F323798

General Info

Members Datasets Scaffolds Average Seq Length
213 156 426 164

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100608570|Ga0070707_1006085702
Length 195
Sequence VKLGEVKRLADLGRCCSVSALAFVVHGQLSRMRRLFLVLALAITAGCAGKQGHYVGGTHVPYSPANESVLKACEEYRLAVERGDADALMLMAHKQYWEDSGTPSGSDDYGYDGLRNVLLTRLLKATDIRYSVRYLAVHQQCSDLQPTCRAAVDIMIDASYTVTNAYGKAARPDKRDQNQLVLEWDGRRWLILSGM

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
57 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
89 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
92 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
96 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
97 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
98 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
107 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
108 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
109 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
110 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
113 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
114 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
115 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
116 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
117 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
118 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
123 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
124 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
128 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
131 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
135 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
136 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
137 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
138 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
139 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
140 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
141 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
142 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
143 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
144 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
145 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
146 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
147 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
148 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
149 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
150 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
151 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
152 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
153 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
154 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
155 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
156 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.74
Nodule 0
Rhizoplane 1.41
Rhizosphere 82.16
Stem 0
Stem Tuber 0
Unclassified 15.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100608570 3300005468 Bacteria 1055
2 Ga0070683_100045952 3300005329 Bacteria 4032
3 Ga0070683_100477868 3300005329 Bacteria 1190
4 Ga0070690_100489174 3300005330 Bacteria 918
5 Ga0070670_100696638 3300005331 Bacteria 913
6 Ga0068869_100038185 3300005334 Bacteria 3420
7 Ga0070680_100209316 3300005336 Bacteria 1645
8 Ga0070682_100168921 3300005337 Unclassified 1518
9 Ga0068868_100417002 3300005338 Bacteria 1162
10 Ga0070689_100012401 3300005340 Bacteria 6139
11 Ga0070689_100015697 3300005340 Bacteria 5529
12 Ga0070689_100117656 3300005340 Bacteria 2120
13 Ga0070687_100100573 3300005343 Bacteria 1618
14 Ga0070688_100188731 3300005365 Bacteria 1434
15 Ga0070710_10470529 3300005437 Bacteria 855
16 Ga0070701_10075617 3300005438 Bacteria 1811
17 Ga0070711_100833629 3300005439 Unclassified 784
18 Ga0070700_100230954 3300005441 Bacteria 1317
19 Ga0070694_100216986 3300005444 Bacteria 1433
20 Ga0070681_10463081 3300005458 Bacteria 1180
21 Ga0070681_11002670 3300005458 Bacteria 755
22 Ga0070706_100013551 3300005467 Bacteria 7538
23 Ga0070698_100002435 3300005471 Bacteria 20509
24 Ga0070698_100471335 3300005471 Bacteria 1192
25 Ga0070699_100287643 3300005518 Bacteria 1473
26 Ga0070679_100001251 3300005530 Bacteria 22398
27 Ga0070679_100488168 3300005530 Bacteria 1176
28 Ga0070679_101374499 3300005530 Bacteria 652
29 Ga0070695_100410233 3300005545 Bacteria 1029
