F324330

General Info

Members Datasets Scaffolds Average Seq Length
213 159 426 272

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0049575|Ga0466969_0049575_429_1220
Length 263
Sequence MPDYHDDLRLAHVLADSADSVTLDRFKALDLKVETKPDLTPVSDADKAAEDLVRSVLGRARPRDAVMGEEHGTTGHGPRRWVIDPIDGTKNYVRGVPVWASLIALLELGPEGEQPVVGIVSAPALGRRWWAAKGSGAYSGRSLARATRLRVSEVSRLGDASFSYSSLGGWEERGKLDAFLELSRACWRTRAYGDFWSYMMVAEGAVDIAAEPELSLWDMAAPCVVVTEAGGRFTGLDGVPGVHSGNAAASNGRLHEELLRRLG

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
40 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
44 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
68 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
69 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
70 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
71 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
72 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
75 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
76 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
77 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
83 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
84 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
85 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
86 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
87 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
88 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
89 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
90 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
91 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
92 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
93 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
94 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
99 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
100 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
101 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
102 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
103 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
104 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
105 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
106 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
107 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
108 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
109 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
110 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
111 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
112 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
113 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
114 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
115 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
116 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
119 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
127 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
128 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
129 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
130 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
131 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
132 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
133 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
134 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
135 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
136 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
137 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
139 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
140 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
141 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
142 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
143 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
144 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
145 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
146 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
147 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
148 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
149 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
150 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
151 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
152 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
153 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
154 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
155 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
156 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
157 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
158 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
159 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 92.96
Metatranscriptomes 2.35
Isolates 4.69

