963_0023309
280 Ga0466963_0035713
281 Ga0466971_0247434
282 Ga0466970_0024647
283 Ga0466970_0108766
284 Ga0466970_0211169
285 Ga0466970_0596012
286 Ga0466957_0004726
287 Ga0466957_0587809
288 Ga0466960_0012495
289 Ga0466959_0073360
290 Ga0466959_0107118
291 Ga0466958_0487960
292 Ga0466967_0057425
293 Ga0466967_0646769
294 Ga0466967_0753030
295 Ga0466967_0983599
296 Ga0466967_1696141
297 Ga0495592_0036350
298 Ga0495651_0027543
299 Ga0495639_0141904
300 Ga0495664_0018596
301 Ga0495628_0030735
302 Ga0495652_0000728
303 Ga0495586_0088096
304 Ga0495587_0823604
305 Ga0495645_0185760
306 Ga0495634_0027185
307 Ga0495635_0001851
308 Ga0495646_0181687
309 Ga0495624_0825884
310 Ga0495600_0052722
311 Ga0495602_0711085
312 Ga0496103_0888055
313 Ga0496104_0304368
314 Ga0496109_1092659
315 Ga0496113_0359245
316 Ga0496114_0100966
317 Ga0496114_0186639
318 Ga0496117_0252266
319 Ga0496118_0044599
320 Ga0496119_0161052
321 Ga0496125_0000086
322 Ga0496125_0004973
323 Ga0496126_0025964
324 Ga0501031_0189697
325 Ga0501032_0000229
326 Ga0501032_0029410
327 Ga0501033_0000497
328 Ga0501033_0599168
329 Ga0501034_0006947
330 Ga0501034_0708352
331 Ga0501036_0002252
332 Ga0501036_0083264
333 Ga0501036_0573921
334 Ga0501037_0577179
335 Ga0501038_0000090
336 Ga0501038_0192014
337 Ga0501038_0397098
338 Ga0501039_0007123
339 Ga0501039_0122678
340 Ga0501039_0171124
341 Ga0501040_0068423
342 Ga0501040_0120089
343 Ga0501040_0575062
344 Ga0501041_0109625
345 Ga0501041_0236792
346 Ga0501041_0430931
347 Ga0501042_0367453
348 Ga0501042_0405241
349 Ga0501042_0643924
350 Ga0501043_0002200
351 Ga0501043_0337528
352 Ga0501043_1038633
353 Ga0501046_0000349
354 Ga0501047_0000278
355 Ga0501047_0004143
356 Ga0501047_1049018
357 Ga0501048_0000105
358 Ga0501048_0047229
359 Ga0501048_0196023
360 Ga0501048_0309170
361 Ga0501048_0320405
362 Ga0501068_0017580
363 Ga0501069_0000273
364 Ga0501070_0003508
365 Ga0501070_0006178
366 Ga0501070_0018604
367 Ga0501071_0006652
368 Ga0501071_0421152
369 Ga0501071_1595413
370 Ga0501072_0184376
371 Ga0501072_0339924
372 Ga0501073_0015229
373 Ga0501074_0002543
374 Ga0501074_0426023
375 Ga0501075_0224248
376 Ga0501075_0454116
377 Ga0501076_0106856
378 Ga0501076_0290299
379 Ga0501077_0540031
380 Ga0501077_0567312
381 Ga0501080_0000473
382 Ga0501080_0021437
383 Ga0501080_0520958
384 Ga0501081_0815441
385 Ga0501083_0017167
386 Ga0501035_0000439
387 Ga0501035_0404711
388 Ga0501044_0006358
389 Ga0501044_0023490
390 Ga0501045_0045091
391 Ga0501045_0882279
392 Ga0501045_1236015
393 nmdc:mga00v17_146519_c1
394 Ga0495601_0041804
395 Ga0495601_0157869
396 Ga0495601_0614744
397 Ga0495619_0214293
398 Ga0495619_0340856
399 Ga0500573_0072241
400 Ga0501084_0003909
401 Ga0501084_0064551
402 Ga0501082_0088076
403 Ga0501082_1124026
404 Ga0530510_0344605
405 2643824183
406 2644082346
407 2644533487
408 2644667031
409 2729906643
410 2738693759
411 2739328141
412 2760304688
413 2760621497
414 2774394600
415 2804845498
416 2809194550
417 2812349296
418 2819742293
419 2839987139
420 2932432234
421 2935893576
422 2984579032
423 2990260351
424 3006427987
425 8025417202
426 8056583214

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01648

ACPS

4'-phosphopantetheinyl transferase superfamily

4

110

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wds-assembly1.cif.gz_A crystal structure of the streptomyces coelicolor h110a acps mutant in complex with cofactor coa at 1.3 a 0.9573 2 115
2wdy-assembly1.cif.gz_A crystal structure of the streptomyces coelicolor d111a acps mutant in complex with cofactor coa at 1.4 a 0.9568 2 114
2wds-assembly1.cif.gz_A crystal structure of the streptomyces coelicolor h110a acps mutant in complex with cofactor coa at 1.3 a 0.9258 2 115
2wdy-assembly1.cif.gz_A crystal structure of the streptomyces coelicolor d111a acps mutant in complex with cofactor coa at 1.4 a 0.9174 2 114
5xuh-assembly1.cif.gz_C crystal structure of escherichia coli holo-[acyl-carrier-protein] synthase (acps) d9a mutant in complex with coa 0.9161 1 115
ID Description Score Start End Superfamily
2wdyA00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.9568 2 114 3.90.470.20
2wdyA00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.9174 2 114 3.90.470.20
5cmoC00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.8896 1 116 3.90.470.20
5cmoC00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.8757 1 116 3.90.470.20
5xuhB00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.868 1 115 3.90.470.20
ID Description Score Start End GO Terms
AF-A0A1J5QN89-F1-model_v4 Holo-[acyl-carrier-protein] synthase (EC 2.7.8.7) 0.9939 1 117 GO:0000287
GO:0006633
GO:0008897
AF-A0A1J5QN89-F1-model_v4 Holo-[acyl-carrier-protein] synthase (EC 2.7.8.7) 0.9855 1 117 GO:0000287
GO:0006633
GO:0008897
AF-A0A2T7TLV7-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9814 1 117 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-A0A5A7NME8-F1-model_v4 4'-phosphopantetheinyl transferase domain-containing protein 0.9794 10 116 GO:0000287
GO:0006633
GO:0008897
AF-A0A849HJW6-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.979 1 115 GO:0000287
GO:0005737
GO:0006633
GO:0008897

Map