F324180

General Info

Members Datasets Scaffolds Average Seq Length
213 144 213 154

Family's Representative Sequence

Representative Sequence 3300028558|Ga0265326_10031751|Ga0265326_100317512
Length 183
Sequence VTNDKINDSLEEAIVYAKRYLEDLLSFFGLNTDVHATSEDEEVIELKIPSTHLNGFLIGMHGDTVRSLQYTISAALKSQGYAHTRINVDVADYKKQRGERLTKVAEDWFKEVQSSGKPKVLEPMNPADRRIVHKAASDYGLDTHSEGEGRDRHIVISLAAGGDIPAPKEDKEPDSEPASDLDE

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
56 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
100 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
101 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
102 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
103 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
106 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
107 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
115 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
116 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
120 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
121 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
127 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
132 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
133 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
134 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
137 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
138 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
139 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
140 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
141 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
142 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
143 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
144 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.8
Nodule 0
Rhizoplane 1.88
Rhizosphere 84.98
Stem 0
Stem Tuber 0
Unclassified 2.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1005805 3300001904 Bacteria 2086
2 JGI24740J21852_10002888 3300001979 Bacteria 7683
3 JGI24740J21852_10026767 3300001979 Unclassified 1927
4 JGI24740J21852_10034123 3300001979 Unclassified 1607
5 JGI24739J22299_10000063 3300001989 Bacteria 29854
6 JGI24737J22298_10000145 3300001990 Bacteria 22015
7 JGI24735J21928_10000067 3300002067 Bacteria 42751
8 JGI24033J26618_1043899 3300002155 Bacteria 629
9 rootH2_10185960 3300003320 Bacteria 1334
10 rootH2_10231047 3300003320 Unclassified 2868
11 rootL2_10162534 3300003322 Bacteria 1728
12 rootH1_10021217 3300003323 Bacteria 85014
13 Ga0070658_10000009 3300005327 Bacteria 319868
14 Ga0070683_100028754 3300005329 Bacteria 5026
15 Ga0070683_100325024 3300005329 Bacteria 1464
16 Ga0068869_100261520 3300005334 Bacteria 1385
17 Ga0070680_101031361 3300005336 Bacteria 711
18 Ga0068868_100253953 3300005338 Bacteria 1480
19 Ga0070660_100134394 3300005339 Bacteria 1981
20 Ga0070660_100255871 3300005339 Bacteria 1429
21 Ga0070661_100006529 3300005344 Bacteria 8047
22 Ga0070661_100076294 3300005344 Unclassified 2470
23 Ga0070661_101426308 3300005344 Unclassified 583
24 Ga0070671_100100003 3300005355 Unclassified 2433
25 Ga0070674_100000720 3300005356 Bacteria 16884
26 Ga0070659_100001064 3300005366 Bacteria 20072
27 Ga0070659_100046912 3300005366 Unclassified 3387
28 Ga0070659_100047976 3300005366 Bacteria 3353
29 Ga0070667_101818337 3300005367 Unclassified 573
30 Ga0070662_100039453 3300005457 Unclassified 3358