Biome Distribution

Category Percentage (%)
Aerial Root 0.94
Bulb 0
Endosphere 0.94
Nodule 0
Rhizoplane 4.69
Rhizosphere 89.67
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0049575 3300044656 Bacteria 2071
2 rootL2_10128290 3300003322 Bacteria 5262
3 Ga0070658_10001658 3300005327 Bacteria 18781
4 Ga0070683_100259117 3300005329 Bacteria 1654
5 Ga0070683_100294643 3300005329 Bacteria 1543
6 Ga0070680_100000111 3300005336 Bacteria 47136
7 Ga0070682_100049948 3300005337 Bacteria 2610
8 Ga0070691_10046519 3300005341 Bacteria 2061
9 Ga0070692_10075691 3300005345 Bacteria 1803
10 Ga0070674_100149163 3300005356 Bacteria 1763
11 Ga0070673_100288000 3300005364 Bacteria 1443
12 Ga0070713_100382405 3300005436 Bacteria 1312
13 Ga0070678_100249831 3300005456 Bacteria 1487
14 Ga0070681_10000299 3300005458 Bacteria 40221
15 Ga0068867_100056691 3300005459 Bacteria 2899
16 Ga0070698_100214051 3300005471 Bacteria 1861
17 Ga0070699_100000332 3300005518 Bacteria 45840
18 Ga0070679_100000736 3300005530 Bacteria 28309
19 Ga0070697_100014155 3300005536 Bacteria 6266
20 Ga0068853_100049919 3300005539 Bacteria 3598
21 Ga0070672_100034134 3300005543 Bacteria 3859
22 Ga0068856_100194781 3300005614 Bacteria 2040
23 Ga0070702_100009702 3300005615 Bacteria 4721
24 Ga0068852_100055903 3300005616 Bacteria 3408
25 Ga0068852_100116434 3300005616 Bacteria 2438
26 Ga0068870_10002134 3300005840 Bacteria 8185
27 Ga0081540_1004477 3300005983 Bacteria 10633
28 Ga0070717_10013512 3300006028 Bacteria 6260
29 Ga0075433_10028383 3300006852 Bacteria 4757
30 Ga0075434_100028737 3300006871 Bacteria 5467
31 Ga0075436_100008756 3300006914 Bacteria 6921
32 Ga0075435_100134246 3300007076 Bacteria 2072
33 Ga0099794_10030899 3300007265 Bacteria 2504
34 Ga0105245_10022692 3300009098 Bacteria 5508
35 Ga0105243_10022143 3300009148 Bacteria 4829
36 Ga0105241_10295586 3300009174 Bacteria 1388
37 Ga0105241_10498107 3300009174 Bacteria 1086
38 Ga0105248_10031551 3300009177 Bacteria 5921
39 Ga0105248_10211829 3300009177 Bacteria 2183
40 Ga0157370_10093178 3300013104 Bacteria 2827
41 Ga0157369_10216316 3300013105 Bacteria 2007
42 Ga0157369_10236533 3300013105 Bacteria 1908
43 Ga0157369_10425585 3300013105 Bacteria 1376
44 Ga0163163_10074320 3300014325 Bacteria 3391
45 Ga0157377_10009373 3300014745 Bacteria 4800
46 Ga0197907_11251869 3300020069 Bacteria 3847
47 Ga0206354_10041318 3300020081 Bacteria 1496
48 Ga0206353_10903442 3300020082 Bacteria 5621
49 Ga0206353_10989779 3300020082 Bacteria 10604
50 Ga0213875_10036361 3300021388 Bacteria 2322
51 Ga0224712_10064876 3300022467 Bacteria 1466
52 Ga0207688_10008787 3300025901 Bacteria 5496
53 Ga0207643_10009779 3300025908 Bacteria 5149
54 Ga0207705_10003618 3300025909 Bacteria 11772
55 Ga0207684_10019858 3300025910 Bacteria 5744
56 Ga0207707_10000341 3300025912 Bacteria 49363
57 Ga0207660_10002994 3300025917 Bacteria 11064
58 Ga0207652_10000143 3300025921 Bacteria 76508
59 Ga0207652_10022061 3300025921 Bacteria 5263
60 Ga0207646_10013016 3300025922 Bacteria 7969
61 Ga0207690_10670532 3300025932 Bacteria 851
62 Ga0207709_10012009 3300025935 Bacteria 4776
63 Ga0207691_10002791 3300025940 Bacteria 17029
64 Ga0207661_10082384 3300025944 Bacteria 2660
65 Ga0207661_10141798 3300025944 Bacteria 2069
66 Ga0207651_10049579 3300025960 Bacteria 2846
67 Ga0207677_10091017 3300026023 Bacteria 2218
68 Ga0207639_10314284 3300026041 Bacteria 1389
69 Ga0207708_10002155 3300026075 Bacteria 14535
70 Ga0207702_10263110 3300026078 Bacteria 1625
71 Ga0207648_10022374 3300026089 Bacteria 5678
72 Ga0207675_100025793 3300026118 Bacteria 5469
73 Ga0207698_10116073 3300026142 Bacteria 2256
74 Ga0207428_10137935 3300027907 Bacteria 1864
75 Ga0268266_10249870 3300028379 Bacteria 1640
76 Ga0307408_100105866 3300031548 Bacteria 2151
