F323817

General Info

Members Datasets Scaffolds Average Seq Length
213 132 426 204

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100012698|Ga0068853_1000126987
Length 209
Sequence MLTADVISFREFAMHEPLPLSTIQTAVLEFLQGRDDAVLFGAQAVNAYVDEPRATQDVDIMSADAAELADELREYLSERFHIAVRVREIAGKGFRVYQTRKEGNRHLVDIRLQEPMPETNVIENVRVLTPAELIVSKVLSYDSRRGKPKSGTDWRDAAVLLRQFPQYKVADGEISQRLLDKDASATAMNSWQQLVEQDLTEDEDDDLSY

Samples

Sample ID Description Type Environment
1 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
118 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
119 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
120 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
121 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
122 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
123 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
125 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
126 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
127 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
128 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
129 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
130 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
131 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
132 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.94
Rhizosphere 98.12
Stem 0
Stem Tuber 0
Unclassified 20.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068853_100012698 3300005539 Bacteria 6858
2 JGI25406J46586_10051997 3300003203 Unclassified 1367
3 Ga0065704_10095253 3300005289 Bacteria 2497
4 Ga0065704_10210806 3300005289 Bacteria 1110
5 Ga0070690_100032580 3300005330 Bacteria 3256
6 Ga0070670_100553490 3300005331 Unclassified 1026
7 Ga0068869_100054668 3300005334 Bacteria 2907
8 Ga0068869_100124477 3300005334 Unclassified 1976
9 Ga0070666_10087320 3300005335 Bacteria 2138
10 Ga0070682_100000048 3300005337 Bacteria 129542
11 Ga0068868_100319999 3300005338 Bacteria 1321
12 Ga0070689_100001167 3300005340 Bacteria 16600
13 Ga0070689_100232295 3300005340 Bacteria 1516
14 Ga0070687_100113014 3300005343 Bacteria 1540
15 Ga0070668_100004184 3300005347 Bacteria 10694
16 Ga0070675_100604756 3300005354 Bacteria 994
17 Ga0070671_100365943 3300005355 Unclassified 1231
18 Ga0070673_100106064 3300005364 Bacteria 2322
19 Ga0070688_100085474 3300005365 Bacteria 2050
20 Ga0070703_10000243 3300005406 Bacteria 26447
21 Ga0070694_100023782 3300005444 Bacteria 3946
22 Ga0070694_100072203 3300005444 Bacteria 2380
23 Ga0070708_100015342 3300005445 Bacteria 6325
24 Ga0070708_100071096 3300005445 Bacteria 3132
25 Ga0070708_100191163 3300005445 Unclassified 1914
26 Ga0070708_100246904 3300005445 Unclassified 1676
27 Ga0070708_101265717 3300005445 Bacteria 689
28 Ga0070678_100596680 3300005456 Bacteria 985
29 Ga0070706_100037317 3300005467 Bacteria 4489
30 Ga0070706_100053476 3300005467 Bacteria 3727
31 Ga0070706_100090883 3300005467 Bacteria 2831
32 Ga0070706_100553110 3300005467 Unclassified 1070
33 Ga0070706_100609394 3300005467 Unclassified 1014
34 Ga0070707_100054473 3300005468 Bacteria 3835
35 Ga0070707_100125501 3300005468 Bacteria 2493
36 Ga0070707_100181472 3300005468 Bacteria 2052
37 Ga0070707_100184554 3300005468 Bacteria 2034
38 Ga0070707_100333903 3300005468 Bacteria 1473
39 Ga0070707_100562514 3300005468 Bacteria 1102
40 Ga0070707_100687975 3300005468 Bacteria 985