31 Ga0070662_100137878 3300005457 Bacteria 1888
32 Ga0070681_10000577 3300005458 Bacteria 30272
33 Ga0068867_100617465 3300005459 Bacteria 947
34 Ga0068867_101428125 3300005459 Bacteria 642
35 Ga0070685_10000558 3300005466 Bacteria 20845
36 Ga0070679_100653347 3300005530 Bacteria 994
37 Ga0070684_100169114 3300005535 Bacteria 1985
38 Ga0068853_100020324 3300005539 Bacteria 5521
39 Ga0070665_100001295 3300005548 Bacteria 29936
40 Ga0068855_100000002 3300005563 Bacteria 616881
41 Ga0068855_100000017 3300005563 Bacteria 212278
42 Ga0068855_100007452 3300005563 Bacteria 13252
43 Ga0068855_100008303 3300005563 Bacteria 12552
44 Ga0070664_100000338 3300005564 Bacteria 34161
45 Ga0068857_100000251 3300005577 Bacteria 36024
46 Ga0068857_100001672 3300005577 Bacteria 17821
47 Ga0068857_100966171 3300005577 Bacteria 819
48 Ga0068854_100004390 3300005578 Bacteria 8897
49 Ga0068856_100000060 3300005614 Bacteria 101415
50 Ga0068856_100000117 3300005614 Bacteria 79068
51 Ga0068852_100045261 3300005616 Unclassified 3742
52 Ga0068852_100084623 3300005616 Bacteria 2823
53 Ga0068861_100439485 3300005719 Unclassified 1166
54 Ga0068863_100179483 3300005841 Bacteria 2032
55 Ga0068860_100093625 3300005843 Bacteria 2864
56 Ga0075365_10000106 3300006038 Bacteria 24747
57 Ga0075365_10005901 3300006038 Bacteria 6667
58 Ga0075364_10015630 3300006051 Unclassified 4710
59 Ga0075369_10095157 3300006186 Bacteria 1332
60 Ga0075366_10001364 3300006195 Bacteria 12202
61 Ga0097621_100338749 3300006237 Bacteria 1335
62 Ga0075370_10029249 3300006353 Unclassified 3068
63 Ga0068871_100026689 3300006358 Unclassified 4510
64 Ga0068865_100000969 3300006881 Bacteria 16387
65 Ga0105240_10000489 3300009093 Bacteria 73274
66 Ga0105240_10003612 3300009093 Bacteria 23956
67 Ga0105240_10383087 3300009093 Unclassified 1588
68 Ga0111539_10005947 3300009094 Bacteria 15756
69 Ga0105245_10124226 3300009098 Bacteria 2414
70 Ga0105245_10262858 3300009098 Bacteria 1680
71 Ga0105245_10291012 3300009098 Unclassified 1600
72 Ga0105241_10370806 3300009174 Bacteria 1248
73 Ga0105242_10003425 3300009176 Bacteria 12333
74 Ga0105248_10263126 3300009177 Bacteria 1942
75 Ga0105248_11708872 3300009177 Unclassified 713
76 Ga0105237_11145882 3300009545 Unclassified 784
77 Ga0105238_10043282 3300009551 Unclassified 4556
78 Ga0105238_10067877 3300009551 Unclassified 3567
79 Ga0105238_10527048 3300009551 Bacteria 1184
80 Ga0105249_10388067 3300009553 Bacteria 1424
81 Ga0105032_100010 3300009979 Bacteria 81059
82 Ga0105033_100602 3300009986 Unclassified 2783
83 Ga0105239_10008700 3300010375 Bacteria 11492
84 Ga0105246_10000783 3300011119 Bacteria 18027
85 Ga0105246_10003793 3300011119 Bacteria 9154
86 Ga0105246_10015050 3300011119 Bacteria 4875
87 Ga0157373_10006025 3300013100 Bacteria 9067
88 Ga0157373_10012732 3300013100 Bacteria 6181
89 Ga0157373_10015398 3300013100 Bacteria 5591
90 Ga0157373_10031633 3300013100 Bacteria 3808
91 Ga0157371_10364410 3300013102 Bacteria 1054
92 Ga0157370_10000984 3300013104 Bacteria 36041
93 Ga0157370_10154312 3300013104 Bacteria 2136
94 Ga0157369_10000003 3300013105 Bacteria 507337
95 Ga0157369_10000026 3300013105 Bacteria 216023
96 Ga0157369_10019121 3300013105 Bacteria 7668
97 Ga0157369_10023455 3300013105 Bacteria 6872
98 Ga0157369_10229362 3300013105 Unclassified 1942
99 Ga0157374_10000056 3300013296 Bacteria 117163
