F324266

General Info

Members Datasets Scaffolds Average Seq Length
213 159 210 176

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0134249|Ga0395899_0134249_285_881
Length 198
Sequence MPWKSISKTFANVTAANFAASSPDRTTARVRLRPTMSSDLDYVVSLEQAAENLPFITPWDKTQHEAAIRFPDFRHFIVEGGVDLTHVGFVILIGCRNPNQAIELKRMVIEAKGTGFGRAALRMTKKIAFDDLGAHRFWLDVKKRNSRAQALYSSEGFVVDGELREAVKTDAGFESLVVMSMLQSEFIGRRSLGLELRA

Samples

Sample ID Description Type Environment
1 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
2 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
3 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
4 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
54 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
76 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
77 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
78 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
79 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
83 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
84 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
85 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
86 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
87 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
88 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
89 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
90 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
91 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
92 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
93 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
94 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
97 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
98 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
102 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
103 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
104 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
105 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
106 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
107 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
108 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
109 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
110 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
111 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
112 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
116 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
117 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
118 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
119 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
120 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
121 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
122 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
123 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
127 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
128 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
144 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
145 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
146 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
147 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
148 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
149 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
153 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
154 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
155 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
156 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
157 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
158 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
159 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.59
Metatranscriptomes 0
Isolates 1.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.39
Nodule 0
Rhizoplane 7.98
Rhizosphere 79.34
Stem 0
Stem Tuber 0
Unclassified 3.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055540_1010222 3300003792 Bacteria 3140
2 Ga0055531_10000604 3300003794 Bacteria 31172
3 Ga0065707_10664476 3300005295 Bacteria 656
4 Ga0070658_10343988 3300005327 Bacteria 1276
5 Ga0070670_100061410 3300005331 Bacteria 3226
6 Ga0068869_100048508 3300005334 Bacteria 3071
7 Ga0070680_100126234 3300005336 Bacteria 2138
8 Ga0068868_100045906 3300005338 Bacteria 3419
9 Ga0068868_100495186 3300005338 Bacteria 1070
10 Ga0070660_100055520 3300005339 Bacteria 3060
11 Ga0070671_100548272 3300005355 Bacteria 997
12 Ga0070674_100333019 3300005356 Bacteria 1221
13 Ga0070714_100045185 3300005435 Bacteria 3732
14 Ga0070678_100189915 3300005456 Bacteria 1688
