F323843

General Info

Members Datasets Scaffolds Average Seq Length
213 155 426 184

Family's Representative Sequence

Representative Sequence 3300005578|Ga0068854_100248391|Ga0068854_1002483911
Length 226
Sequence VSRLDDGLKPGEFILKLAVLSPHRDPLPKGEGVKTYHHLSMRIIAGKFRGRRLKSPPSLQTRPTSDRLRETLFNIVTPRIADARLLDLCAGSGAIGIEALSRGAGYVTFVDQSRKMCDLIEANLQSLEIEDNTVAVISSAAVDFLKRFSKQRAEPFDIIFFDPPYATNYEEALEQISEHAGDLLARDGVVVVEHHKKRELAEEFGSLRRYRVLKQGDSCLSFYERS

Samples

Sample ID Description Type Environment
1 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
44 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
112 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
113 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
114 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
115 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
116 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
122 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
123 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
132 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
133 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
134 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
135 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
136 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
137 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
138 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
139 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
140 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
141 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
142 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
143 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
144 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
145 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
146 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
147 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
148 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
149 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
150 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
151 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
154 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.47
Nodule 0
Rhizoplane 4.69
Rhizosphere 93.9
Stem 0
Stem Tuber 0
Unclassified 21.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068854_100248391 3300005578 Bacteria 1420
2 Ga0070683_100494093 3300005329 Archaea 1169
3 Ga0070690_100135045 3300005330 Bacteria 1670
4 Ga0070690_100155326 3300005330 Bacteria 1564
5 Ga0070670_100003404 3300005331 Bacteria 13186
6 Ga0070670_100513803 3300005331 Bacteria 1066
7 Ga0070677_10072469 3300005333 Bacteria 1453
8 Ga0070680_100898085 3300005336 Bacteria 764
9 Ga0070660_100551722 3300005339 Unclassified 961
10 Ga0070689_100120250 3300005340 Bacteria 2097
11 Ga0070661_100068745 3300005344 Bacteria 2603
12 Ga0070661_100093565 3300005344 Bacteria 2227
13 Ga0070669_100029825 3300005353 Bacteria 3935
14 Ga0070669_100760090 3300005353 Bacteria 822
15 Ga0070675_100613631 3300005354 Bacteria 987
16 Ga0070659_100002050 3300005366 Bacteria 14385
17 Ga0070659_100426747 3300005366 Unclassified 1122
18 Ga0070705_100060770 3300005440 Bacteria 2243
19 Ga0070700_100000245 3300005441 Bacteria 29598
20 Ga0070700_100133549 3300005441 Bacteria 1678
21 Ga0070694_100024313 3300005444 Unclassified 3910
22 Ga0070694_100186474 3300005444 Bacteria 1537
23 Ga0070694_100872859 3300005444 Bacteria 741
24 Ga0070708_100179618 3300005445 Unclassified 1978