100 Ga0157374_10116961 3300013296 Bacteria 2569
101 Ga0157378_10857209 3300013297 Unclassified 937
102 Ga0157372_10093755 3300013307 Bacteria 3417
103 Ga0157377_10000264 3300014745 Bacteria 25782
104 Ga0157377_10020480 3300014745 Bacteria 3466
105 Ga0157376_10000001 3300014969 Bacteria 842910
106 Ga0157376_10000054 3300014969 Bacteria 99154
107 Ga0157376_10010602 3300014969 Bacteria 6749
108 Ga0207697_10110486 3300025315 Bacteria 1177
109 Ga0207688_10014552 3300025901 Unclassified 4274
110 Ga0207647_10000177 3300025904 Bacteria 51270
111 Ga0207647_10000410 3300025904 Bacteria 35247
112 Ga0207705_10000010 3300025909 Bacteria 518023
113 Ga0207654_10216763 3300025911 Bacteria 1267
114 Ga0207695_10001563 3300025913 Bacteria 37484
115 Ga0207695_10003061 3300025913 Bacteria 23962
116 Ga0207695_10149420 3300025913 Bacteria 2276
117 Ga0207657_10002733 3300025919 Bacteria 18998
118 Ga0207649_10013475 3300025920 Bacteria 4565
119 Ga0207649_10032594 3300025920 Bacteria 3108
120 Ga0207694_10226765 3300025924 Unclassified 1525
121 Ga0207694_10299476 3300025924 Bacteria 1324
122 Ga0207687_10160325 3300025927 Bacteria 1725
123 Ga0207687_10534540 3300025927 Unclassified 982
124 Ga0207644_10490602 3300025931 Bacteria 1012
125 Ga0207690_10013713 3300025932 Bacteria 4878
126 Ga0207690_10040491 3300025932 Unclassified 3047
127 Ga0207690_10702949 3300025932 Bacteria 831
128 Ga0207706_10000004 3300025933 Bacteria 280765
129 Ga0207686_10002187 3300025934 Bacteria 10761
130 Ga0207669_10003143 3300025937 Bacteria 7122
131 Ga0207704_10001729 3300025938 Bacteria 9776
132 Ga0207711_10411734 3300025941 Bacteria 1257
133 Ga0207711_10790647 3300025941 Bacteria 884
134 Ga0207689_10253180 3300025942 Bacteria 1456
135 Ga0207661_10046264 3300025944 Unclassified 3450
136 Ga0207661_10112827 3300025944 Unclassified 2302
137 Ga0207679_10000069 3300025945 Bacteria 93919
138 Ga0207667_10000005 3300025949 Bacteria 715503
139 Ga0207667_10000048 3300025949 Bacteria 238293
140 Ga0207667_10004604 3300025949 Bacteria 16915
141 Ga0207667_10014016 3300025949 Bacteria 9151
142 Ga0207640_10006327 3300025981 Bacteria 6494
143 Ga0207658_10286759 3300025986 Unclassified 1413
144 Ga0207677_11035140 3300026023 Unclassified 746
145 Ga0207702_10000097 3300026078 Bacteria 101497
146 Ga0207702_10000271 3300026078 Bacteria 59575
147 Ga0207641_10421973 3300026088 Bacteria 1284
148 Ga0207674_10000667 3300026116 Bacteria 44679
149 Ga0207674_10133919 3300026116 Unclassified 2441
150 Ga0207674_11354066 3300026116 Unclassified 681
151 Ga0207675_101110070 3300026118 Unclassified 811
152 Ga0207698_10000107 3300026142 Bacteria 52384
153 Ga0207698_10065194 3300026142 Bacteria 2859
154 Ga0268266_10000916 3300028379 Bacteria 37956
155 Ga0268264_10208477 3300028381 Bacteria 1792
156 Ga0265337_1000043 3300028556 Bacteria 56064
157 Ga0265337_1004918 3300028556 Bacteria 5439
158 Ga0265326_10031751 3300028558 Bacteria 1505
159 Ga0265334_10022024 3300028573 Bacteria 2601
160 Ga0265318_10015068 3300028577 Bacteria 3228
161 Ga0265336_10231476 3300028666 Unclassified 549
162 Ga0265338_10002643 3300028800 Bacteria 26402
163 Ga0265338_10003277 3300028800 Bacteria 22968
164 Ga0265338_10028182 3300028800 Bacteria 5607
165 Ga0265338_10473649 3300028800 Unclassified 884
166 Ga0265338_10496469 3300028800 Unclassified 860
167 Ga0316183_1029717 3300030742 Bacteria 763
168 Ga0316183_1042478 3300030742 Bacteria 4291