77 Ga0307410_10043472 3300031852 Bacteria 2978
78 Ga0307410_10050813 3300031852 Bacteria 2791
79 Ga0307410_10270082 3300031852 Bacteria 1330
80 Ga0307406_10027582 3300031901 Bacteria 3424
81 Ga0307406_10189458 3300031901 Bacteria 1504
82 Ga0307407_10057816 3300031903 Bacteria 2252
83 Ga0307407_10104415 3300031903 Bacteria 1766
84 Ga0307407_10207611 3300031903 Bacteria 1317
85 Ga0307412_10264552 3300031911 Bacteria 1343
86 Ga0307409_100071619 3300031995 Bacteria 2757
87 Ga0307409_100120057 3300031995 Bacteria 2224
88 Ga0307409_100149420 3300031995 Bacteria 2026
89 Ga0307409_100180071 3300031995 Bacteria 1870
90 Ga0307416_100138740 3300032002 Bacteria 2205
91 Ga0307416_100388614 3300032002 Bacteria 1428
92 Ga0307416_100528811 3300032002 Bacteria 1249
93 Ga0307416_100727689 3300032002 Bacteria 1083
94 Ga0307414_10045323 3300032004 Bacteria 3011
95 Ga0307411_10262240 3300032005 Bacteria 1365
96 Ga0307415_100121220 3300032126 Bacteria 1961
97 Ga0307415_100158214 3300032126 Bacteria 1753
98 Ga0307415_100232620 3300032126 Bacteria 1485
99 Ga0395899_0010927 3300037312 Bacteria 6956
100 Ga0395900_0040772 3300037418 Bacteria 4785
101 Ga0395900_0072804 3300037418 Bacteria 3532
102 Ga0395898_0004995 3300037466 Bacteria 14387
103 Ga0395898_0012461 3300037466 Bacteria 8790
104 Ga0395898_0058782 3300037466 Bacteria 3742
105 Ga0395898_0361858 3300037466 Bacteria 1383
106 Ga0395905_0230669 3300037471 Bacteria 1731
107 Ga0395905_0320035 3300037471 Bacteria 1441
108 Ga0395901_0004163 3300038443 Bacteria 14596
109 Ga0395901_0037439 3300038443 Bacteria 5017
110 Ga0395901_0232016 3300038443 Bacteria 1926
111 Ga0395901_0729941 3300038443 Bacteria 985
112 Ga0400486_23067 3300038742 Bacteria 58321
113 Ga0436363_1229971 3300039450 Bacteria 1747
114 Ga0439431_0038092 3300041997 Bacteria 1216
115 Ga0439442_006349 3300042002 Bacteria 2373
116 Ga0439449_0118074 3300042007 Bacteria 984
117 Ga0466972_0115644 3300044658 Bacteria 1266
118 Ga0466966_0027375 3300044684 Bacteria 3717
119 Ga0466961_0021157 3300044693 Bacteria 4187
120 Ga0466961_0024746 3300044693 Bacteria 3862
121 Ga0466961_0133538 3300044693 Bacteria 1555
122 Ga0466961_0209839 3300044693 Bacteria 1202
123 Ga0466961_0230366 3300044693 Bacteria 1140
124 Ga0466963_0155590 3300044694 Bacteria 1589
125 Ga0466971_0011614 3300044719 Bacteria 3856
126 Ga0466970_0010029 3300044765 Bacteria 4798
127 Ga0466970_0187683 3300044765 Bacteria 1148
128 Ga0466970_0190175 3300044765 Bacteria 1140
129 Ga0466957_0078963 3300044842 Bacteria 2047
130 Ga0466957_0127270 3300044842 Bacteria 1628
131 Ga0466957_0176438 3300044842 Bacteria 1394
132 Ga0466960_0020016 3300044901 Bacteria 2958
133 Ga0466959_0002515 3300045049 Bacteria 11755
134 Ga0466958_0069864 3300045836 Bacteria 2148
135 Ga0466958_0076713 3300045836 Bacteria 2052
136 Ga0466958_0149804 3300045836 Bacteria 1471
137 Ga0466967_0006106 3300045976 Bacteria 8471
138 Ga0466967_0122057 3300045976 Bacteria 2409
139 Ga0466967_0272816 3300045976 Bacteria 1621
140 Ga0495603_0004324 3300046455 Bacteria 8474
141 Ga0495629_0002819 3300046459 Bacteria 13265
142 Ga0495662_0054891 3300046476 Bacteria 1925
143 Ga0495664_0076796 3300046477 Bacteria 1999
144 Ga0495644_0136649 3300046523 Bacteria 935
145 Ga0495645_0022271 3300046543 Bacteria 4583
146 Ga0495634_0136261 3300046642 Bacteria 1562
147 Ga0495623_0079421 3300046679 Bacteria 2032
148 Ga0495613_0003059 3300046689 Bacteria 12502
149 Ga0495613_0064168 3300046689 Bacteria 2687
150 Ga0495604_0062126 3300047317 Bacteria 2855
151 Ga0495676_0002047 3300047321 Bacteria 17746
152 Ga0495675_0015166 3300047444 Bacteria 4871
153 Ga0495685_011724 3300047447 Bacteria 2962
154 Ga0495614_0001937 3300048089 Bacteria 9093
155 Ga0496104_0095047 3300048907 Bacteria 2852