25 Ga0070663_100572773 3300005455 Unclassified 946
26 Ga0070662_100631646 3300005457 Unclassified 902
27 Ga0070681_10002416 3300005458 Bacteria 17095
28 Ga0070681_10002827 3300005458 Bacteria 16033
29 Ga0070681_10045114 3300005458 Bacteria 4411
30 Ga0070681_10374883 3300005458 Bacteria 1334
31 Ga0070706_100049333 3300005467 Bacteria 3885
32 Ga0070706_100126214 3300005467 Unclassified 2386
33 Ga0070706_100620803 3300005467 Unclassified 1004
34 Ga0070698_100269758 3300005471 Bacteria 1633
35 Ga0070699_100013682 3300005518 Bacteria 6981
36 Ga0070679_100004402 3300005530 Bacteria 13029
37 Ga0070679_100021150 3300005530 Bacteria 6347
38 Ga0070697_100138789 3300005536 Bacteria 2043
39 Ga0070697_100193880 3300005536 Unclassified 1725
40 Ga0068853_100019483 3300005539 Bacteria 5625
41 Ga0068853_100295934 3300005539 Bacteria 1495
42 Ga0070695_100133105 3300005545 Bacteria 1716
43 Ga0070696_100641848 3300005546 Bacteria 860
44 Ga0070696_100828065 3300005546 Unclassified 763
45 Ga0070696_100853799 3300005546 Bacteria 752
46 Ga0070704_100049282 3300005549 Bacteria 2954
47 Ga0070704_100554074 3300005549 Bacteria 1005
48 Ga0070664_100056257 3300005564 Bacteria 3342
49 Ga0070664_100311569 3300005564 Unclassified 1424
50 Ga0068857_100005375 3300005577 Bacteria 10918
51 Ga0068854_100076599 3300005578 Bacteria 2459
52 Ga0068852_100181234 3300005616 Archaea 1981
53 Ga0068859_100479432 3300005617 Unclassified 1339
54 Ga0068864_100037706 3300005618 Bacteria 4126
55 Ga0068861_100088035 3300005719 Bacteria 2444
56 Ga0068870_10004839 3300005840 Bacteria 5824
57 Ga0068863_100152822 3300005841 Bacteria 2209
58 Ga0068863_100435220 3300005841 Bacteria 1286
59 Ga0068858_100062665 3300005842 Bacteria 3439
60 Ga0068862_100226327 3300005844 Bacteria 1695
61 Ga0068871_100773288 3300006358 Archaea 884
62 Ga0075428_100193252 3300006844 Unclassified 2201
63 Ga0075430_100201416 3300006846 Bacteria 1653
64 Ga0097620_100479457 3300006931 Unclassified 1339
65 Ga0099794_10000704 3300007265 Bacteria 11246
66 Ga0099795_10119407 3300007788 Bacteria 1053
67 Ga0105240_10175153 3300009093 Bacteria 2536
68 Ga0105240_10390470 3300009093 Bacteria 1570
69 Ga0111539_10711267 3300009094 Bacteria 1169
70 Ga0105245_10595874 3300009098 Bacteria 1131
71 Ga0114129_10134989 3300009147 Bacteria 3386
72 Ga0105243_10945762 3300009148 Bacteria 860
73 Ga0105241_10133531 3300009174 Bacteria 2012
74 Ga0105248_10072896 3300009177 Bacteria 3860
75 Ga0105237_10026149 3300009545 Bacteria 5964
76 Ga0105238_10157172 3300009551 Bacteria 2249
77 Ga0099796_10213524 3300010159 Unclassified 788
78 Ga0105239_11151960 3300010375 Archaea 893
79 Ga0105246_10076393 3300011119 Bacteria 2373
80 Ga0157373_10007149 3300013100 Bacteria 8325
81 Ga0157373_10119301 3300013100 Bacteria 1854
82 Ga0157373_10314774 3300013100 Bacteria 1113
83 Ga0157373_10377545 3300013100 Bacteria 1014
84 Ga0157373_10425979 3300013100 Bacteria 953
85 Ga0157369_10444817 3300013105 Bacteria 1342
86 Ga0157374_11154180 3300013296 Bacteria 796
87 Ga0157378_10045479 3300013297 Bacteria 3900
88 Ga0157378_10153423 3300013297 Bacteria 2147
89 Ga0157378_10216039 3300013297 Bacteria 1820
90 Ga0157378_11239651 3300013297 Bacteria 786
91 Ga0163162_10009441 3300013306 Bacteria 9486
92 Ga0163162_10494882 3300013306 Bacteria 1353
93 Ga0157372_10125324 3300013307 Bacteria 2953
94 Ga0157372_10879914 3300013307 Unclassified 1039
95 Ga0157375_11217747 3300013308 Archaea 883
96 Ga0163163_10255970 3300014325 Bacteria 1801
97 Ga0163163_10720905 3300014325 Unclassified 1061