169 Ga0316183_1085278 3300030742 Bacteria 5253
170 Ga0316181_1226594 3300030744 Bacteria 25946
171 Ga0316182_1038782 3300030745 Bacteria 5372
172 Ga0307405_10204318 3300031731 Bacteria 1437
173 Ga0307412_10011652 3300031911 Bacteria 5100
174 Ga0395899_0009895 3300037312 Bacteria 7311
175 Ga0395899_0021729 3300037312 Bacteria 4867
176 Ga0395900_0000001 3300037418 Bacteria 931146
177 Ga0395898_0000002 3300037466 Bacteria 931013
178 Ga0395901_0000006 3300038443 Bacteria 514112
179 Ga0439463_002381 3300042016 Bacteria 4792
180 Ga0439464_0000042 3300042439 Bacteria 16260
181 Ga0466972_0047837 3300044658 Bacteria 2067
182 Ga0453684_0378461 3300044712 Unclassified 1590
183 Ga0451576_0038551 3300045051 Bacteria 5057
184 Ga0495638_0013359 3300046460 Bacteria 5594
185 Ga0495597_0172094 3300046542 Unclassified 878
186 Ga0495686_0046728 3300047472 Bacteria 2735
187 Ga0496105_0373970 3300048908 Bacteria 1135
188 Ga0496109_0304287 3300048912 Unclassified 1504
189 Ga0496112_0015966 3300048915 Bacteria 7020
190 Ga0496113_0218076 3300048916 Unclassified 1520
191 Ga0496124_0009218 3300048927 Bacteria 10181
192 Ga0501037_0000011 3300049573 Bacteria 196525
193 Ga0501073_0165219 3300049589 Bacteria 1533
194 Ga0501080_0130571 3300049742 Bacteria 2326
195 Ga0501035_0941343 3300049822 Unclassified 682
196 nmdc:mga00v17_144630_c1 3300050491 Bacteria 1526
197 nmdc:mga0yw44_3271_c1 3300050492 Bacteria 6667
198 nmdc:mga0yw44_82_c2 3300050492 Bacteria 32345
199 nmdc:mga0k408_1863_c2 3300050493 Bacteria 10923
200 nmdc:mga07m45_3334_c2 3300050496 Bacteria 6998
201 nmdc:mga08y16_218_c1 3300050511 Bacteria 51574
202 nmdc:mga0sz30_21331_c1 3300050516 Unclassified 2621
203 Ga0500643_001184 3300053087 Bacteria 15569
204 Ga0500643_006489 3300053087 Bacteria 4876
205 Ga0500651_0000011 3300053093 Bacteria 246573
206 Ga0500651_0000021 3300053093 Bacteria 137927
207 Ga0500651_0017835 3300053093 Bacteria 4387
208 Ga0500555_000001 3300053103 Bacteria 1353713
209 Ga0500569_000778 3300053109 Bacteria 5594
210 Ga0500594_0000008 3300053118 Bacteria 102101
211 Ga0500614_000224 3300053123 Bacteria 14867
212 Ga0500588_0000736 3300053146 Bacteria 5593
213 Ga0500622_0064009 3300053156 Bacteria 1871

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026116 Ga0207674_11354066 Ga0207674_113540662 134
2 3300013297 Ga0157378_10857209 Ga0157378_108572091 148
3 3300053093 Ga0500651_0000011 Ga0500651_0000011_167154_167606 148
4 3300053093 Ga0500651_0017835 Ga0500651_0017835_2369_2821 148
5 3300053123 Ga0500614_000224 Ga0500614_000224_2741_3193 148
6 3300003320 rootH2_10185960 rootH2_101859601 149
7 3300005355 Ga0070671_100100003 Ga0070671_1001000032 149
8 3300005356 Ga0070674_100000720 Ga0070674_10000072013 149
9 3300005366 Ga0070659_100046912 Ga0070659_1000469123 149
10 3300005458 Ga0070681_10000577 Ga0070681_1000057714 149
11 3300005466 Ga0070685_10000558 Ga0070685_1000055816 149
12 3300005548 Ga0070665_100001295 Ga0070665_1000012955 149
13 3300005841 Ga0068863_100179483 Ga0068863_1001794832 149
14 3300009098 Ga0105245_10262858 Ga0105245_102628582 149
15 3300009098 Ga0105245_10291012 Ga0105245_102910122 149
16 3300009176 Ga0105242_10003425 Ga0105242_100034256 149
17 3300009177 Ga0105248_10263126 Ga0105248_102631261 149
18 3300009177 Ga0105248_11708872 Ga0105248_117088722 149
19 3300009545 Ga0105237_11145882 Ga0105237_111458822 149
