F324401

General Info

Members Datasets Scaffolds Average Seq Length
213 131 426 251

Family's Representative Sequence

Representative Sequence 3300046516|Ga0495628_0279835|Ga0495628_0279835_103_936
Length 277
Sequence MVRCPGIAKRGELEKAPLFSGLPSIIYLRPFNMNSALIIVPTYNERENIRLLTQRLLNLPVSVDLLVVDGNSTDGTSQLADELASKDPTIHVLHEKEKKGLGRAYIAGFKWALERGYEFIFEMDGDLSHNPDDVPAFLKAAENADLVLGTRYSNGSVRVVNWPLKRLILSRGAGYYVRIITGMPFSDPTGGYKCFRRRALQAIALDKIQSNGYSFQIEMTHRLWRQGLKVAEVPIVFTDREHGQSKMSKAIVREALWMVWRLWLQNGMRRWPRVRAK

Samples

Sample ID Description Type Environment
1 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
58 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
59 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
60 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
61 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
62 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
63 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
64 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
65 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
66 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
67 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
68 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
69 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
70 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
71 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
72 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
73 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
74 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
75 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
76 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
82 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
83 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
84 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
85 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
86 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
87 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
88 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
89 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
90 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
91 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
92 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
93 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
94 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
97 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
98 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
99 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
100 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
101 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
102 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
103 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
104 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
105 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
106 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
107 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
108 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
109 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
110 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
111 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
112 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
113 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
114 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
115 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