15 Ga0070678_101052219 3300005456 Bacteria 750
16 Ga0070681_10332456 3300005458 Bacteria 1429
17 Ga0070706_100082607 3300005467 Bacteria 2976
18 Ga0070679_100026495 3300005530 Bacteria 5696
19 Ga0070679_100157733 3300005530 Bacteria 2244
20 Ga0068855_100014376 3300005563 Bacteria 9530
21 Ga0068856_100390669 3300005614 Bacteria 1411
22 Ga0068856_100658129 3300005614 Bacteria 1068
23 Ga0068864_100352905 3300005618 Bacteria 1388
24 Ga0068863_100072022 3300005841 Bacteria 3270
25 Ga0075368_10043512 3300006042 Bacteria 1770
26 Ga0075363_100091596 3300006048 Bacteria 1674
27 Ga0075362_10186315 3300006177 Bacteria 1007
28 Ga0075362_10290260 3300006177 Bacteria 810
29 Ga0075367_10027516 3300006178 Bacteria 3235
30 Ga0075366_10066903 3300006195 Bacteria 2138
31 Ga0075370_10140018 3300006353 Bacteria 1414
32 Ga0068871_100356489 3300006358 Bacteria 1295
33 Ga0075430_100145641 3300006846 Bacteria 1973
34 Ga0105240_10004554 3300009093 Bacteria 21043
35 Ga0105245_10051059 3300009098 Bacteria 3707
36 Ga0105245_10197776 3300009098 Bacteria 1929
37 Ga0105241_10156670 3300009174 Bacteria 1868
38 Ga0105248_10051388 3300009177 Bacteria 4625
39 Ga0105248_10227656 3300009177 Bacteria 2099
40 Ga0105237_10197463 3300009545 Bacteria 2011
41 Ga0105237_10200095 3300009545 Bacteria 1997
42 Ga0105238_10041650 3300009551 Bacteria 4651
43 Ga0105238_10056229 3300009551 Bacteria 3948
44 Ga0105239_10543274 3300010375 Bacteria 1323
45 Ga0157324_1019347 3300012506 Bacteria 677
46 Ga0157371_10143733 3300013102 Bacteria 1700
47 Ga0157371_10730063 3300013102 Bacteria 743
48 Ga0157369_11008893 3300013105 Bacteria 852
49 Ga0157374_10315903 3300013296 Bacteria 1547
50 Ga0157378_10136583 3300013297 Bacteria 2274
51 Ga0163162_10057737 3300013306 Bacteria 3909
52 Ga0163162_12273971 3300013306 Bacteria 623
53 Ga0157372_10049415 3300013307 Bacteria 4677
54 Ga0157375_10102212 3300013308 Bacteria 2951
55 Ga0157375_10534476 3300013308 Bacteria 1335
56 Ga0157375_10830771 3300013308 Bacteria 1071
57 Ga0163163_11030555 3300014325 Bacteria 886
58 Ga0157380_10565029 3300014326 Bacteria 1119
59 Ga0182008_10236430 3300014497 Bacteria 939
60 Ga0182008_10433191 3300014497 Bacteria 712
61 Ga0157377_10031018 3300014745 Bacteria 2902
62 Ga0157379_10018238 3300014968 Bacteria 6185
63 Ga0157376_10064306 3300014969 Bacteria 3094
64 Ga0157376_10103908 3300014969 Bacteria 2489
65 Ga0182007_10172226 3300015262 Bacteria 745
66 Ga0209673_1088485 3300025273 Bacteria 691
67 Ga0209051_1000320 3300025303 Bacteria 72764
68 Ga0209257_1000161 3300025304 Bacteria 176089
69 Ga0207656_10083582 3300025321 Bacteria 1439
70 Ga0207705_10091950 3300025909 Bacteria 2223
71 Ga0207705_10717504 3300025909 Bacteria 777
72 Ga0207671_10123877 3300025914 Bacteria 1978
73 Ga0207660_10284968 3300025917 Bacteria 1312
74 Ga0207657_10105492 3300025919 Bacteria 2332
75 Ga0207652_10013631 3300025921 Bacteria 6572
76 Ga0207652_10247893 3300025921 Bacteria 1606
77 Ga0207650_10030128 3300025925 Bacteria 3906
78 Ga0207650_10157361 3300025925 Bacteria 1797
79 Ga0207687_10312334 3300025927 Bacteria 1270
80 Ga0207664_11381454 3300025929 Bacteria 625
81 Ga0207706_10002276 3300025933 Bacteria 18747
82 Ga0207711_10108504 3300025941 Bacteria 2466
83 Ga0207689_10080274 3300025942 Bacteria 2681
84 Ga0207658_10120747 3300025986 Bacteria 2089
85 Ga0207677_10083241 3300026023 Bacteria 2302
86 Ga0207677_10465465 3300026023 Bacteria 1086
87 Ga0207641_10092603 3300026088 Bacteria 2647
88 Ga0207676_10154641 3300026095 Bacteria 1979
89 Ga0207683_10736106 3300026121 Bacteria 915
90 Ga0207698_11653745 3300026142 Bacteria 656
91 Ga0265332_10008112 3300031238 Bacteria 4721
92 Ga0265331_10058922 3300031250 Bacteria 1817
93 Ga0265314_10007629 3300031711 Bacteria 9364
94 Ga0265314_10025087 3300031711 Bacteria 4505
95 Ga0307516_10242335 3300031730 Bacteria 1501
96 Ga0307516_10527991 3300031730 Bacteria 834
97 Ga0307413_10733003 3300031824 Bacteria 824
98 Ga0307410_11384293 3300031852 Bacteria 617
99 Ga0307416_100201899 3300032002 Bacteria 1887
100 Ga0307411_10007969 3300032005 Bacteria 5449
101 Ga0307411_10578136 3300032005 Bacteria 963
102 Ga0307507_10252320 3300033179 Bacteria 1138
103 Ga0373940_0037753 3300035088 Bacteria 1316
104 Ga0373949_0069852 3300035090 Bacteria 918
105 Ga0373951_0130715 3300035091 Bacteria 690
106 Ga0373952_0016221 3300035092 Bacteria 1512
107 Ga0373932_0013173 3300035112 Bacteria 2051
108 Ga0373960_0063482 3300035121 Bacteria 1126
109 Ga0373942_0137971 3300035207 Bacteria 774
110 Ga0373961_0029851 3300035241 Bacteria 1513
111 Ga0373962_0094716 3300035242 Bacteria 924
112 Ga0373924_0198360 3300035410 Bacteria 885
113 Ga0373931_0018536 3300035691 Bacteria 3463