20 3300009551 Ga0105238_10043282 Ga0105238_100432823 149
21 3300013296 Ga0157374_10000056 Ga0157374_1000005671 149
22 3300014745 Ga0157377_10020480 Ga0157377_100204802 149
23 3300014969 Ga0157376_10000001 Ga0157376_10000001725 149
24 3300025924 Ga0207694_10299476 Ga0207694_102994762 149
25 3300025927 Ga0207687_10160325 Ga0207687_101603252 149
26 3300025931 Ga0207644_10490602 Ga0207644_104906022 149
27 3300025932 Ga0207690_10040491 Ga0207690_100404912 149
28 3300025934 Ga0207686_10002187 Ga0207686_100021877 149
29 3300025937 Ga0207669_10003143 Ga0207669_100031437 149
30 3300025941 Ga0207711_10411734 Ga0207711_104117342 149
31 3300026088 Ga0207641_10421973 Ga0207641_104219732 149
32 3300028379 Ga0268266_10000916 Ga0268266_1000091612 149
33 3300048908 Ga0496105_0373970 Ga0496105_0373970_255_710 149
34 3300048915 Ga0496112_0015966 Ga0496112_0015966_3650_4105 149
35 3300053103 Ga0500555_000001 Ga0500555_000001_165754_166206 149
36 3300005530 Ga0070679_100653347 Ga0070679_1006533471 150
37 3300009094 Ga0111539_10005947 Ga0111539_1000594711 150
38 3300025904 Ga0207647_10000410 Ga0207647_100004106 150
39 3300028800 Ga0265338_10002643 Ga0265338_100026439 150
40 3300049589 Ga0501073_0165219 Ga0501073_0165219_673_1131 150
41 3300050511 nmdc:mga08y16_218_c1 nmdc:mga08y16_218_c1_4100_4579 150
42 3300053087 Ga0500643_001184 Ga0500643_001184_6560_7021 150
43 3300053156 Ga0500622_0064009 Ga0500622_0064009_1025_1486 150
44 3300009551 Ga0105238_10527048 Ga0105238_105270482 151
45 3300025913 Ga0207695_10149420 Ga0207695_101494203 151
46 3300005336 Ga0070680_101031361 Ga0070680_1010313611 152
47 3300005459 Ga0068867_100617465 Ga0068867_1006174651 152
48 3300005539 Ga0068853_100020324 Ga0068853_1000203242 152
49 3300005563 Ga0068855_100008303 Ga0068855_1000083038 152
50 3300005843 Ga0068860_100093625 Ga0068860_1000936251 152
51 3300006038 Ga0075365_10005901 Ga0075365_100059013 152
52 3300006051 Ga0075364_10015630 Ga0075364_100156303 152
53 3300013100 Ga0157373_10015398 Ga0157373_100153984 152
54 3300013105 Ga0157369_10019121 Ga0157369_100191219 152
55 3300025941 Ga0207711_10790647 Ga0207711_107906472 152
56 3300025949 Ga0207667_10014016 Ga0207667_100140165 152
57 3300025986 Ga0207658_10286759 Ga0207658_102867591 152
58 3300028381 Ga0268264_10208477 Ga0268264_102084772 152
59 3300028556 Ga0265337_1000043 Ga0265337_100004321 152
60 3300028556 Ga0265337_1004918 Ga0265337_10049182 152
61 3300028558 Ga0265326_10031751 Ga0265326_100317512 152
62 3300028573 Ga0265334_10022024 Ga0265334_100220243 152
63 3300028577 Ga0265318_10015068 Ga0265318_100150683 152
64 3300028666 Ga0265336_10231476 Ga0265336_102314761 152
65 3300028800 Ga0265338_10003277 Ga0265338_100032774 152
66 3300028800 Ga0265338_10028182 Ga0265338_100281824 152
67 3300028800 Ga0265338_10473649 Ga0265338_104736492 152
68 3300028800 Ga0265338_10496469 Ga0265338_104964691 152
69 3300049742 Ga0501080_0130571 Ga0501080_0130571_169_651 152
70 3300050492 nmdc:mga0yw44_3271_c1 nmdc:mga0yw44_3271_c1_1468_1935 152
71 3300001904 JGI24736J21556_1005805 JGI24736J21556_10058054 153
72 3300001979 JGI24740J21852_10002888 JGI24740J21852_100028889 153
73 3300001979 JGI24740J21852_10026767 JGI24740J21852_100267673 153
74 3300001979 JGI24740J21852_10034123 JGI24740J21852_100341232 153
75 3300001989 JGI24739J22299_10000063 JGI24739J22299_1000006319 153
76 3300001990 JGI24737J22298_10000145 JGI24737J22298_1000014518 153