98 Ga0182008_10012340 3300014497 Unclassified 4511
99 Ga0157379_10465268 3300014968 Bacteria 1169
100 Ga0157376_10551378 3300014969 Bacteria 1141
101 Ga0213873_10026471 3300021358 Bacteria 1408
102 Ga0207647_10327542 3300025904 Bacteria 869
103 Ga0207643_10028938 3300025908 Bacteria 3080
104 Ga0207684_10068571 3300025910 Bacteria 3014
105 Ga0207684_10145421 3300025910 Unclassified 2039
106 Ga0207684_10460029 3300025910 Bacteria 1092
107 Ga0207654_10281607 3300025911 Bacteria 1125
108 Ga0207707_10007245 3300025912 Bacteria 9652
109 Ga0207707_10085643 3300025912 Bacteria 2753
110 Ga0207671_10101502 3300025914 Bacteria 2180
111 Ga0207657_10018860 3300025919 Bacteria 6569
112 Ga0207657_10325043 3300025919 Bacteria 1216
113 Ga0207649_10009908 3300025920 Bacteria 5222
114 Ga0207681_10023021 3300025923 Bacteria 3978
115 Ga0207650_10000526 3300025925 Bacteria 31386
116 Ga0207650_10456714 3300025925 Unclassified 1064
117 Ga0207659_10714548 3300025926 Bacteria 858
118 Ga0207687_10321630 3300025927 Bacteria 1252
119 Ga0207690_10046903 3300025932 Bacteria 2864
120 Ga0207670_10015821 3300025936 Bacteria 4517
121 Ga0207691_10092627 3300025940 Bacteria 2706
122 Ga0207711_10059791 3300025941 Bacteria 3282
123 Ga0207661_10552427 3300025944 Bacteria 1055
124 Ga0207661_11198917 3300025944 Unclassified 699
125 Ga0207679_10097401 3300025945 Bacteria 2291
126 Ga0207679_10125192 3300025945 Bacteria 2052
127 Ga0207679_10199319 3300025945 Bacteria 1671
128 Ga0207712_11401945 3300025961 Bacteria 625
129 Ga0207640_10081138 3300025981 Bacteria 2217
130 Ga0207640_10216541 3300025981 Bacteria 1463
131 Ga0207703_10057219 3300026035 Bacteria 3179
132 Ga0207639_10081169 3300026041 Bacteria 2568
133 Ga0207639_10650597 3300026041 Unclassified 975
134 Ga0207678_10195425 3300026067 Bacteria 1729
135 Ga0207708_10000386 3300026075 Bacteria 34516
136 Ga0207708_10128418 3300026075 Bacteria 1980
137 Ga0207641_10138157 3300026088 Bacteria 2195
138 Ga0207641_10179327 3300026088 Bacteria 1939
139 Ga0207641_10195983 3300026088 Bacteria 1859
140 Ga0207641_10798328 3300026088 Unclassified 934
141 Ga0207648_10390539 3300026089 Bacteria 1259
142 Ga0207676_10011873 3300026095 Bacteria 6234
143 Ga0207674_10001736 3300026116 Bacteria 27848
144 Ga0207674_10552943 3300026116 Archaea 1112
145 Ga0207674_10663788 3300026116 Bacteria 1007
146 Ga0207675_100172535 3300026118 Bacteria 2068
147 Ga0207675_100439476 3300026118 Bacteria 1291
148 Ga0207675_101454022 3300026118 Unclassified 706
149 Ga0268265_10021350 3300028380 Bacteria 4535
150 Ga0268265_10662048 3300028380 Bacteria 1005
151 Ga0265338_10101767 3300028800 Bacteria 2338
152 Ga0265316_10193027 3300031344 Bacteria 1512
153 Ga0307408_100017867 3300031548 Bacteria 4752
154 Ga0307408_100282421 3300031548 Bacteria 1383
155 Ga0307413_10076040 3300031824 Bacteria 2133
156 Ga0307410_10110302 3300031852 Bacteria 1990
157 Ga0307406_10074325 3300031901 Bacteria 2237
158 Ga0307412_10026093 3300031911 Bacteria 3628
159 Ga0307412_10406486 3300031911 Bacteria 1110
160 Ga0307409_100290882 3300031995 Unclassified 1515
161 Ga0307416_100064727 3300032002 Bacteria 3001
162 Ga0307414_10132179 3300032004 Bacteria 1939
163 Ga0307414_10233912 3300032004 Bacteria 1517
164 Ga0307411_10013272 3300032005 Bacteria 4539
165 Ga0307415_100029536 3300032126 Bacteria 3505
166 Ga0373938_0165493 3300034957 Unclassified 596
167 Ga0373929_0056482 3300035085 Unclassified 910
168 Ga0373940_0053201 3300035088 Bacteria 1142
169 Ga0373951_0007005 3300035091 Bacteria 2571