114 Ga0373937_0074771 3300036401 Bacteria 3127
115 Ga0395899_0006574 3300037312 Bacteria 9010
116 Ga0395899_0007650 3300037312 Bacteria 8331
117 Ga0395899_0134249 3300037312 Bacteria 1765
118 Ga0395900_0001269 3300037418 Bacteria 30864
119 Ga0395900_0018302 3300037418 Bacteria 7146
120 Ga0395900_0019677 3300037418 Bacteria 6882
121 Ga0395900_0055813 3300037418 Bacteria 4067
122 Ga0395900_0454239 3300037418 Bacteria 1237
123 Ga0395900_1740699 3300037418 Bacteria 534
124 Ga0395898_0030738 3300037466 Bacteria 5372
125 Ga0395898_0034892 3300037466 Bacteria 5006
126 Ga0395898_0046087 3300037466 Bacteria 4282
127 Ga0395898_0436876 3300037466 Bacteria 1247
128 Ga0395905_0000653 3300037471 Bacteria 46132
129 Ga0395905_0021389 3300037471 Bacteria 6118
130 Ga0395905_0026145 3300037471 Bacteria 5505
131 Ga0395905_0098099 3300037471 Bacteria 2751
132 Ga0395905_0307878 3300037471 Bacteria 1472
133 Ga0395905_0334304 3300037471 Bacteria 1405
134 Ga0395905_0341367 3300037471 Bacteria 1389
135 Ga0395905_0420467 3300037471 Bacteria 1233
136 Ga0395905_0473878 3300037471 Bacteria 1151
137 Ga0395901_0014228 3300038443 Bacteria 8100
138 Ga0395901_0044609 3300038443 Bacteria 4598
139 Ga0395901_0054511 3300038443 Bacteria 4155
140 Ga0395901_0069058 3300038443 Bacteria 3680
141 Ga0436363_0876686 3300039450 Bacteria 968
142 Ga0439437_013984 3300042000 Bacteria 935
143 Ga0450914_008340 3300042118 Bacteria 957
144 Ga0439460_0112826 3300042461 Bacteria 883
145 Ga0450893_0002811 3300042532 Bacteria 2729
146 Ga0466969_0017858 3300044656 Bacteria 3700
147 Ga0466972_0013917 3300044658 Bacteria 4035
148 Ga0466972_0181435 3300044658 Bacteria 987
149 Ga0466966_0015007 3300044684 Bacteria 5125
150 Ga0466966_0134101 3300044684 Bacteria 1515
151 Ga0466961_0148188 3300044693 Bacteria 1466
152 Ga0453684_0054723 3300044712 Bacteria 5195
153 Ga0453684_1421115 3300044712 Bacteria 719
154 Ga0453684_1991601 3300044712 Bacteria 585
155 Ga0466971_0014364 3300044719 Bacteria 3483
156 Ga0466970_0096749 3300044765 Bacteria 1606
157 Ga0466959_0143918 3300045049 Bacteria 1683
158 Ga0451576_0102128 3300045051 Bacteria 2982
159 Ga0451576_0342473 3300045051 Bacteria 1565
160 Ga0451576_0548712 3300045051 Bacteria 1214
161 Ga0495629_0101367 3300046459 Bacteria 2009
162 Ga0495651_0817108 3300046462 Bacteria 574
163 Ga0495666_0169297 3300046526 Bacteria 1011
164 Ga0495621_0353597 3300046539 Bacteria 617
165 Ga0495633_0096807 3300046558 Bacteria 1371
166 Ga0495635_0063359 3300046663 Bacteria 2539
167 Ga0495626_0067888 3300048091 Bacteria 1609
168 Ga0496100_0221971 3300048903 Bacteria 1387
169 Ga0496101_0106681 3300048904 Bacteria 2104
170 Ga0496102_0028128 3300048905 Bacteria 5024
171 Ga0496104_0357298 3300048907 Bacteria 1373
172 Ga0496104_0382079 3300048907 Bacteria 1321
173 Ga0496105_0182923 3300048908 Bacteria 1716
174 Ga0496106_0012295 3300048909 Bacteria 6317
175 Ga0496107_0069441 3300048910 Bacteria 2557
176 Ga0496108_0036240 3300048911 Bacteria 4104
177 Ga0496109_0007259 3300048912 Bacteria 9370
178 Ga0496110_0234233 3300048913 Bacteria 1670
179 Ga0496111_0850367 3300048914 Bacteria 659
180 Ga0496112_0149259 3300048915 Bacteria 2305
181 Ga0496113_0217703 3300048916 Bacteria 1521
182 Ga0496114_0035576 3300048917 Bacteria 4113
183 Ga0496114_0722271 3300048917 Bacteria 872
184 Ga0496115_0024438 3300048918 Bacteria 4697
185 Ga0501032_0277595 3300049569 Bacteria 1085
186 Ga0501034_0154886 3300049571 Bacteria 2266
187 Ga0501043_0228543 3300049579 Bacteria 1437
188 Ga0501046_0109257 3300049580 Bacteria 2114
189 Ga0501047_0085595 3300049581 Bacteria 3029
190 Ga0501047_0177460 3300049581 Bacteria 1997
191 Ga0501048_0704962 3300049582 Bacteria 725
192 Ga0501073_0175063 3300049589 Bacteria 1485
193 Ga0501198_000005 3300049649 Bacteria 156657
194 Ga0501206_013404 3300049653 Unclassified 1120
195 Ga0501222_000003 3300049662 Bacteria 157406
196 Ga0501080_0142442 3300049742 Bacteria 2216
197 Ga0501274_007013 3300049771 Bacteria 984
198 Ga0501280_088480 3300049776 Bacteria 580
199 Ga0501035_0249729 3300049822 Bacteria 1507
200 Ga0501044_0181768 3300049823 Bacteria 2069
201 nmdc:mga03683_124645_c1 3300050489 Bacteria 1148
202 nmdc:mga0yw44_10087_c1 3300050492 Bacteria 4809
203 nmdc:mga0yw44_152596_c1 3300050492 Bacteria 1508
204 nmdc:mga0k408_48601_c1 3300050493 Bacteria 2454
205 nmdc:mga06z11_49336_c1 3300050494 Bacteria 2147
206 nmdc:mga07m45_123810_c1 3300050496 Bacteria 1494
207 nmdc:mga07m45_638128_c1 3300050496 Bacteria 614
208 nmdc:mga09592_765687_c1 3300050508 Bacteria 818
209 nmdc:mga0rr50_126375_c1 3300050513 Bacteria 2042
210 Ga0500620_257650 3300053155 Unclassified 578