77 3300002067 JGI24735J21928_10000067 JGI24735J21928_100000679 153
78 3300002155 JGI24033J26618_1043899 JGI24033J26618_10438992 153
79 3300003320 rootH2_10231047 rootH2_102310474 153
80 3300003322 rootL2_10162534 rootL2_101625342 153
81 3300003323 rootH1_10021217 rootH1_1002121732 153
82 3300005327 Ga0070658_10000009 Ga0070658_10000009193 153
83 3300005329 Ga0070683_100028754 Ga0070683_1000287545 153
84 3300005329 Ga0070683_100325024 Ga0070683_1003250242 153
85 3300005334 Ga0068869_100261520 Ga0068869_1002615202 153
86 3300005338 Ga0068868_100253953 Ga0068868_1002539532 153
87 3300005339 Ga0070660_100134394 Ga0070660_1001343941 153
88 3300005339 Ga0070660_100255871 Ga0070660_1002558712 153
89 3300005344 Ga0070661_100006529 Ga0070661_10000652910 153
90 3300005344 Ga0070661_100076294 Ga0070661_1000762942 153
91 3300005344 Ga0070661_101426308 Ga0070661_1014263081 153
92 3300005366 Ga0070659_100001064 Ga0070659_10000106415 153
93 3300005366 Ga0070659_100047976 Ga0070659_1000479763 153
94 3300005367 Ga0070667_101818337 Ga0070667_1018183371 153
95 3300005457 Ga0070662_100039453 Ga0070662_1000394531 153
96 3300005457 Ga0070662_100137878 Ga0070662_1001378782 153
97 3300005459 Ga0068867_101428125 Ga0068867_1014281251 153
98 3300005535 Ga0070684_100169114 Ga0070684_1001691142 153
99 3300005563 Ga0068855_100000002 Ga0068855_100000002543 153
100 3300005563 Ga0068855_100000017 Ga0068855_10000001783 153
101 3300005563 Ga0068855_100007452 Ga0068855_1000074528 153
102 3300005564 Ga0070664_100000338 Ga0070664_10000033815 153
103 3300005577 Ga0068857_100000251 Ga0068857_10000025137 153
104 3300005577 Ga0068857_100001672 Ga0068857_10000167217 153
105 3300005577 Ga0068857_100966171 Ga0068857_1009661712 153
106 3300005578 Ga0068854_100004390 Ga0068854_10000439010 153
107 3300005614 Ga0068856_100000060 Ga0068856_10000006027 153
108 3300005614 Ga0068856_100000117 Ga0068856_10000011759 153
109 3300005616 Ga0068852_100045261 Ga0068852_1000452614 153
110 3300005616 Ga0068852_100084623 Ga0068852_1000846235 153
111 3300005719 Ga0068861_100439485 Ga0068861_1004394851 153
112 3300006038 Ga0075365_10000106 Ga0075365_1000010618 153
113 3300006186 Ga0075369_10095157 Ga0075369_100951572 153
114 3300006195 Ga0075366_10001364 Ga0075366_1000136411 153
115 3300006237 Ga0097621_100338749 Ga0097621_1003387492 153
116 3300006353 Ga0075370_10029249 Ga0075370_100292493 153
117 3300006358 Ga0068871_100026689 Ga0068871_1000266892 153
118 3300006881 Ga0068865_100000969 Ga0068865_10000096913 153
119 3300009093 Ga0105240_10000489 Ga0105240_1000048933 153
120 3300009093 Ga0105240_10003612 Ga0105240_1000361210 153
121 3300009093 Ga0105240_10383087 Ga0105240_103830872 153
122 3300009098 Ga0105245_10124226 Ga0105245_101242263 153
123 3300009174 Ga0105241_10370806 Ga0105241_103708061 153
124 3300009551 Ga0105238_10067877 Ga0105238_100678774 153
125 3300009553 Ga0105249_10388067 Ga0105249_103880672 153
126 3300009979 Ga0105032_100010 Ga0105032_10001091 153
127 3300009986 Ga0105033_100602 Ga0105033_1006022 153
128 3300010375 Ga0105239_10008700 Ga0105239_100087003 153
129 3300011119 Ga0105246_10000783 Ga0105246_100007832 153
130 3300011119 Ga0105246_10003793 Ga0105246_100037933 153
131 3300011119 Ga0105246_10015050 Ga0105246_100150502 153
132 3300013100 Ga0157373_10006025 Ga0157373_100060253 153
133 3300013100 Ga0157373_10012732 Ga0157373_100127324 153