116 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
117 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
118 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
119 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
120 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
128 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
129 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
130 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
131 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.53
Stem 0
Stem Tuber 0
Unclassified 19.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495628_0279835 3300046516 Unclassified 1239
2 rootH1_10124927 3300003323 Bacteria 4523
3 Ga0065707_10125126 3300005295 Bacteria 2030
4 Ga0065707_10247199 3300005295 Bacteria 1131
5 Ga0070670_100306738 3300005331 Unclassified 1389
6 Ga0070680_100386300 3300005336 Bacteria 1192
7 Ga0068868_100109068 3300005338 Bacteria 2248
8 Ga0070689_100005026 3300005340 Bacteria 8990
9 Ga0070689_100021287 3300005340 Bacteria 4825
10 Ga0070689_100071574 3300005340 Bacteria 2709
11 Ga0070689_100268681 3300005340 Unclassified 1411
12 Ga0070688_100011494 3300005365 Bacteria 4918
13 Ga0070688_100311301 3300005365 Bacteria 1141
14 Ga0070714_100005217 3300005435 Bacteria 9889
15 Ga0070713_100265879 3300005436 Bacteria 1569
16 Ga0070711_100008141 3300005439 Bacteria 6410
17 Ga0070700_100111612 3300005441 Unclassified 1819
18 Ga0070694_100426836 3300005444 Bacteria 1042
19 Ga0070708_100058291 3300005445 Bacteria 3440
20 Ga0070685_10116006 3300005466 Bacteria 1657
21 Ga0070706_100384958 3300005467 Bacteria 1306
22 Ga0068853_100408937 3300005539 Unclassified 1271
23 Ga0070686_100009924 3300005544 Bacteria 5355
24 Ga0070686_100322780 3300005544 Bacteria 1152
25 Ga0068855_100047676 3300005563 Bacteria 5061
26 Ga0068855_100092607 3300005563 Bacteria 3485
27 Ga0068855_100252299 3300005563 Unclassified 1967
28 Ga0068857_100047335 3300005577 Unclassified 3818
29 Ga0068857_100144079 3300005577 Bacteria 2155
30 Ga0068856_100001157 3300005614 Bacteria 27739
31 Ga0068859_100244987 3300005617 Bacteria 1882
32 Ga0068859_100588404 3300005617 Bacteria 1206
33 Ga0068859_100667147 3300005617 Bacteria 1131
34 Ga0068864_100367056 3300005618 Unclassified 1361
35 Ga0068863_100128811 3300005841 Bacteria 2415
36 Ga0068863_100459522 3300005841 Bacteria 1250
37 Ga0068858_100413147 3300005842 Bacteria 1297
38 Ga0075428_100034960 3300006844 Bacteria 5540
39 Ga0075431_100063096 3300006847 Bacteria 3823
40 Ga0075431_100189445 3300006847 Unclassified 2108
41 Ga0075429_100126154 3300006880 Bacteria 2238
42 Ga0075436_100501544 3300006914 Bacteria 888
43 Ga0097620_100244986 3300006931 Bacteria 1882
44 Ga0097620_100588506 3300006931 Bacteria 1206
45 Ga0097620_100667133 3300006931 Bacteria 1131
46 Ga0105240_10041167 3300009093 Bacteria 5900
47 Ga0105240_10395684 3300009093 Bacteria 1557
48 Ga0111539_10004377 3300009094 Bacteria 18480
49 Ga0111539_10032852 3300009094 Bacteria 6301
50 Ga0111539_10647376 3300009094 Bacteria 1231
51 Ga0114129_10498174 3300009147 Bacteria 1591
52 Ga0105242_10111825 3300009176 Bacteria 2330
53 Ga0105242_10147887 3300009176 Unclassified 2045
54 Ga0105248_10088592 3300009177 Bacteria 3483
55 Ga0105248_10949507 3300009177 Unclassified 971
56 Ga0105238_10015736 3300009551 Bacteria 7659
57 Ga0105249_10187418 3300009553 Bacteria 2017
58 Ga0157374_10130837 3300013296 Bacteria 2429
59 Ga0157375_10000421 3300013308 Bacteria 38383