156 Ga0496105_0166028 3300048908 Bacteria 1811
157 Ga0496108_0245736 3300048911 Bacteria 1557
158 Ga0496110_0060310 3300048913 Bacteria 3345
159 Ga0496110_0457374 3300048913 Bacteria 1163
160 Ga0496110_0702407 3300048913 Bacteria 913
161 Ga0496111_0081592 3300048914 Bacteria 2361
162 Ga0496111_0177949 3300048914 Bacteria 1581
163 Ga0496114_0206137 3300048917 Bacteria 1723
164 Ga0496114_0220644 3300048917 Bacteria 1664
165 Ga0496126_0008682 3300048929 Bacteria 10916
166 Ga0501031_0042069 3300049568 Bacteria 2983
167 Ga0501034_0042080 3300049571 Bacteria 4623
168 Ga0501036_0047510 3300049572 Bacteria 3634
169 Ga0501038_0047035 3300049574 Bacteria 3739
170 Ga0501040_0016712 3300049576 Bacteria 4863
171 Ga0501040_0043853 3300049576 Bacteria 3049
172 Ga0501040_0074926 3300049576 Bacteria 2339
173 Ga0501041_0059448 3300049577 Bacteria 2339
174 Ga0501046_0119995 3300049580 Bacteria 2001
175 Ga0501067_0034064 3300049583 Bacteria 2826
176 Ga0501068_0109663 3300049584 Bacteria 1715
177 Ga0501069_0001080 3300049585 Bacteria 13107
178 Ga0501069_0017130 3300049585 Bacteria 3896
179 Ga0501070_0018996 3300049586 Bacteria 5765
180 Ga0501070_0407980 3300049586 Bacteria 1098
181 Ga0501070_0443884 3300049586 Bacteria 1046
182 Ga0501071_0020529 3300049587 Bacteria 4591
183 Ga0501072_0019636 3300049588 Bacteria 5226
184 Ga0501074_0027795 3300049590 Bacteria 4101
185 Ga0501075_0011275 3300049591 Bacteria 6324
186 Ga0501076_0036562 3300049592 Bacteria 3848
187 Ga0501080_0002831 3300049742 Bacteria 15248
188 Ga0501080_0146723 3300049742 Bacteria 2181
189 Ga0501083_0152459 3300049744 Bacteria 1513
190 Ga0501035_0021235 3300049822 Bacteria 5968
191 Ga0501044_0021446 3300049823 Bacteria 6891
192 Ga0501044_0259886 3300049823 Bacteria 1675
193 nmdc:mga0yw44_72172_c1 3300050492 Bacteria 2145
194 nmdc:mga08y16_55292_c1 3300050511 Bacteria 4148
195 nmdc:mga0n895_241403_c1 3300050512 Bacteria 1834
196 nmdc:mga0rr50_181515_c1 3300050513 Bacteria 1721
197 nmdc:mga08x19_12800_c1 3300050514 Bacteria 5060
198 nmdc:mga0a205_114288_c1 3300050515 Bacteria 2598
199 Ga0500600_0194184 3300053149 Bacteria 963
200 Ga0501084_0011534 3300054114 Bacteria 7317
201 Ga0501082_0063968 3300060353 Bacteria 3167
202 Ga0466962_0000234 3300061719 Bacteria 23125
203 Ga0530510_0028703 3300061734 Bacteria 3989
204 2623501648 2622736605 Bacteria 4992138
205 2644017561 2643221601 Bacteria 7493239
206 2644173478 2643221631 Bacteria 8168043
207 2812362092 2811994880 Bacteria 4147780
208 2819740771 2818991472 Bacteria 10089953
209 2827629244 2827628540 Bacteria 6858585
210 2919052172 2919051321 Bacteria 4210889
211 2946026355 2946024296 Bacteria 3508095
212 2984576901 2984576629 Bacteria 4248407
213 2990258649 2990256926 Bacteria 4252839
214 Ga0466969_0049575
215 rootL2_10128290
216 Ga0070658_10001658
217 Ga0070683_100259117
218 Ga0070683_100294643
219 Ga0070680_100000111
220 Ga0070682_100049948
221 Ga0070691_10046519
222 Ga0070692_10075691
223 Ga0070674_100149163
224 Ga0070673_100288000
225 Ga0070713_100382405
226 Ga0070678_100249831
227 Ga0070681_10000299
228 Ga0068867_100056691
229 Ga0070698_100214051
230 Ga0070699_100000332
231 Ga0070679_100000736
232 Ga0070697_100014155
233 Ga0068853_100049919
234 Ga0070672_100034134
235 Ga0068856_100194781
236 Ga0070702_100009702
237 Ga0068852_100055903
238 Ga0068852_100116434
239 Ga0068870_10002134
240 Ga0081540_1004477
241 Ga0070717_10013512
242 Ga0075433_10028383
243 Ga0075434_100028737
244 Ga0075436_100008756
245 Ga0075435_100134246
246 Ga0099794_10030899
247 Ga0105245_10022692
248 Ga0105243_10022143
249 Ga0105241_10295586
250 Ga0105241_10498107
251 Ga0105248_10031551
252 Ga0105248_10211829
253 Ga0157370_10093178
254 Ga0157369_10216316
255 Ga0157369_10236533
256 Ga0157369_10425585
257 Ga0163163_10074320