134 3300013100 Ga0157373_10031633 Ga0157373_100316331 153
135 3300013102 Ga0157371_10364410 Ga0157371_103644102 153
136 3300013104 Ga0157370_10000984 Ga0157370_100009844 153
137 3300013104 Ga0157370_10154312 Ga0157370_101543123 153
138 3300013105 Ga0157369_10000003 Ga0157369_10000003150 153
139 3300013105 Ga0157369_10000026 Ga0157369_10000026249 153
140 3300013105 Ga0157369_10023455 Ga0157369_100234553 153
141 3300013105 Ga0157369_10229362 Ga0157369_102293623 153
142 3300013296 Ga0157374_10116961 Ga0157374_101169611 153
143 3300013307 Ga0157372_10093755 Ga0157372_100937552 153
144 3300014745 Ga0157377_10000264 Ga0157377_1000026422 153
145 3300014969 Ga0157376_10000054 Ga0157376_1000005485 153
146 3300014969 Ga0157376_10010602 Ga0157376_100106025 153
147 3300025315 Ga0207697_10110486 Ga0207697_101104862 153
148 3300025901 Ga0207688_10014552 Ga0207688_100145525 153
149 3300025904 Ga0207647_10000177 Ga0207647_1000017713 153
150 3300025909 Ga0207705_10000010 Ga0207705_10000010333 153
151 3300025911 Ga0207654_10216763 Ga0207654_102167633 153
152 3300025913 Ga0207695_10001563 Ga0207695_1000156311 153
153 3300025913 Ga0207695_10003061 Ga0207695_1000306110 153
154 3300025919 Ga0207657_10002733 Ga0207657_100027334 153
155 3300025920 Ga0207649_10013475 Ga0207649_100134752 153
156 3300025920 Ga0207649_10032594 Ga0207649_100325945 153
157 3300025924 Ga0207694_10226765 Ga0207694_102267652 153
158 3300025927 Ga0207687_10534540 Ga0207687_105345402 153
159 3300025932 Ga0207690_10013713 Ga0207690_100137133 153
160 3300025932 Ga0207690_10702949 Ga0207690_107029491 153
161 3300025933 Ga0207706_10000004 Ga0207706_10000004210 153
162 3300025938 Ga0207704_10001729 Ga0207704_100017299 153
163 3300025942 Ga0207689_10253180 Ga0207689_102531802 153
164 3300025944 Ga0207661_10046264 Ga0207661_100462645 153
165 3300025944 Ga0207661_10112827 Ga0207661_101128273 153
166 3300025945 Ga0207679_10000069 Ga0207679_1000006919 153
167 3300025949 Ga0207667_10000005 Ga0207667_10000005653 153
168 3300025949 Ga0207667_10000048 Ga0207667_1000004882 153
169 3300025949 Ga0207667_10004604 Ga0207667_1000460411 153
170 3300025981 Ga0207640_10006327 Ga0207640_100063273 153
171 3300026023 Ga0207677_11035140 Ga0207677_110351402 153
172 3300026078 Ga0207702_10000097 Ga0207702_1000009781 153
173 3300026078 Ga0207702_10000271 Ga0207702_1000027133 153
174 3300026116 Ga0207674_10000667 Ga0207674_1000066727 153
175 3300026116 Ga0207674_10133919 Ga0207674_101339192 153
176 3300026118 Ga0207675_101110070 Ga0207675_1011100702 153
177 3300026142 Ga0207698_10000107 Ga0207698_1000010756 153
178 3300026142 Ga0207698_10065194 Ga0207698_100651942 153
179 3300030742 Ga0316183_1029717 Ga0316183_10297172 153
180 3300030742 Ga0316183_1042478 Ga0316183_10424785 153
181 3300030742 Ga0316183_1085278 Ga0316183_10852787 153
182 3300030744 Ga0316181_1226594 Ga0316181_122659424 153
183 3300030745 Ga0316182_1038782 Ga0316182_10387824 153
184 3300031731 Ga0307405_10204318 Ga0307405_102043182 153
185 3300031911 Ga0307412_10011652 Ga0307412_100116526 153
186 3300037312 Ga0395899_0009895 Ga0395899_0009895_4423_4884 153
187 3300037312 Ga0395899_0021729 Ga0395899_0021729_3337_3798 153
188 3300037418 Ga0395900_0000001 Ga0395900_0000001_566991_567452 153
189 3300037466 Ga0395898_0000002 Ga0395898_0000002_538554_539015 153
190 3300038443 Ga0395901_0000006 Ga0395901_0000006_184230_184691 153