60 Ga0163163_10000067 3300014325 Bacteria 114831
61 Ga0163163_10020232 3300014325 Bacteria 6264
62 Ga0157379_10340086 3300014968 Unclassified 1372
63 Ga0207654_10267284 3300025911 Unclassified 1152
64 Ga0207695_10039795 3300025913 Bacteria 5049
65 Ga0207695_10622197 3300025913 Unclassified 961
66 Ga0207663_10028887 3300025916 Bacteria 3251
67 Ga0207694_10015567 3300025924 Bacteria 5735
68 Ga0207694_10025236 3300025924 Bacteria 4517
69 Ga0207694_10068752 3300025924 Unclassified 2766
70 Ga0207694_10077346 3300025924 Bacteria 2607
71 Ga0207700_10493636 3300025928 Unclassified 1083
72 Ga0207664_10002691 3300025929 Bacteria 11789
73 Ga0207686_10091929 3300025934 Bacteria 2005
74 Ga0207670_10002543 3300025936 Bacteria 9575
75 Ga0207670_10270668 3300025936 Bacteria 1320
76 Ga0207667_10023109 3300025949 Bacteria 6849
77 Ga0207667_10090372 3300025949 Bacteria 3164
78 Ga0207667_10101593 3300025949 Bacteria 2966
79 Ga0207677_10084706 3300026023 Bacteria 2286
80 Ga0207639_10083445 3300026041 Bacteria 2536
81 Ga0207708_10675101 3300026075 Unclassified 881
82 Ga0207702_10001093 3300026078 Bacteria 27743
83 Ga0207702_10134096 3300026078 Bacteria 2232
84 Ga0207702_10260978 3300026078 Bacteria 1631
85 Ga0207641_10369604 3300026088 Bacteria 1371
86 Ga0207674_10055429 3300026116 Unclassified 4030
87 Ga0207428_10114028 3300027907 Unclassified 2077
88 Ga0265337_1000269 3300028556 Bacteria 28329
89 Ga0265337_1003214 3300028556 Bacteria 7157
90 Ga0265337_1022020 3300028556 Unclassified 1979
91 Ga0265337_1028612 3300028556 Bacteria 1671
92 Ga0265326_10049027 3300028558 Unclassified 1197
93 Ga0265319_1036451 3300028563 Bacteria 1682
94 Ga0265334_10050809 3300028573 Unclassified 1591
95 Ga0265318_10039671 3300028577 Unclassified 1796
96 Ga0265322_10034401 3300028654 Bacteria 1444
97 Ga0265338_10000008 3300028800 Bacteria 481542
98 Ga0265338_10000305 3300028800 Bacteria 88659
99 Ga0265338_10016994 3300028800 Bacteria 7871
100 Ga0265338_10017923 3300028800 Bacteria 7605
101 Ga0265338_10022306 3300028800 Bacteria 6560
102 Ga0265338_10030818 3300028800 Bacteria 5271
103 Ga0265338_10041153 3300028800 Bacteria 4326
104 Ga0265338_10057472 3300028800 Bacteria 3441
105 Ga0265338_10057706 3300028800 Bacteria 3432
106 Ga0265338_10060127 3300028800 Unclassified 3341
107 Ga0265338_10074951 3300028800 Bacteria 2874
108 Ga0265338_10078094 3300028800 Bacteria 2794
109 Ga0265338_10215662 3300028800 Bacteria 1437
110 Ga0265338_10412508 3300028800 Bacteria 961
111 Ga0265324_10000727 3300029957 Bacteria 21946
112 Ga0265324_10009177 3300029957 Bacteria 3876
113 Ga0265324_10011710 3300029957 Unclassified 3335
114 Ga0265324_10027934 3300029957 Bacteria 1991
115 Ga0265324_10054910 3300029957 Bacteria 1366
116 Ga0265320_10008373 3300031240 Bacteria 6332
117 Ga0265329_10001611 3300031242 Bacteria 10830
118 Ga0265340_10030152 3300031247 Bacteria 2720
119 Ga0265340_10041403 3300031247 Unclassified 2265
120 Ga0265339_10035754 3300031249 Bacteria 2784
121 Ga0265339_10172056 3300031249 Unclassified 1083
122 Ga0265331_10047483 3300031250 Bacteria 2066
123 Ga0265331_10135048 3300031250 Bacteria 1124
124 Ga0265327_10003925 3300031251 Bacteria 13635
125 Ga0265316_10064815 3300031344 Bacteria 2830
126 Ga0265316_10163568 3300031344 Unclassified 1663
127 Ga0265316_10242077 3300031344 Bacteria 1326
128 Ga0265314_10000020 3300031711 Bacteria 307052
129 Ga0265314_10024304 3300031711 Bacteria 4596
130 Ga0265342_10216876 3300031712 Unclassified 1032
131 Ga0316576_10192811 3300031727 Bacteria 1536