41 Ga0070707_101042795 3300005468 Unclassified 783
42 Ga0070698_100008990 3300005471 Bacteria 10744
43 Ga0070698_100026585 3300005471 Bacteria 6024
44 Ga0070698_100092186 3300005471 Bacteria 3011
45 Ga0070698_100182204 3300005471 Unclassified 2038
46 Ga0070698_100459787 3300005471 Bacteria 1209
47 Ga0070698_100851691 3300005471 Unclassified 856
48 Ga0070699_100055673 3300005518 Bacteria 3424
49 Ga0070699_100555286 3300005518 Unclassified 1045
50 Ga0070699_101015012 3300005518 Unclassified 761
51 Ga0070697_100015116 3300005536 Bacteria 6061
52 Ga0070697_100967584 3300005536 Unclassified 756
53 Ga0070672_100036957 3300005543 Bacteria 3724
54 Ga0070686_100015772 3300005544 Bacteria 4385
55 Ga0070695_100341545 3300005545 Bacteria 1119
56 Ga0070696_100014588 3300005546 Bacteria 5275
57 Ga0070696_100226935 3300005546 Bacteria 1404
58 Ga0070704_100151961 3300005549 Unclassified 1821
59 Ga0070704_101216288 3300005549 Bacteria 687
60 Ga0068855_100438754 3300005563 Bacteria 1426
61 Ga0068854_100130385 3300005578 Bacteria 1919
62 Ga0070702_100167099 3300005615 Bacteria 1428
63 Ga0068852_100545205 3300005616 Bacteria 1159
64 Ga0068859_100005538 3300005617 Bacteria 12861
65 Ga0068859_100025811 3300005617 Bacteria 5895
66 Ga0068859_100494365 3300005617 Bacteria 1319
67 Ga0068859_100845395 3300005617 Bacteria 1001
68 Ga0068859_100867058 3300005617 Unclassified 988
69 Ga0068859_101029531 3300005617 Unclassified 905
70 Ga0068859_101371316 3300005617 Unclassified 780
71 Ga0068864_100681996 3300005618 Bacteria 1002
72 Ga0068864_100728644 3300005618 Unclassified 970
73 Ga0068866_10014072 3300005718 Bacteria 3524
74 Ga0068866_10018046 3300005718 Bacteria 3185
75 Ga0068870_10069879 3300005840 Bacteria 1912
76 Ga0068863_100022819 3300005841 Bacteria 5979
77 Ga0068863_100036724 3300005841 Bacteria 4666
78 Ga0068860_100131248 3300005843 Bacteria 2404
79 Ga0068862_100027159 3300005844 Bacteria 4817
80 Ga0081455_10006719 3300005937 Bacteria 12287
81 Ga0081539_10002577 3300005985 Bacteria 25025
82 Ga0070716_100000004 3300006173 Bacteria 296614
83 Ga0070716_100157428 3300006173 Bacteria 1468
84 Ga0070716_100417641 3300006173 Bacteria 969
85 Ga0097621_100081684 3300006237 Bacteria 2690
86 Ga0068871_100032382 3300006358 Bacteria 4129
87 Ga0075433_10041379 3300006852 Bacteria 3992
88 Ga0075434_100190975 3300006871 Bacteria 2069
89 Ga0075429_100020825 3300006880 Bacteria 5690
90 Ga0068865_100005351 3300006881 Bacteria 7774
91 Ga0068865_100438957 3300006881 Unclassified 1077
92 Ga0075436_100033513 3300006914 Bacteria 3540
93 Ga0097620_100005538 3300006931 Bacteria 12861
94 Ga0097620_100025808 3300006931 Bacteria 5895
95 Ga0097620_100494342 3300006931 Bacteria 1319
96 Ga0097620_100845381 3300006931 Bacteria 1001
97 Ga0097620_100867044 3300006931 Unclassified 988
98 Ga0097620_101029603 3300006931 Unclassified 905
99 Ga0097620_101371326 3300006931 Unclassified 780
100 Ga0105240_10332119 3300009093 Bacteria 1729
101 Ga0105245_10064480 3300009098 Bacteria 3310
102 Ga0114129_10012139 3300009147 Bacteria 12265
103 Ga0114129_10062284 3300009147 Bacteria 5212
104 Ga0105243_10000364 3300009148 Bacteria 48410
105 Ga0105243_10023383 3300009148 Bacteria 4706
106 Ga0105243_10072452 3300009148 Bacteria 2789
107 Ga0105243_11393108 3300009148 Unclassified 721
108 Ga0105242_10000270 3300009176 Bacteria 41208
109 Ga0105242_10240351 3300009176 Bacteria 1628