170 Ga0373941_0070273 3300035115 Unclassified 1161
171 Ga0373931_0292091 3300035691 Unclassified 1004
172 Ga0395900_0026168 3300037418 Bacteria 5974
173 Ga0395898_0797986 3300037466 Bacteria 884
174 Ga0395901_0731712 3300038443 Bacteria 984
175 Ga0436365_1483199 3300039437 Bacteria 3249
176 Ga0436363_0429723 3300039450 Bacteria 6968
177 Ga0436362_0606873 3300039453 Unclassified 3960
178 Ga0453683_0127331 3300044673 Bacteria 1604
179 Ga0496104_0383605 3300048907 Archaea 1318
180 Ga0496108_0225550 3300048911 Bacteria 1629
181 Ga0496109_0149711 3300048912 Bacteria 2185
182 Ga0496110_0063106 3300048913 Bacteria 3273
183 Ga0496111_0037989 3300048914 Bacteria 3448
184 Ga0496111_0725049 3300048914 Unclassified 722
185 Ga0496112_0061876 3300048915 Bacteria 3691
186 Ga0496112_0579615 3300048915 Bacteria 1054
187 Ga0496112_1007842 3300048915 Unclassified 752
188 Ga0496114_0559984 3300048917 Unclassified 1010
189 Ga0501198_041200 3300049649 Unclassified 800
190 Ga0501202_008836 3300049652 Bacteria 1842
191 Ga0501209_002973 3300049656 Bacteria 2717
192 Ga0501216_013354 3300049660 Unclassified 1361
193 Ga0501217_001336 3300049661 Bacteria 4591
194 Ga0501223_018796 3300049663 Unclassified 1359
195 Ga0501224_005897 3300049664 Unclassified 1767
196 Ga0501227_004778 3300049665 Bacteria 2905
197 Ga0501239_022277 3300049672 Unclassified 785
198 Ga0501240_002492 3300049673 Unclassified 1960
199 Ga0501243_067443 3300049675 Unclassified 674
200 Ga0501253_009182 3300049683 Unclassified 1449
201 Ga0501257_018479 3300049686 Unclassified 1626
202 Ga0501258_011140 3300049687 Unclassified 960
203 Ga0501259_013261 3300049688 Unclassified 1382
204 Ga0501221_010468 3300049704 Bacteria 1648
205 Ga0501225_0013548 3300049705 Bacteria 2281
206 Ga0501234_003811 3300049707 Bacteria 2370
207 Ga0501268_007377 3300049765 Bacteria 1639
208 Ga0501226_001257 3300049853 Bacteria 3289
209 nmdc:mga0qj67_254547_c1 3300050509 Bacteria 1424
210 nmdc:mga08y16_738391_c1 3300050511 Unclassified 981
211 Ga0500641_0005952 3300053096 Bacteria 4318
212 Ga0501084_0379314 3300054114 Bacteria 1195
213 Ga0501082_0368989 3300060353 Bacteria 1252
214 Ga0068854_100248391
215 Ga0070683_100494093
216 Ga0070690_100135045
217 Ga0070690_100155326
218 Ga0070670_100003404
219 Ga0070670_100513803
220 Ga0070677_10072469
221 Ga0070680_100898085
222 Ga0070660_100551722
223 Ga0070689_100120250
224 Ga0070661_100068745
225 Ga0070661_100093565
226 Ga0070669_100029825
227 Ga0070669_100760090
228 Ga0070675_100613631
229 Ga0070659_100002050
230 Ga0070659_100426747
231 Ga0070705_100060770
232 Ga0070700_100000245
233 Ga0070700_100133549
234 Ga0070694_100024313
235 Ga0070694_100186474
236 Ga0070694_100872859
237 Ga0070708_100179618
238 Ga0070663_100572773
239 Ga0070662_100631646
240 Ga0070681_10002416
241 Ga0070681_10002827
242 Ga0070681_10045114
243 Ga0070681_10374883
244 Ga0070706_100049333
245 Ga0070706_100126214
246 Ga0070706_100620803
247 Ga0070698_100269758
248 Ga0070699_100013682
249 Ga0070679_100004402
250 Ga0070679_100021150
251 Ga0070697_100138789
252 Ga0070697_100193880
253 Ga0068853_100019483
254 Ga0068853_100295934
255 Ga0070695_100133105
256 Ga0070696_100641848
257 Ga0070696_100828065
258 Ga0070696_100853799
259 Ga0070704_100049282
260 Ga0070704_100554074
261 Ga0070664_100056257
262 Ga0070664_100311569
263 Ga0068857_100005375
264 Ga0068854_100076599
265 Ga0068852_100181234
266 Ga0068859_100479432
267 Ga0068864_100037706
268 Ga0068861_100088035
269 Ga0068870_10004839
270 Ga0068863_100152822
271 Ga0068863_100435220
272 Ga0068858_100062665