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005456 Ga0070678_101052219 Ga0070678_1010522191 162
2 3300014497 Ga0182008_10433191 Ga0182008_104331911 162
3 3300026121 Ga0207683_10736106 Ga0207683_107361062 162
4 3300032005 Ga0307411_10007969 Ga0307411_100079694 162
5 3300048914 Ga0496111_0850367 Ga0496111_0850367_113_601 162
6 3300005355 Ga0070671_100548272 Ga0070671_1005482722 163
7 3300005356 Ga0070674_100333019 Ga0070674_1003330192 163
8 3300005456 Ga0070678_100189915 Ga0070678_1001899152 163
9 3300005467 Ga0070706_100082607 Ga0070706_1000826073 163
10 3300009098 Ga0105245_10197776 Ga0105245_101977762 163
11 3300009177 Ga0105248_10051388 Ga0105248_100513883 163
12 3300009545 Ga0105237_10200095 Ga0105237_102000952 163
13 3300009551 Ga0105238_10041650 Ga0105238_100416502 163
14 3300010375 Ga0105239_10543274 Ga0105239_105432742 163
15 3300012506 Ga0157324_1019347 Ga0157324_10193471 163
16 3300013102 Ga0157371_10143733 Ga0157371_101437332 163
17 3300013105 Ga0157369_11008893 Ga0157369_110088932 163
18 3300013296 Ga0157374_10315903 Ga0157374_103159032 163
19 3300013306 Ga0163162_10057737 Ga0163162_100577373 163
20 3300013307 Ga0157372_10049415 Ga0157372_100494153 163
21 3300013308 Ga0157375_10102212 Ga0157375_101022122 163
22 3300013308 Ga0157375_10534476 Ga0157375_105344762 163
23 3300013308 Ga0157375_10830771 Ga0157375_108307711 163
24 3300014326 Ga0157380_10565029 Ga0157380_105650292 163
25 3300014745 Ga0157377_10031018 Ga0157377_100310182 163
26 3300014968 Ga0157379_10018238 Ga0157379_100182386 163
27 3300014969 Ga0157376_10103908 Ga0157376_101039082 163
28 3300025321 Ga0207656_10083582 Ga0207656_100835822 163
29 3300025925 Ga0207650_10157361 Ga0207650_101573612 163
30 3300025933 Ga0207706_10002276 Ga0207706_1000227619 163
31 3300031824 Ga0307413_10733003 Ga0307413_107330031 163
32 3300031852 Ga0307410_11384293 Ga0307410_113842931 163
33 3300032005 Ga0307411_10578136 Ga0307411_105781362 163
34 3300035088 Ga0373940_0037753 Ga0373940_0037753_399_893 163
35 3300035090 Ga0373949_0069852 Ga0373949_0069852_293_787 163
36 3300035091 Ga0373951_0130715 Ga0373951_0130715_31_525 163
37 3300035092 Ga0373952_0016221 Ga0373952_0016221_274_768 163
38 3300035112 Ga0373932_0013173 Ga0373932_0013173_133_633 163
39 3300035121 Ga0373960_0063482 Ga0373960_0063482_487_981 163
40 3300035207 Ga0373942_0137971 Ga0373942_0137971_73_567 163
41 3300035241 Ga0373961_0029851 Ga0373961_0029851_842_1336 163
42 3300035242 Ga0373962_0094716 Ga0373962_0094716_123_617 163
43 3300035410 Ga0373924_0198360 Ga0373924_0198360_28_528 163
44 3300035691 Ga0373931_0018536 Ga0373931_0018536_764_1258 163
45 3300036401 Ga0373937_0074771 Ga0373937_0074771_2448_2945 163
46 3300037418 Ga0395900_1740699 Ga0395900_1740699_23_514 163
47 3300037471 Ga0395905_0341367 Ga0395905_0341367_59_550 163
48 3300039450 Ga0436363_0876686 Ga0436363_0876686_343_840 163
49 3300044658 Ga0466972_0013917 Ga0466972_0013917_895_1386 163
50 3300044712 Ga0453684_1421115 Ga0453684_1421115_203_694 163
51 3300044712 Ga0453684_1991601 Ga0453684_1991601_46_543 163
52 3300044719 Ga0466971_0014364 Ga0466971_0014364_24_515 163
53 3300045051 Ga0451576_0102128 Ga0451576_0102128_1769_2266 163
54 3300045051 Ga0451576_0342473 Ga0451576_0342473_593_1087 163