191 3300042016 Ga0439463_002381 Ga0439463_002381_4144_4605 153
192 3300042439 Ga0439464_0000042 Ga0439464_0000042_7759_8220 153
193 3300044658 Ga0466972_0047837 Ga0466972_0047837_147_608 153
194 3300044712 Ga0453684_0378461 Ga0453684_0378461_578_1039 153
195 3300045051 Ga0451576_0038551 Ga0451576_0038551_2021_2482 153
196 3300046460 Ga0495638_0013359 Ga0495638_0013359_1212_1673 153
197 3300046542 Ga0495597_0172094 Ga0495597_0172094_306_767 153
198 3300047472 Ga0495686_0046728 Ga0495686_0046728_1302_1763 153
199 3300048912 Ga0496109_0304287 Ga0496109_0304287_893_1354 153
200 3300048916 Ga0496113_0218076 Ga0496113_0218076_555_1016 153
201 3300048927 Ga0496124_0009218 Ga0496124_0009218_7274_7735 153
202 3300049573 Ga0501037_0000011 Ga0501037_0000011_68239_68700 153
203 3300049822 Ga0501035_0941343 Ga0501035_0941343_88_549 153
204 3300050491 nmdc:mga00v17_144630_c1 nmdc:mga00v17_144630_c1_878_1339 153
205 3300050492 nmdc:mga0yw44_82_c2 nmdc:mga0yw44_82_c2_6136_6597 153
206 3300050493 nmdc:mga0k408_1863_c2 nmdc:mga0k408_1863_c2_8060_8521 153
207 3300050496 nmdc:mga07m45_3334_c2 nmdc:mga07m45_3334_c2_6345_6806 153
208 3300050516 nmdc:mga0sz30_21331_c1 nmdc:mga0sz30_21331_c1_827_1288 153
209 3300053087 Ga0500643_006489 Ga0500643_006489_3372_3833 153
210 3300053093 Ga0500651_0000021 Ga0500651_0000021_83380_83841 153
211 3300053109 Ga0500569_000778 Ga0500569_000778_3922_4383 153
212 3300053118 Ga0500594_0000008 Ga0500594_0000008_54087_54548 153
213 3300053146 Ga0500588_0000736 Ga0500588_0000736_3922_4383 153

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01424

R3H

R3H domain

99

158

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2lrr-assembly1.cif.gz_A solution structure of the r3h domain from human smubp-2 in complex with 2'-deoxyguanosine-5'-monophosphate 0.8503 97 151
3gku-assembly2.cif.gz_C-2 crystal structure of a probable rna-binding protein from clostridium symbiosum atcc 14940 0.8275 6 88
2fph-assembly1.cif.gz_X cell division protein ylmh from streptococcus pneumoniae 0.8053 89 152
1msz-assembly1.cif.gz_A solution structure of the r3h domain from human smubp-2 0.7337 95 151
3gku-assembly1.cif.gz_B crystal structure of a probable rna-binding protein from clostridium symbiosum atcc 14940 0.6962 6 150
ID Description Score Start End Superfamily
3gkuB03 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain 0.9184 85 150 3.30.1370.50
af_O53598_123_187_3.30.1370.50 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain 0.9126 90 150 3.30.1370.50
af_Q9Y3T6_11_82_3.30.1370.50 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain 0.8956 89 153 3.30.1370.50
af_A0A0R4IN15_23_108_3.30.1370.50 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;R3H-like domain 0.8835 89 152 3.30.1370.50
af_O53598_41_122_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8819 8 86 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A8A6LEA1-F1-model_v4 deleted 0.9725 1 150
AF-A0A8A6LEA1-F1-model_v4 deleted 0.96 1 150
AF-A0A7T5UW33-F1-model_v4 Single-stranded DNA-binding protein 0.9361 75 153 GO:0003677
GO:0003723
AF-A0A1F7Q6S7-F1-model_v4 R3H domain-containing protein 0.9227 6 151 GO:0003723
AF-A0A848DG58-F1-model_v4 Single-stranded DNA-binding protein 0.9152 4 151 GO:0003677
GO:0003723

Feature Viewer

pLDDT pTM Quality
94.51 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map