110 Ga0105242_10657249 3300009176 Bacteria 1020
111 Ga0105248_10098514 3300009177 Bacteria 3293
112 Ga0105249_10002055 3300009553 Bacteria 17465
113 Ga0105249_10103306 3300009553 Bacteria 2684
114 Ga0105249_10121434 3300009553 Bacteria 2483
115 Ga0105239_10917833 3300010375 Bacteria 1005
116 Ga0105246_10356485 3300011119 Bacteria 1200
117 Ga0157370_10800939 3300013104 Unclassified 857
118 Ga0157369_10016428 3300013105 Bacteria 8324
119 Ga0157374_10013305 3300013296 Bacteria 7179
120 Ga0157378_10024799 3300013297 Bacteria 5281
121 Ga0157378_10037878 3300013297 Bacteria 4273
122 Ga0157378_10155980 3300013297 Bacteria 2131
123 Ga0157378_11183152 3300013297 Unclassified 803
124 Ga0163162_10000162 3300013306 Bacteria 61820
125 Ga0163162_10374716 3300013306 Bacteria 1556
126 Ga0157372_10985971 3300013307 Unclassified 976
127 Ga0157375_10005270 3300013308 Bacteria 11232
128 Ga0157375_10400502 3300013308 Bacteria 1539
129 Ga0163163_10555894 3300014325 Bacteria 1210
130 Ga0157380_10004438 3300014326 Bacteria 9720
131 Ga0157380_10037126 3300014326 Bacteria 3774
132 Ga0157376_10029105 3300014969 Bacteria 4399
133 Ga0163161_10029373 3300017792 Bacteria 3909
134 Ga0207653_10000239 3300025885 Bacteria 36531
135 Ga0207642_10003676 3300025899 Bacteria 4874
136 Ga0207699_10000013 3300025906 Bacteria 261480
137 Ga0207643_10196321 3300025908 Bacteria 1227
138 Ga0207684_10010909 3300025910 Bacteria 7966
139 Ga0207684_10031514 3300025910 Bacteria 4510
140 Ga0207684_10525083 3300025910 Bacteria 1014
141 Ga0207684_10729435 3300025910 Unclassified 841
142 Ga0207684_10731796 3300025910 Unclassified 839
143 Ga0207654_10194248 3300025911 Bacteria 1332
144 Ga0207654_10218356 3300025911 Unclassified 1263
145 Ga0207695_10464858 3300025913 Unclassified 1148
146 Ga0207662_10065615 3300025918 Bacteria 2186
147 Ga0207646_10082328 3300025922 Bacteria 2878
148 Ga0207646_10524484 3300025922 Unclassified 1066
149 Ga0207681_10303916 3300025923 Bacteria 1263
150 Ga0207650_10206995 3300025925 Bacteria 1574
151 Ga0207687_10317141 3300025927 Bacteria 1261
152 Ga0207686_10000039 3300025934 Bacteria 126792
153 Ga0207686_10211443 3300025934 Bacteria 1395
154 Ga0207709_10000192 3300025935 Bacteria 81277
155 Ga0207709_10029006 3300025935 Bacteria 3204
156 Ga0207709_10332406 3300025935 Bacteria 1141
157 Ga0207670_10001561 3300025936 Bacteria 12063
158 Ga0207670_10259569 3300025936 Bacteria 1346
159 Ga0207665_10000006 3300025939 Bacteria 184957
160 Ga0207665_10180489 3300025939 Bacteria 1528
161 Ga0207691_10027214 3300025940 Bacteria 5364
162 Ga0207711_10190747 3300025941 Bacteria 1867
163 Ga0207711_10466933 3300025941 Bacteria 1175
164 Ga0207689_10001615 3300025942 Bacteria 21365
165 Ga0207689_10099308 3300025942 Unclassified 2392
166 Ga0207651_10047720 3300025960 Bacteria 2890
167 Ga0207651_10126789 3300025960 Bacteria 1946
168 Ga0207712_10001476 3300025961 Bacteria 16047
169 Ga0207712_10167962 3300025961 Bacteria 1712
170 Ga0207668_10000926 3300025972 Bacteria 17613
171 Ga0207640_10072282 3300025981 Bacteria 2326
172 Ga0207640_10100145 3300025981 Bacteria 2030
173 Ga0207677_10126912 3300026023 Bacteria 1929
174 Ga0207703_10126970 3300026035 Bacteria 2197
175 Ga0207639_10012253 3300026041 Bacteria 5969
176 Ga0207708_10602726 3300026075 Unclassified 931
177 Ga0207641_10068076 3300026088 Bacteria 3051
178 Ga0207641_10282876 3300026088 Bacteria 1561