55 3300046459 Ga0495629_0101367 Ga0495629_0101367_1497_1997 163
56 3300046462 Ga0495651_0817108 Ga0495651_0817108_12_512 163
57 3300046539 Ga0495621_0353597 Ga0495621_0353597_13_513 163
58 3300046558 Ga0495633_0096807 Ga0495633_0096807_719_1219 163
59 3300046663 Ga0495635_0063359 Ga0495635_0063359_2019_2519 163
60 3300048903 Ga0496100_0221971 Ga0496100_0221971_589_1083 163
61 3300048904 Ga0496101_0106681 Ga0496101_0106681_791_1285 163
62 3300048905 Ga0496102_0028128 Ga0496102_0028128_721_1215 163
63 3300048907 Ga0496104_0357298 Ga0496104_0357298_725_1219 163
64 3300048907 Ga0496104_0382079 Ga0496104_0382079_490_993 163
65 3300048908 Ga0496105_0182923 Ga0496105_0182923_509_1003 163
66 3300048909 Ga0496106_0012295 Ga0496106_0012295_745_1239 163
67 3300048910 Ga0496107_0069441 Ga0496107_0069441_1117_1611 163
68 3300048911 Ga0496108_0036240 Ga0496108_0036240_2864_3358 163
69 3300048912 Ga0496109_0007259 Ga0496109_0007259_4547_5041 163
70 3300048913 Ga0496110_0234233 Ga0496110_0234233_533_1027 163
71 3300048915 Ga0496112_0149259 Ga0496112_0149259_1304_1798 163
72 3300048916 Ga0496113_0217703 Ga0496113_0217703_291_785 163
73 3300048917 Ga0496114_0035576 Ga0496114_0035576_986_1480 163
74 3300048917 Ga0496114_0722271 Ga0496114_0722271_161_664 163
75 3300048918 Ga0496115_0024438 Ga0496115_0024438_3199_3693 163
76 3300049649 Ga0501198_000005 Ga0501198_000005_107809_108306 163
77 3300049653 Ga0501206_013404 Ga0501206_013404_71_568 163
78 3300049662 Ga0501222_000003 Ga0501222_000003_108558_109055 163
79 3300049776 Ga0501280_088480 Ga0501280_088480_16_507 163
80 3300050496 nmdc:mga07m45_638128_c1 nmdc:mga07m45_638128_c1_28_528 163
81 3300050508 nmdc:mga09592_765687_c1 nmdc:mga09592_765687_c1_183_674 163
82 3300050513 nmdc:mga0rr50_126375_c1 nmdc:mga0rr50_126375_c1_1400_1894 163
83 iso_pu_bacteria 2643221592 2643970680 163
84 iso_pu_bacteria 2643221625 2644139038 163
85 iso_pu_bacteria 2643221648 2644274648 163
86 3300014497 Ga0182008_10236430 Ga0182008_102364302 166
87 3300037418 Ga0395900_0055813 Ga0395900_0055813_1283_1828 167
88 3300037471 Ga0395905_0334304 Ga0395905_0334304_694_1239 167
89 3300048091 Ga0495626_0067888 Ga0495626_0067888_801_1310 167
90 3300031730 Ga0307516_10527991 Ga0307516_105279912 169
91 3300006358 Ga0068871_100356489 Ga0068871_1003564892 170
92 3300009545 Ga0105237_10197463 Ga0105237_101974632 170
93 3300014325 Ga0163163_11030555 Ga0163163_110305552 170
94 3300025914 Ga0207671_10123877 Ga0207671_101238772 170
95 3300025986 Ga0207658_10120747 Ga0207658_101207471 170
96 3300026142 Ga0207698_11653745 Ga0207698_116537452 170
97 3300033179 Ga0307507_10252320 Ga0307507_102523202 170
98 3300031730 Ga0307516_10242335 Ga0307516_102423352 171
99 3300032002 Ga0307416_100201899 Ga0307416_1002018992 171
100 3300044658 Ga0466972_0181435 Ga0466972_0181435_315_833 171
101 3300044712 Ga0453684_0054723 Ga0453684_0054723_4345_4866 171
102 3300013306 Ga0163162_12273971 Ga0163162_122739712 172
103 3300025909 Ga0207705_10717504 Ga0207705_107175041 172
104 3300046526 Ga0495666_0169297 Ga0495666_0169297_246_770 172
105 3300053155 Ga0500620_257650 Ga0500620_257650_17_535 172
106 3300005295 Ga0065707_10664476 Ga0065707_106644761 180
107 3300013102 Ga0157371_10730063 Ga0157371_107300632 180
108 3300042118 Ga0450914_008340 Ga0450914_008340_329_889 180