258 Ga0157377_10009373
259 Ga0197907_11251869
260 Ga0206354_10041318
261 Ga0206353_10903442
262 Ga0206353_10989779
263 Ga0213875_10036361
264 Ga0224712_10064876
265 Ga0207688_10008787
266 Ga0207643_10009779
267 Ga0207705_10003618
268 Ga0207684_10019858
269 Ga0207707_10000341
270 Ga0207660_10002994
271 Ga0207652_10000143
272 Ga0207652_10022061
273 Ga0207646_10013016
274 Ga0207690_10670532
275 Ga0207709_10012009
276 Ga0207691_10002791
277 Ga0207661_10082384
278 Ga0207661_10141798
279 Ga0207651_10049579
280 Ga0207677_10091017
281 Ga0207639_10314284
282 Ga0207708_10002155
283 Ga0207702_10263110
284 Ga0207648_10022374
285 Ga0207675_100025793
286 Ga0207698_10116073
287 Ga0207428_10137935
288 Ga0268266_10249870
289 Ga0307408_100105866
290 Ga0307410_10043472
291 Ga0307410_10050813
292 Ga0307410_10270082
293 Ga0307406_10027582
294 Ga0307406_10189458
295 Ga0307407_10057816
296 Ga0307407_10104415
297 Ga0307407_10207611
298 Ga0307412_10264552
299 Ga0307409_100071619
300 Ga0307409_100120057
301 Ga0307409_100149420
302 Ga0307409_100180071
303 Ga0307416_100138740
304 Ga0307416_100388614
305 Ga0307416_100528811
306 Ga0307416_100727689
307 Ga0307414_10045323
308 Ga0307411_10262240
309 Ga0307415_100121220
310 Ga0307415_100158214
311 Ga0307415_100232620
312 Ga0395899_0010927
313 Ga0395900_0040772
314 Ga0395900_0072804
315 Ga0395898_0004995
316 Ga0395898_0012461
317 Ga0395898_0058782
318 Ga0395898_0361858
319 Ga0395905_0230669
320 Ga0395905_0320035
321 Ga0395901_0004163
322 Ga0395901_0037439
323 Ga0395901_0232016
324 Ga0395901_0729941
325 Ga0400486_23067
326 Ga0436363_1229971
327 Ga0439431_0038092
328 Ga0439442_006349
329 Ga0439449_0118074
330 Ga0466972_0115644
331 Ga0466966_0027375
332 Ga0466961_0021157
333 Ga0466961_0024746
334 Ga0466961_0133538
335 Ga0466961_0209839
336 Ga0466961_0230366
337 Ga0466963_0155590
338 Ga0466971_0011614
339 Ga0466970_0010029
340 Ga0466970_0187683
341 Ga0466970_0190175
342 Ga0466957_0078963
343 Ga0466957_0127270
344 Ga0466957_0176438
345 Ga0466960_0020016
346 Ga0466959_0002515
347 Ga0466958_0069864
348 Ga0466958_0076713
349 Ga0466958_0149804
350 Ga0466967_0006106
351 Ga0466967_0122057
352 Ga0466967_0272816
353 Ga0495603_0004324
354 Ga0495629_0002819
355 Ga0495662_0054891
356 Ga0495664_0076796
357 Ga0495644_0136649
358 Ga0495645_0022271
359 Ga0495634_0136261
360 Ga0495623_0079421
361 Ga0495613_0003059
362 Ga0495613_0064168
363 Ga0495604_0062126
364 Ga0495676_0002047
365 Ga0495675_0015166
366 Ga0495685_011724
367 Ga0495614_0001937
368 Ga0496104_0095047
369 Ga0496105_0166028
370 Ga0496108_0245736
371 Ga0496110_0060310
372 Ga0496110_0457374
373 Ga0496110_0702407
374 Ga0496111_0081592
375 Ga0496111_0177949
376 Ga0496114_0206137
377 Ga0496114_0220644
378 Ga0496126_0008682
379 Ga0501031_0042069
380 Ga0501034_0042080
381 Ga0501036_0047510
382 Ga0501038_0047035
383 Ga0501040_0016712
384 Ga0501040_0043853
385 Ga0501040_0074926
386 Ga0501041_0059448
387 Ga0501046_0119995
388 Ga0501067_0034064
389 Ga0501068_0109663
390 Ga0501069_0001080
391 Ga0501069_0017130
392 Ga0501070_0018996
393 Ga0501070_0407980
394 Ga0501070_0443884
395 Ga0501071_0020529
396 Ga0501072_0019636
397 Ga0501074_0027795
398 Ga0501075_0011275
399 Ga0501076_0036562
400 Ga0501080_0002831
401 Ga0501080_0146723
402 Ga0501083_0152459
403 Ga0501035_0021235
404 Ga0501044_0021446
405 Ga0501044_0259886
406 nmdc:mga0yw44_72172_c1
407 nmdc:mga08y16_55292_c1
408 nmdc:mga0n895_241403_c1
409 nmdc:mga0rr50_181515_c1
410 nmdc:mga08x19_12800_c1
411 nmdc:mga0a205_114288_c1
412 Ga0500600_0194184
413 Ga0501084_0011534
414 Ga0501082_0063968
415 Ga0466962_0000234
416 Ga0530510_0028703
417 2623501648
418 2644017561
419 2644173478
420 2812362092
421 2819740771
422 2827629244
423 2919052172
424 2946026355
425 2984576901
426 2990258649