132 Ga0316578_10071824 3300031728 Bacteria 2050
133 Ga0307405_10268677 3300031731 Unclassified 1278
134 Ga0307409_100062800 3300031995 Bacteria 2910
135 Ga0307414_10302454 3300032004 Unclassified 1354
136 Ga0307411_10224517 3300032005 Unclassified 1460
137 Ga0373930_0029106 3300034816 Unclassified 1127
138 Ga0373938_0039256 3300034957 Bacteria 1046
139 Ga0373928_0000017 3300035084 Bacteria 29049
140 Ga0373929_0000620 3300035085 Bacteria 6836
141 Ga0373949_0001183 3300035090 Bacteria 7740
142 Ga0373932_0000003 3300035112 Bacteria 459351
143 Ga0373941_0148162 3300035115 Bacteria 859
144 Ga0373946_0039210 3300035171 Bacteria 1933
145 Ga0373942_0109698 3300035207 Unclassified 852
146 Ga0373962_0000829 3300035242 Bacteria 7055
147 Ga0373931_0000054 3300035691 Bacteria 58930
148 Ga0373935_0101083 3300035692 Bacteria 1901
149 Ga0373935_0197929 3300035692 Bacteria 1387
150 Ga0373927_0031774 3300035695 Bacteria 3439
151 Ga0373927_0037642 3300035695 Bacteria 3143
152 Ga0373927_0209422 3300035695 Bacteria 1280
153 Ga0373947_0055622 3300035725 Bacteria 2390
154 Ga0373947_0108533 3300035725 Bacteria 1751
155 Ga0373937_0063912 3300036401 Bacteria 3385
156 Ga0373937_0287508 3300036401 Bacteria 1553
157 Ga0373925_0003667 3300037068 Bacteria 11820
158 Ga0373925_0046204 3300037068 Bacteria 3237
159 Ga0451577_0016174 3300042876 Bacteria 6915
160 Ga0451577_0021455 3300042876 Bacteria 5912
161 Ga0451577_0092993 3300042876 Bacteria 2693
162 Ga0451577_0349372 3300042876 Bacteria 1342
163 Ga0453684_0005584 3300044712 Bacteria 24781
164 Ga0453684_0010752 3300044712 Bacteria 15551
165 Ga0453684_0015647 3300044712 Bacteria 11963
166 Ga0453684_0034368 3300044712 Bacteria 7038
167 Ga0453684_0090576 3300044712 Unclassified 3779
168 Ga0451576_0047335 3300045051 Viruses 4522
169 Ga0451576_0118102 3300045051 Bacteria 2761
170 Ga0451576_0163896 3300045051 Bacteria 2320
171 Ga0451576_0257850 3300045051 Unclassified 1822
172 Ga0451576_0492046 3300045051 Bacteria 1288
173 Ga0495651_0120762 3300046462 Bacteria 1926
174 Ga0495653_0110440 3300046463 Bacteria 1976
175 Ga0495582_0018509 3300046473 Bacteria 3809
176 Ga0495618_0011197 3300046514 Bacteria 5436
177 Ga0495630_0000045 3300046517 Bacteria 102985
178 Ga0495630_0012283 3300046517 Bacteria 6214
179 Ga0495640_0078747 3300046533 Bacteria 2195
180 Ga0495586_0000005 3300046535 Bacteria 171839
181 Ga0495586_0032625 3300046535 Bacteria 2792
182 Ga0495587_0110760 3300046536 Unclassified 1577
183 Ga0495634_0178824 3300046642 Bacteria 1329
184 Ga0495657_0039028 3300046675 Bacteria 3265
185 Ga0495657_0276145 3300046675 Unclassified 1007
186 Ga0495599_0149171 3300046678 Bacteria 1449
187 Ga0495658_0029215 3300046683 Bacteria 2982
188 Ga0495613_0046351 3300046689 Bacteria 3215
189 Ga0495624_0106544 3300046690 Bacteria 1725
190 Ga0495581_0258680 3300047315 Bacteria 1018
191 Ga0495674_0001441 3300047319 Bacteria 23322
192 Ga0495674_0099910 3300047319 Unclassified 2470
193 Ga0495676_0005209 3300047321 Bacteria 11895
194 Ga0495676_0182845 3300047321 Bacteria 1468
195 Ga0495675_0010305 3300047444 Bacteria 5841
196 Ga0495675_0054595 3300047444 Bacteria 2535
197 Ga0495684_0100582 3300047471 Bacteria 2186
198 Ga0495684_0192139 3300047471 Unclassified 1509
199 Ga0495602_0138977 3300048088 Unclassified 1926
200 Ga0501032_0109653 3300049569 Bacteria 1827
201 Ga0501033_0100653 3300049570 Bacteria 2109
202 Ga0501034_0298224 3300049571 Bacteria 1549
203 Ga0501037_0118119 3300049573 Bacteria 1908
204 Ga0501043_0152077 3300049579 Bacteria 1811