109 3300005327 Ga0070658_10343988 Ga0070658_103439882 181
110 3300005331 Ga0070670_100061410 Ga0070670_1000614103 181
111 3300005334 Ga0068869_100048508 Ga0068869_1000485082 181
112 3300005336 Ga0070680_100126234 Ga0070680_1001262342 181
113 3300005338 Ga0068868_100045906 Ga0068868_1000459062 181
114 3300005338 Ga0068868_100495186 Ga0068868_1004951862 181
115 3300005339 Ga0070660_100055520 Ga0070660_1000555202 181
116 3300005435 Ga0070714_100045185 Ga0070714_1000451854 181
117 3300005458 Ga0070681_10332456 Ga0070681_103324561 181
118 3300005530 Ga0070679_100026495 Ga0070679_1000264954 181
119 3300005530 Ga0070679_100157733 Ga0070679_1001577332 181
120 3300005563 Ga0068855_100014376 Ga0068855_1000143763 181
121 3300005614 Ga0068856_100390669 Ga0068856_1003906692 181
122 3300005614 Ga0068856_100658129 Ga0068856_1006581292 181
123 3300005618 Ga0068864_100352905 Ga0068864_1003529052 181
124 3300005841 Ga0068863_100072022 Ga0068863_1000720223 181
125 3300006042 Ga0075368_10043512 Ga0075368_100435122 181
126 3300006048 Ga0075363_100091596 Ga0075363_1000915962 181
127 3300006177 Ga0075362_10186315 Ga0075362_101863152 181
128 3300006177 Ga0075362_10290260 Ga0075362_102902602 181
129 3300006178 Ga0075367_10027516 Ga0075367_100275164 181
130 3300006195 Ga0075366_10066903 Ga0075366_100669032 181
131 3300006353 Ga0075370_10140018 Ga0075370_101400182 181
132 3300006846 Ga0075430_100145641 Ga0075430_1001456413 181
133 3300009093 Ga0105240_10004554 Ga0105240_1000455417 181
134 3300009098 Ga0105245_10051059 Ga0105245_100510592 181
135 3300009174 Ga0105241_10156670 Ga0105241_101566702 181
136 3300009177 Ga0105248_10227656 Ga0105248_102276562 181
137 3300009551 Ga0105238_10056229 Ga0105238_100562293 181
138 3300013297 Ga0157378_10136583 Ga0157378_101365832 181
139 3300014969 Ga0157376_10064306 Ga0157376_100643064 181
140 3300015262 Ga0182007_10172226 Ga0182007_101722261 181
141 3300025909 Ga0207705_10091950 Ga0207705_100919502 181
142 3300025917 Ga0207660_10284968 Ga0207660_102849681 181
143 3300025919 Ga0207657_10105492 Ga0207657_101054922 181
144 3300025921 Ga0207652_10013631 Ga0207652_100136313 181
145 3300025921 Ga0207652_10247893 Ga0207652_102478932 181
146 3300025925 Ga0207650_10030128 Ga0207650_100301283 181
147 3300025927 Ga0207687_10312334 Ga0207687_103123342 181
148 3300025929 Ga0207664_11381454 Ga0207664_113814541 181
149 3300025941 Ga0207711_10108504 Ga0207711_101085042 181
150 3300025942 Ga0207689_10080274 Ga0207689_100802742 181
151 3300026023 Ga0207677_10083241 Ga0207677_100832412 181
152 3300026023 Ga0207677_10465465 Ga0207677_104654652 181
153 3300026088 Ga0207641_10092603 Ga0207641_100926032 181
154 3300026095 Ga0207676_10154641 Ga0207676_101546412 181
155 3300031238 Ga0265332_10008112 Ga0265332_100081123 181
156 3300031250 Ga0265331_10058922 Ga0265331_100589222 181
157 3300031711 Ga0265314_10007629 Ga0265314_100076293 181
158 3300031711 Ga0265314_10025087 Ga0265314_100250872 181
159 3300037312 Ga0395899_0006574 Ga0395899_0006574_1902_2462 181
160 3300037312 Ga0395899_0007650 Ga0395899_0007650_4275_4829 181
161 3300037312 Ga0395899_0134249 Ga0395899_0134249_285_881 181
162 3300037418 Ga0395900_0001269 Ga0395900_0001269_20081_20635 181
163 3300037418 Ga0395900_0018302 Ga0395900_0018302_1205_1765 181