273 Ga0068862_100226327
274 Ga0068871_100773288
275 Ga0075428_100193252
276 Ga0075430_100201416
277 Ga0097620_100479457
278 Ga0099794_10000704
279 Ga0099795_10119407
280 Ga0105240_10175153
281 Ga0105240_10390470
282 Ga0111539_10711267
283 Ga0105245_10595874
284 Ga0114129_10134989
285 Ga0105243_10945762
286 Ga0105241_10133531
287 Ga0105248_10072896
288 Ga0105237_10026149
289 Ga0105238_10157172
290 Ga0099796_10213524
291 Ga0105239_11151960
292 Ga0105246_10076393
293 Ga0157373_10007149
294 Ga0157373_10119301
295 Ga0157373_10314774
296 Ga0157373_10377545
297 Ga0157373_10425979
298 Ga0157369_10444817
299 Ga0157374_11154180
300 Ga0157378_10045479
301 Ga0157378_10153423
302 Ga0157378_10216039
303 Ga0157378_11239651
304 Ga0163162_10009441
305 Ga0163162_10494882
306 Ga0157372_10125324
307 Ga0157372_10879914
308 Ga0157375_11217747
309 Ga0163163_10255970
310 Ga0163163_10720905
311 Ga0182008_10012340
312 Ga0157379_10465268
313 Ga0157376_10551378
314 Ga0213873_10026471
315 Ga0207647_10327542
316 Ga0207643_10028938
317 Ga0207684_10068571
318 Ga0207684_10145421
319 Ga0207684_10460029
320 Ga0207654_10281607
321 Ga0207707_10007245
322 Ga0207707_10085643
323 Ga0207671_10101502
324 Ga0207657_10018860
325 Ga0207657_10325043
326 Ga0207649_10009908
327 Ga0207681_10023021
328 Ga0207650_10000526
329 Ga0207650_10456714
330 Ga0207659_10714548
331 Ga0207687_10321630
332 Ga0207690_10046903
333 Ga0207670_10015821
334 Ga0207691_10092627
335 Ga0207711_10059791
336 Ga0207661_10552427
337 Ga0207661_11198917
338 Ga0207679_10097401
339 Ga0207679_10125192
340 Ga0207679_10199319
341 Ga0207712_11401945
342 Ga0207640_10081138
343 Ga0207640_10216541
344 Ga0207703_10057219
345 Ga0207639_10081169
346 Ga0207639_10650597
347 Ga0207678_10195425
348 Ga0207708_10000386
349 Ga0207708_10128418
350 Ga0207641_10138157
351 Ga0207641_10179327
352 Ga0207641_10195983
353 Ga0207641_10798328
354 Ga0207648_10390539
355 Ga0207676_10011873
356 Ga0207674_10001736
357 Ga0207674_10552943
358 Ga0207674_10663788
359 Ga0207675_100172535
360 Ga0207675_100439476
361 Ga0207675_101454022
362 Ga0268265_10021350
363 Ga0268265_10662048
364 Ga0265338_10101767
365 Ga0265316_10193027
366 Ga0307408_100017867
367 Ga0307408_100282421
368 Ga0307413_10076040
369 Ga0307410_10110302
370 Ga0307406_10074325
371 Ga0307412_10026093
372 Ga0307412_10406486
373 Ga0307409_100290882
374 Ga0307416_100064727
375 Ga0307414_10132179
376 Ga0307414_10233912
377 Ga0307411_10013272
378 Ga0307415_100029536
379 Ga0373938_0165493
380 Ga0373929_0056482
381 Ga0373940_0053201
382 Ga0373951_0007005
383 Ga0373941_0070273
384 Ga0373931_0292091
385 Ga0395900_0026168
386 Ga0395898_0797986
387 Ga0395901_0731712
388 Ga0436365_1483199
389 Ga0436363_0429723
390 Ga0436362_0606873
391 Ga0453683_0127331
392 Ga0496104_0383605
393 Ga0496108_0225550
394 Ga0496109_0149711
395 Ga0496110_0063106
396 Ga0496111_0037989
397 Ga0496111_0725049
398 Ga0496112_0061876
399 Ga0496112_0579615
400 Ga0496112_1007842
401 Ga0496114_0559984
402 Ga0501198_041200
403 Ga0501202_008836
404 Ga0501209_002973
405 Ga0501216_013354
406 Ga0501217_001336
407 Ga0501223_018796
408 Ga0501224_005897
409 Ga0501227_004778
410 Ga0501239_022277
411 Ga0501240_002492
412 Ga0501243_067443
413 Ga0501253_009182
414 Ga0501257_018479
415 Ga0501258_011140
416 Ga0501259_013261
417 Ga0501221_010468
418 Ga0501225_0013548
419 Ga0501234_003811
420 Ga0501268_007377
421 Ga0501226_001257
422 nmdc:mga0qj67_254547_c1
423 nmdc:mga08y16_738391_c1
424 Ga0500641_0005952
425 Ga0501084_0379314
426 Ga0501082_0368989