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00459

Inositol_P

Inositol monophosphatase family

3

263

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yht-assembly1.cif.gz_A crystal structure of a phosphatase from mycobacterium tuberculosis in complex with its substrate 0.9094 11 263
5yht-assembly1.cif.gz_B crystal structure of a phosphatase from mycobacterium tuberculosis in complex with its substrate 0.9073 12 263
5zon-assembly1.cif.gz_B histidinol phosphate phosphatase from mycobacterium tuberculosis 0.9009 11 263
5yht-assembly1.cif.gz_B crystal structure of a phosphatase from mycobacterium tuberculosis in complex with its substrate 0.9003 12 263
5zon-assembly2.cif.gz_D histidinol phosphate phosphatase from mycobacterium tuberculosis 0.9 11 263
ID Description Score Start End Superfamily
af_P95189_145_259_3.40.190.80 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9966 150 263 3.40.190.80
af_P95189_145_259_3.40.190.80 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9795 150 263 3.40.190.80
4n81A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9107 157 262 3.40.190.80
af_P95189_1_144_3.30.540.10 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9087 7 149 3.30.540.10
3luzB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9039 150 262 3.40.190.80
ID Description Score Start End GO Terms
AF-A0A4Y8XVL2-F1-model_v4 deleted 0.9853 130 230
AF-A0A4Y8XVL2-F1-model_v4 deleted 0.9758 130 230
AF-A0A535QF12-F1-model_v4 Histidinol phosphatase 0.9742 164 263 GO:0046854
GO:0046872
AF-A0A1J5Q9F8-F1-model_v4 Histidinol-phosphatase (EC 3.1.3.15) 0.9644 126 263 GO:0004401
AF-A0A6J7P8T3-F1-model_v4 histidinol-phosphatase (EC 3.1.3.15) (Histidinol-phosphate phosphatase) 0.9643 9 263 GO:0000105
GO:0004401
GO:0006020
GO:0007165
GO:0008934
GO:0046872

Map