164 3300037418 Ga0395900_0019677 Ga0395900_0019677_2364_2960 181
165 3300037418 Ga0395900_0454239 Ga0395900_0454239_362_922 181
166 3300037466 Ga0395898_0030738 Ga0395898_0030738_1670_2230 181
167 3300037466 Ga0395898_0034892 Ga0395898_0034892_2815_3411 181
168 3300037466 Ga0395898_0046087 Ga0395898_0046087_3331_3885 181
169 3300037466 Ga0395898_0436876 Ga0395898_0436876_96_656 181
170 3300037471 Ga0395905_0000653 Ga0395905_0000653_16883_17443 181
171 3300037471 Ga0395905_0021389 Ga0395905_0021389_2331_2891 181
172 3300037471 Ga0395905_0026145 Ga0395905_0026145_1803_2363 181
173 3300037471 Ga0395905_0098099 Ga0395905_0098099_1486_2082 181
174 3300037471 Ga0395905_0307878 Ga0395905_0307878_405_965 181
175 3300037471 Ga0395905_0420467 Ga0395905_0420467_651_1211 181
176 3300037471 Ga0395905_0473878 Ga0395905_0473878_459_1013 181
177 3300038443 Ga0395901_0014228 Ga0395901_0014228_3861_4415 181
178 3300038443 Ga0395901_0044609 Ga0395901_0044609_300_896 181
179 3300038443 Ga0395901_0054511 Ga0395901_0054511_3331_3891 181
180 3300038443 Ga0395901_0069058 Ga0395901_0069058_2795_3394 181
181 3300042000 Ga0439437_013984 Ga0439437_013984_28_588 181
182 3300042461 Ga0439460_0112826 Ga0439460_0112826_150_701 181
183 3300042532 Ga0450893_0002811 Ga0450893_0002811_502_1062 181
184 3300044656 Ga0466969_0017858 Ga0466969_0017858_2258_2818 181
185 3300044684 Ga0466966_0015007 Ga0466966_0015007_108_668 181
186 3300044684 Ga0466966_0134101 Ga0466966_0134101_570_1130 181
187 3300044693 Ga0466961_0148188 Ga0466961_0148188_179_739 181
188 3300044765 Ga0466970_0096749 Ga0466970_0096749_860_1420 181
189 3300045049 Ga0466959_0143918 Ga0466959_0143918_851_1411 181
190 3300045051 Ga0451576_0548712 Ga0451576_0548712_551_1117 181
191 3300049569 Ga0501032_0277595 Ga0501032_0277595_500_1054 181
192 3300049571 Ga0501034_0154886 Ga0501034_0154886_755_1318 181
193 3300049579 Ga0501043_0228543 Ga0501043_0228543_16_579 181
194 3300049580 Ga0501046_0109257 Ga0501046_0109257_892_1455 181
195 3300049581 Ga0501047_0085595 Ga0501047_0085595_912_1469 181
196 3300049581 Ga0501047_0177460 Ga0501047_0177460_440_1003 181
197 3300049582 Ga0501048_0704962 Ga0501048_0704962_100_663 181
198 3300049589 Ga0501073_0175063 Ga0501073_0175063_687_1250 181
199 3300049742 Ga0501080_0142442 Ga0501080_0142442_996_1559 181
200 3300049771 Ga0501274_007013 Ga0501274_007013_224_784 181
201 3300049822 Ga0501035_0249729 Ga0501035_0249729_594_1148 181
202 3300049823 Ga0501044_0181768 Ga0501044_0181768_162_716 181
203 3300050489 nmdc:mga03683_124645_c1 nmdc:mga03683_124645_c1_205_765 181
204 3300050492 nmdc:mga0yw44_10087_c1 nmdc:mga0yw44_10087_c1_2372_2932 181
205 3300050492 nmdc:mga0yw44_152596_c1 nmdc:mga0yw44_152596_c1_765_1325 181
206 3300050493 nmdc:mga0k408_48601_c1 nmdc:mga0k408_48601_c1_1175_1735 181
207 3300050494 nmdc:mga06z11_49336_c1 nmdc:mga06z11_49336_c1_277_837 181
208 3300050496 nmdc:mga07m45_123810_c1 nmdc:mga07m45_123810_c1_264_824 181
209 3300003792 Ga0055540_1010222 Ga0055540_10102223 182
210 3300003794 Ga0055531_10000604 Ga0055531_1000060412 182
211 3300025273 Ga0209673_1088485 Ga0209673_10884852 182
212 3300025303 Ga0209051_1000320 Ga0209051_100032062 182
213 3300025304 Ga0209257_1000161 Ga0209257_100016173 182