179 Ga0207641_10594710 3300026088 Bacteria 1082
180 Ga0207648_10332775 3300026089 Bacteria 1366
181 Ga0207648_10653505 3300026089 Bacteria 972
182 Ga0207676_10042446 3300026095 Bacteria 3498
183 Ga0207675_100774174 3300026118 Bacteria 972
184 Ga0207683_10656169 3300026121 Bacteria 972
185 Ga0207428_10042643 3300027907 Bacteria 3669
186 Ga0268265_10072513 3300028380 Bacteria 2686
187 Ga0268264_10094154 3300028381 Bacteria 2589
188 Ga0307513_10550718 3300031456 Bacteria 866
189 Ga0307408_100064422 3300031548 Unclassified 2684
190 Ga0307405_11002728 3300031731 Unclassified 712
191 Ga0307410_10129348 3300031852 Unclassified 1853
192 Ga0307406_10037705 3300031901 Bacteria 2987
193 Ga0307412_10718483 3300031911 Unclassified 859
194 Ga0307414_10018243 3300032004 Bacteria 4313
195 Ga0307411_10029153 3300032005 Bacteria 3366
196 Ga0307415_100022333 3300032126 Bacteria 3902
197 Ga0400489_36399 3300039093 Bacteria 8992
198 Ga0453683_0376291 3300044673 Unclassified 914
199 Ga0453684_0035188 3300044712 Bacteria 6927
200 Ga0495610_0038219 3300046512 Bacteria 2438
201 Ga0496107_0576346 3300048910 Unclassified 833
202 Ga0496108_0197344 3300048911 Unclassified 1746
203 Ga0501046_0637815 3300049580 Unclassified 754
204 Ga0501076_0431327 3300049592 Bacteria 1085
205 nmdc:mga05p37_176746_c2 3300050507 Unclassified 2218
206 nmdc:mga05p37_23881_c1 3300050507 Bacteria 7424
207 nmdc:mga09592_367309_c1 3300050508 Bacteria 1245
208 nmdc:mga08y16_315975_c1 3300050511 Bacteria 1609
209 nmdc:mga08x19_115040_c1 3300050514 Bacteria 1798
210 nmdc:mga0a205_243366_c1 3300050515 Bacteria 1680
211 Ga0495655_0007789 3300053083 Bacteria 2008
212 Ga0501082_0353101 3300060353 Bacteria 1282
213 Ga0530510_0685048 3300061734 Unclassified 781
214 Ga0068853_100012698
215 JGI25406J46586_10051997
216 Ga0065704_10095253
217 Ga0065704_10210806
218 Ga0070690_100032580
219 Ga0070670_100553490
220 Ga0068869_100054668
221 Ga0068869_100124477
222 Ga0070666_10087320
223 Ga0070682_100000048
224 Ga0068868_100319999
225 Ga0070689_100001167
226 Ga0070689_100232295
227 Ga0070687_100113014
228 Ga0070668_100004184
229 Ga0070675_100604756
230 Ga0070671_100365943
231 Ga0070673_100106064
232 Ga0070688_100085474
233 Ga0070703_10000243
234 Ga0070694_100023782
235 Ga0070694_100072203
236 Ga0070708_100015342
237 Ga0070708_100071096
238 Ga0070708_100191163
239 Ga0070708_100246904
240 Ga0070708_101265717
241 Ga0070678_100596680
242 Ga0070706_100037317
243 Ga0070706_100053476
244 Ga0070706_100090883
245 Ga0070706_100553110
246 Ga0070706_100609394
247 Ga0070707_100054473
248 Ga0070707_100125501
249 Ga0070707_100181472
250 Ga0070707_100184554
251 Ga0070707_100333903
252 Ga0070707_100562514
253 Ga0070707_100687975
254 Ga0070707_101042795
255 Ga0070698_100008990
256 Ga0070698_100026585
257 Ga0070698_100092186
258 Ga0070698_100182204
259 Ga0070698_100459787
260 Ga0070698_100851691
261 Ga0070699_100055673
262 Ga0070699_100555286
263 Ga0070699_101015012
264 Ga0070697_100015116
265 Ga0070697_100967584
266 Ga0070672_100036957
267 Ga0070686_100015772
268 Ga0070695_100341545
269 Ga0070696_100014588
270 Ga0070696_100226935
271 Ga0070704_100151961
272 Ga0070704_101216288
273 Ga0068855_100438754
274 Ga0068854_100130385
275 Ga0070702_100167099
276 Ga0068852_100545205
277 Ga0068859_100005538
278 Ga0068859_100025811
279 Ga0068859_100494365
280 Ga0068859_100845395
281 Ga0068859_100867058
282 Ga0068859_101029531