205 Ga0501035_0383688 3300049822 Bacteria 1171
206 Ga0501044_0010636 3300049823 Bacteria 9982
207 nmdc:mga09592_136214_c1 3300050508 Bacteria 2115
208 nmdc:mga06r32_24955_c1 3300050510 Bacteria 5554
209 nmdc:mga08y16_104423_c1 3300050511 Bacteria 2949
210 nmdc:mga08y16_154994_c1 3300050511 Unclassified 2380
211 nmdc:mga08y16_7652_c1 3300050511 Bacteria 11307
212 nmdc:mga0rr50_88105_c1 3300050513 Bacteria 2410
213 nmdc:mga08x19_235509_c1 3300050514 Bacteria 1261
214 Ga0495628_0279835
215 rootH1_10124927
216 Ga0065707_10125126
217 Ga0065707_10247199
218 Ga0070670_100306738
219 Ga0070680_100386300
220 Ga0068868_100109068
221 Ga0070689_100005026
222 Ga0070689_100021287
223 Ga0070689_100071574
224 Ga0070689_100268681
225 Ga0070688_100011494
226 Ga0070688_100311301
227 Ga0070714_100005217
228 Ga0070713_100265879
229 Ga0070711_100008141
230 Ga0070700_100111612
231 Ga0070694_100426836
232 Ga0070708_100058291
233 Ga0070685_10116006
234 Ga0070706_100384958
235 Ga0068853_100408937
236 Ga0070686_100009924
237 Ga0070686_100322780
238 Ga0068855_100047676
239 Ga0068855_100092607
240 Ga0068855_100252299
241 Ga0068857_100047335
242 Ga0068857_100144079
243 Ga0068856_100001157
244 Ga0068859_100244987
245 Ga0068859_100588404
246 Ga0068859_100667147
247 Ga0068864_100367056
248 Ga0068863_100128811
249 Ga0068863_100459522
250 Ga0068858_100413147
251 Ga0075428_100034960
252 Ga0075431_100063096
253 Ga0075431_100189445
254 Ga0075429_100126154
255 Ga0075436_100501544
256 Ga0097620_100244986
257 Ga0097620_100588506
258 Ga0097620_100667133
259 Ga0105240_10041167
260 Ga0105240_10395684
261 Ga0111539_10004377
262 Ga0111539_10032852
263 Ga0111539_10647376
264 Ga0114129_10498174
265 Ga0105242_10111825
266 Ga0105242_10147887
267 Ga0105248_10088592
268 Ga0105248_10949507
269 Ga0105238_10015736
270 Ga0105249_10187418
271 Ga0157374_10130837
272 Ga0157375_10000421
273 Ga0163163_10000067
274 Ga0163163_10020232
275 Ga0157379_10340086
276 Ga0207654_10267284
277 Ga0207695_10039795
278 Ga0207695_10622197
279 Ga0207663_10028887
280 Ga0207694_10015567
281 Ga0207694_10025236
282 Ga0207694_10068752
283 Ga0207694_10077346
284 Ga0207700_10493636
285 Ga0207664_10002691
286 Ga0207686_10091929
287 Ga0207670_10002543
288 Ga0207670_10270668
289 Ga0207667_10023109
290 Ga0207667_10090372
291 Ga0207667_10101593
292 Ga0207677_10084706
293 Ga0207639_10083445
294 Ga0207708_10675101
295 Ga0207702_10001093
296 Ga0207702_10134096
297 Ga0207702_10260978
298 Ga0207641_10369604
299 Ga0207674_10055429
300 Ga0207428_10114028
301 Ga0265337_1000269
302 Ga0265337_1003214
303 Ga0265337_1022020
304 Ga0265337_1028612
305 Ga0265326_10049027
306 Ga0265319_1036451
307 Ga0265334_10050809
308 Ga0265318_10039671
309 Ga0265322_10034401
310 Ga0265338_10000008
311 Ga0265338_10000305
312 Ga0265338_10016994
313 Ga0265338_10017923
314 Ga0265338_10022306
315 Ga0265338_10030818
316 Ga0265338_10041153
317 Ga0265338_10057472
318 Ga0265338_10057706
319 Ga0265338_10060127
320 Ga0265338_10074951
321 Ga0265338_10078094
322 Ga0265338_10215662
323 Ga0265338_10412508
324 Ga0265324_10000727
325 Ga0265324_10009177
326 Ga0265324_10011710
327 Ga0265324_10027934
328 Ga0265324_10054910
329 Ga0265320_10008373
330 Ga0265329_10001611
331 Ga0265340_10030152
332 Ga0265340_10041403
333 Ga0265339_10035754
334 Ga0265339_10172056
335 Ga0265331_10047483
336 Ga0265331_10135048
337 Ga0265327_10003925
338 Ga0265316_10064815
339 Ga0265316_10163568
340 Ga0265316_10242077
341 Ga0265314_10000020
342 Ga0265314_10024304
343 Ga0265342_10216876
344 Ga0316576_10192811