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

29

158

0.81

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

40

157

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
6erd-assembly1.cif.gz_A crystal structure of a putative acetyltransferase from bacillus cereus species. 0.8969 14 170
7kwj-assembly1.cif.gz_B spermidine n-acetyltransferase speg k23-q34 chimera from vibrio cholerae and hssat 0.8905 14 173
8fv0-assembly1.cif.gz_C speg spermidine n-acetyltransferase from staphylococcus aureus in complex with spermine 0.8898 13 171
6vfn-assembly1.cif.gz_D crystal structure of speg allosteric polyamine acetyltransferase from bacillus thuringiensis in complex with spermine 0.8894 13 172
6erd-assembly2.cif.gz_D crystal structure of a putative acetyltransferase from bacillus cereus species. 0.8884 14 169
ID Description Score Start End Superfamily
af_A0A0R0LDP2_1_100_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9069 85 169 3.40.630.30
af_C7IYZ1_1_59_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.906 117 169 3.40.630.30
af_A0A1D6QIS1_205_278_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8939 101 166 3.40.630.30
af_A0A0R0ECR9_59_131_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8875 99 168 3.40.630.30
af_K7M825_2_117_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8748 85 166 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A424Y3E9-F1-model_v4 N-acetyltransferase 0.9781 14 172 GO:0016747
AF-H6SIP7-F1-model_v4 N-acetyltransferase domain-containing protein 0.9723 25 172 GO:0016747
AF-A0A1G9H741-F1-model_v4 Protein N-acetyltransferase, RimJ/RimL family 0.9687 14 169 GO:0016747
AF-A0A7V6FC92-F1-model_v4 GNAT family N-acetyltransferase 0.962 13 174 GO:0016747
AF-A0A2V5KC88-F1-model_v4 N-acetyltransferase domain-containing protein 0.9559 9 169 GO:0004757
GO:0005737
GO:0006729
GO:0016747

Feature Viewer

pLDDT pTM Quality
93.24 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map