283 Ga0068859_101371316
284 Ga0068864_100681996
285 Ga0068864_100728644
286 Ga0068866_10014072
287 Ga0068866_10018046
288 Ga0068870_10069879
289 Ga0068863_100022819
290 Ga0068863_100036724
291 Ga0068860_100131248
292 Ga0068862_100027159
293 Ga0081455_10006719
294 Ga0081539_10002577
295 Ga0070716_100000004
296 Ga0070716_100157428
297 Ga0070716_100417641
298 Ga0097621_100081684
299 Ga0068871_100032382
300 Ga0075433_10041379
301 Ga0075434_100190975
302 Ga0075429_100020825
303 Ga0068865_100005351
304 Ga0068865_100438957
305 Ga0075436_100033513
306 Ga0097620_100005538
307 Ga0097620_100025808
308 Ga0097620_100494342
309 Ga0097620_100845381
310 Ga0097620_100867044
311 Ga0097620_101029603
312 Ga0097620_101371326
313 Ga0105240_10332119
314 Ga0105245_10064480
315 Ga0114129_10012139
316 Ga0114129_10062284
317 Ga0105243_10000364
318 Ga0105243_10023383
319 Ga0105243_10072452
320 Ga0105243_11393108
321 Ga0105242_10000270
322 Ga0105242_10240351
323 Ga0105242_10657249
324 Ga0105248_10098514
325 Ga0105249_10002055
326 Ga0105249_10103306
327 Ga0105249_10121434
328 Ga0105239_10917833
329 Ga0105246_10356485
330 Ga0157370_10800939
331 Ga0157369_10016428
332 Ga0157374_10013305
333 Ga0157378_10024799
334 Ga0157378_10037878
335 Ga0157378_10155980
336 Ga0157378_11183152
337 Ga0163162_10000162
338 Ga0163162_10374716
339 Ga0157372_10985971
340 Ga0157375_10005270
341 Ga0157375_10400502
342 Ga0163163_10555894
343 Ga0157380_10004438
344 Ga0157380_10037126
345 Ga0157376_10029105
346 Ga0163161_10029373
347 Ga0207653_10000239
348 Ga0207642_10003676
349 Ga0207699_10000013
350 Ga0207643_10196321
351 Ga0207684_10010909
352 Ga0207684_10031514
353 Ga0207684_10525083
354 Ga0207684_10729435
355 Ga0207684_10731796
356 Ga0207654_10194248
357 Ga0207654_10218356
358 Ga0207695_10464858
359 Ga0207662_10065615
360 Ga0207646_10082328
361 Ga0207646_10524484
362 Ga0207681_10303916
363 Ga0207650_10206995
364 Ga0207687_10317141
365 Ga0207686_10000039
366 Ga0207686_10211443
367 Ga0207709_10000192
368 Ga0207709_10029006
369 Ga0207709_10332406
370 Ga0207670_10001561
371 Ga0207670_10259569
372 Ga0207665_10000006
373 Ga0207665_10180489
374 Ga0207691_10027214
375 Ga0207711_10190747
376 Ga0207711_10466933
377 Ga0207689_10001615
378 Ga0207689_10099308
379 Ga0207651_10047720
380 Ga0207651_10126789
381 Ga0207712_10001476
382 Ga0207712_10167962
383 Ga0207668_10000926
384 Ga0207640_10072282
385 Ga0207640_10100145
386 Ga0207677_10126912
387 Ga0207703_10126970
388 Ga0207639_10012253
389 Ga0207708_10602726
390 Ga0207641_10068076
391 Ga0207641_10282876
392 Ga0207641_10594710
393 Ga0207648_10332775
394 Ga0207648_10653505
395 Ga0207676_10042446
396 Ga0207675_100774174
397 Ga0207683_10656169
398 Ga0207428_10042643
399 Ga0268265_10072513
400 Ga0268264_10094154
401 Ga0307513_10550718
402 Ga0307408_100064422
403 Ga0307405_11002728
404 Ga0307410_10129348
405 Ga0307406_10037705
406 Ga0307412_10718483
407 Ga0307414_10018243
408 Ga0307411_10029153
409 Ga0307415_100022333
410 Ga0400489_36399
411 Ga0453683_0376291
412 Ga0453684_0035188
413 Ga0495610_0038219
414 Ga0496107_0576346
415 Ga0496108_0197344
416 Ga0501046_0637815
417 Ga0501076_0431327
418 nmdc:mga05p37_176746_c2
419 nmdc:mga05p37_23881_c1
420 nmdc:mga09592_367309_c1
421 nmdc:mga08y16_315975_c1
422 nmdc:mga08x19_115040_c1
423 nmdc:mga0a205_243366_c1
424 Ga0495655_0007789
425 Ga0501082_0353101
426 Ga0530510_0685048