345 Ga0316578_10071824
346 Ga0307405_10268677
347 Ga0307409_100062800
348 Ga0307414_10302454
349 Ga0307411_10224517
350 Ga0373930_0029106
351 Ga0373938_0039256
352 Ga0373928_0000017
353 Ga0373929_0000620
354 Ga0373949_0001183
355 Ga0373932_0000003
356 Ga0373941_0148162
357 Ga0373946_0039210
358 Ga0373942_0109698
359 Ga0373962_0000829
360 Ga0373931_0000054
361 Ga0373935_0101083
362 Ga0373935_0197929
363 Ga0373927_0031774
364 Ga0373927_0037642
365 Ga0373927_0209422
366 Ga0373947_0055622
367 Ga0373947_0108533
368 Ga0373937_0063912
369 Ga0373937_0287508
370 Ga0373925_0003667
371 Ga0373925_0046204
372 Ga0451577_0016174
373 Ga0451577_0021455
374 Ga0451577_0092993
375 Ga0451577_0349372
376 Ga0453684_0005584
377 Ga0453684_0010752
378 Ga0453684_0015647
379 Ga0453684_0034368
380 Ga0453684_0090576
381 Ga0451576_0047335
382 Ga0451576_0118102
383 Ga0451576_0163896
384 Ga0451576_0257850
385 Ga0451576_0492046
386 Ga0495651_0120762
387 Ga0495653_0110440
388 Ga0495582_0018509
389 Ga0495618_0011197
390 Ga0495630_0000045
391 Ga0495630_0012283
392 Ga0495640_0078747
393 Ga0495586_0000005
394 Ga0495586_0032625
395 Ga0495587_0110760
396 Ga0495634_0178824
397 Ga0495657_0039028
398 Ga0495657_0276145
399 Ga0495599_0149171
400 Ga0495658_0029215
401 Ga0495613_0046351
402 Ga0495624_0106544
403 Ga0495581_0258680
404 Ga0495674_0001441
405 Ga0495674_0099910
406 Ga0495676_0005209
407 Ga0495676_0182845
408 Ga0495675_0010305
409 Ga0495675_0054595
410 Ga0495684_0100582
411 Ga0495684_0192139
412 Ga0495602_0138977
413 Ga0501032_0109653
414 Ga0501033_0100653
415 Ga0501034_0298224
416 Ga0501037_0118119
417 Ga0501043_0152077
418 Ga0501035_0383688
419 Ga0501044_0010636
420 nmdc:mga09592_136214_c1
421 nmdc:mga06r32_24955_c1
422 nmdc:mga08y16_104423_c1
423 nmdc:mga08y16_154994_c1
424 nmdc:mga08y16_7652_c1
425 nmdc:mga0rr50_88105_c1
426 nmdc:mga08x19_235509_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

37

204

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mm1-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose 0.8806 4 235
5mm0-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) 0.8798 4 234
5eke-assembly1.cif.gz_A structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) 0.8386 4 203
5mm0-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) 0.8221 4 234
5mm1-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose 0.8086 4 235
ID Description Score Start End Superfamily
af_O53493_586_855_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9519 1 235 3.90.550.10
af_O53493_586_855_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9176 1 235 3.90.550.10
af_A4ICW5_2_228_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8717 4 226 3.90.550.10
af_A0A0R0GWU7_24_252_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8603 4 223 3.90.550.10
af_A4ICW5_2_228_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8537 4 226 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A3D4G0G2-F1-model_v4 Dolichyl-phosphate beta-D-mannosyltransferase 0.9857 2 207 GO:0004582
GO:0009247
GO:0016020
AF-A0A348TT88-F1-model_v4 Dolichyl-phosphate beta-D-mannosyltransferase 0.9832 58 202 GO:0004582
GO:0009247
GO:0016020
AF-A0A660ZDY2-F1-model_v4 Polyprenol monophosphomannose synthase 0.983 1 235 GO:0004582
GO:0009247
GO:0016020
AF-A0A1H4RIJ4-F1-model_v4 Dolichol-phosphate mannosyltransferase 0.9782 1 232 GO:0004582
GO:0009247
GO:0016020
AF-A0A511T1F8-F1-model_v4 Lipid-A-disaccharide synthase (EC 2.4.1.182) 0.9757 1 231 GO:0004582
GO:0005543
GO:0008915
GO:0009245
GO:0016020

Map