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03602

Cons_hypoth95

Conserved hypothetical protein 95

41

224

0.94

PF13847

Methyltransf_31

Methyltransferase domain

81

222

0.82

PF05175

MTS

Methyltransferase small domain

53

216

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m1c-assembly1.cif.gz_A crystal structure of rsmd methyltransferase of m. tuberculosis in complex with sinefungin reveals key interactions 0.9138 7 172
2esr-assembly1.cif.gz_B conserved hypothetical protein- streptococcus pyogenes 0.9007 14 171
2fhp-assembly2.cif.gz_B crystal structure of putative methylase from enterococcus faecalis 0.9005 11 172
2fhp-assembly1.cif.gz_A crystal structure of putative methylase from enterococcus faecalis 0.8993 1 172
3p9n-assembly1.cif.gz_A rv2966c of m. tuberculosis is a rsmd-like methyltransferase 0.8924 1 172
ID Description Score Start End Superfamily
af_Q2FZF6_1_156_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9322 11 172 3.40.50.150
af_Q2FZF6_1_156_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9094 11 172 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9012 29 100 3.40.50.150
6aieC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9006 2 172 3.40.50.150
2fhpB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8931 10 172 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1Q7UVI7-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9771 36 171 GO:0003676
GO:0008168
GO:0031167
AF-A0A2N2D171-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9667 3 171 GO:0008168
GO:0031167
AF-A0A2V9Z5E9-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9664 1 172 GO:0008168
GO:0031167
AF-A0A0S6VTU7-F1-model_v4 N6-adenine-specific methylase 0.9622 29 170 GO:0003676
GO:0008168
GO:0031167
AF-A0A3M1WBJ1-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD (EC 2.1.1.171) 0.9619 3 171 GO:0003676
GO:0052913

Map