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08843

AbiEii

Nucleotidyl transferase AbiEii toxin, Type IV TA system

25

207

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wse-assembly1.cif.gz_A crystal structure of the mimivirus polyadenylate synthase 0.8375 20 166
4p37-assembly1.cif.gz_A crystal structure of the megavirus polyadenylate synthase 0.8189 20 166
4p37-assembly1.cif.gz_B crystal structure of the megavirus polyadenylate synthase 0.7894 20 166
4wse-assembly1.cif.gz_B crystal structure of the mimivirus polyadenylate synthase 0.7563 5 166
7ycu-assembly1.cif.gz_C-2 heterotetramer of antitoxin prpa together with toxin prpt from pseudoalteromonas rubra 0.7265 84 119
ID Description Score Start End Superfamily
af_P11532_2694_2795_1.20.58.60 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.781 131 169 1.20.58.60
af_A0A2R8QLM0_885_1210_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7714 83 113 2.130.10.10
3er8C03 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Poxvirus poly(A) polymerase, nucleotidyltransferase domain 0.7698 17 131 3.30.460.60
af_Q58319_5_91_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.734 84 112 3.30.2310.20
af_Q91WG4_7_164_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7027 82 117 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A6P0WX37-F1-model_v4 Nucleotidyl transferase AbiEii/AbiGii toxin family protein 0.9825 28 207 GO:0016740
AF-A0A6P0MUH4-F1-model_v4 Nucleotidyl transferase AbiEii/AbiGii toxin family protein 0.9786 18 146
AF-A0A7C2Y5U6-F1-model_v4 Nucleotidyl transferase AbiEii/AbiGii toxin family protein 0.9778 23 209
AF-K9ER53-F1-model_v4 deleted 0.9764 16 209
AF-A0A2V9IUV7-F1-model_v4 Nucleotidyl transferase AbiEii/AbiGii toxin family protein 0.9757 34 209

Map