30 Ga0070665_100003503 3300005548 Bacteria 16701
31 Ga0070665_100996493 3300005548 Bacteria 850
32 Ga0070704_100120701 3300005549 Bacteria 2013
33 Ga0068855_100993227 3300005563 Bacteria 882
34 Ga0068857_101260714 3300005577 Unclassified 717
35 Ga0068856_100121323 3300005614 Bacteria 2615
36 Ga0070702_100246889 3300005615 Bacteria 1208
37 Ga0070702_100890968 3300005615 Unclassified 696
38 Ga0068859_100031274 3300005617 Bacteria 5344
39 Ga0068859_100849358 3300005617 Bacteria 999
40 Ga0068859_101175521 3300005617 Bacteria 845
41 Ga0068864_100074683 3300005618 Bacteria 2958
42 Ga0068864_100379116 3300005618 Bacteria 1340
43 Ga0068861_100026222 3300005719 Bacteria 4236
44 Ga0068863_100118658 3300005841 Bacteria 2522
45 Ga0068863_100184771 3300005841 Bacteria 2002
46 Ga0068858_100677586 3300005842 Unclassified 1003
47 Ga0070717_10023776 3300006028 Bacteria 4859
48 Ga0070717_10046488 3300006028 Bacteria 3551
49 Ga0068871_101152764 3300006358 Unclassified 726
50 Ga0075428_100541026 3300006844 Unclassified 1245
51 Ga0075430_100902602 3300006846 Bacteria 728
52 Ga0075433_10784040 3300006852 Bacteria 833
53 Ga0068865_100090181 3300006881 Bacteria 2222
54 Ga0075436_100203692 3300006914 Bacteria 1402
55 Ga0097620_100031274 3300006931 Bacteria 5344
56 Ga0097620_100849472 3300006931 Bacteria 999
57 Ga0097620_101175588 3300006931 Bacteria 845
58 Ga0075435_100090154 3300007076 Bacteria 2529
59 Ga0075435_100198935 3300007076 Unclassified 1698
60 Ga0105240_11008358 3300009093 Bacteria 890
61 Ga0111539_10047645 3300009094 Bacteria 5122
62 Ga0111539_10870058 3300009094 Unclassified 1048
63 Ga0105245_10000008 3300009098 Bacteria 279925
64 Ga0105245_10363232 3300009098 Bacteria 1437
65 Ga0105245_11539007 3300009098 Bacteria 716
66 Ga0105247_10623892 3300009101 Bacteria 802
67 Ga0105243_10296438 3300009148 Bacteria 1463
68 Ga0105241_10278878 3300009174 Bacteria 1427
69 Ga0105248_10571271 3300009177 Unclassified 1276
70 Ga0105239_10500263 3300010375 Bacteria 1382
71 Ga0105246_11293336 3300011119 Bacteria 675
72 Ga0157374_10115124 3300013296 Bacteria 2589
73 Ga0157378_10052147 3300013297 Bacteria 3639
74 Ga0157372_10963118 3300013307 Bacteria 989
75 Ga0157376_10325669 3300014969 Bacteria 1462
76 Ga0157376_10608448 3300014969 Unclassified 1088
77 Ga0213874_10091895 3300021377 Bacteria 998
78 Ga0207642_10124368 3300025899 Bacteria 1336
79 Ga0207710_10379257 3300025900 Bacteria 723
80 Ga0207705_10435146 3300025909 Unclassified 1016
81 Ga0207684_10162922 3300025910 Unclassified 1921
82 Ga0207707_10424425 3300025912 Bacteria 1140
83 Ga0207707_10585447 3300025912 Bacteria 946
84 Ga0207695_10671122 3300025913 Bacteria 917
85 Ga0207660_10398131 3300025917 Bacteria 1109
86 Ga0207662_10027223 3300025918 Bacteria 3300
87 Ga0207652_10006560 3300025921 Bacteria 9380
88 Ga0207652_10759063 3300025921 Bacteria 863
89 Ga0207652_10872867 3300025921 Unclassified 796
90 Ga0207650_10573784 3300025925 Bacteria 947
91 Ga0207687_10000071 3300025927 Bacteria 77050
92 Ga0207687_10172247 3300025927 Bacteria 1670
93 Ga0207709_10250503 3300025935 Bacteria 1293
94 Ga0207670_10086579 3300025936 Bacteria 2205
95 Ga0207670_10390008 3300025936 Bacteria 1111
96 Ga0207704_10053964 3300025938 Bacteria 2447
97 Ga0207711_10156351 3300025941 Bacteria 2061
98 Ga0207689_10028130 3300025942 Bacteria 4701
99 Ga0207689_10126739 3300025942 Bacteria 2100
100 Ga0207689_10557171 3300025942 Bacteria 963
101 Ga0207667_10559084 3300025949 Bacteria 1157
102 Ga0207712_10400849 3300025961 Unclassified 1153
103 Ga0207703_10608463 3300026035 Bacteria 1034
104 Ga0207708_10104407 3300026075 Bacteria 2196
105 Ga0207702_10179979 3300026078 Bacteria 1946
106 Ga0207641_10048529 3300026088 Bacteria 3583
107 Ga0207676_10080451 3300026095 Bacteria 2645
108 Ga0207676_10631174 3300026095 Bacteria 1032
109 Ga0207675_100045765 3300026118 Bacteria 4088
110 Ga0207675_100087138 3300026118 Bacteria 2932
111 Ga0207683_10024553 3300026121 Bacteria 5193
112 Ga0207428_10211408 3300027907 Bacteria 1457
113 Ga0268266_10005513 3300028379 Bacteria 11779
114 Ga0268266_10484974 3300028379 Bacteria 1179
115 Ga0268265_10434120 3300028380 Unclassified 1223
116 Ga0268264_10150851 3300028381 Bacteria 2083
117 Ga0307517_10052102 3300028786 Bacteria 4111
118 Ga0265338_10134057 3300028800 Bacteria 1950
119 Ga0265338_10529220 3300028800 Bacteria 827
120 Ga0265332_10004191 3300031238 Bacteria 6826
121 Ga0307509_10000065 3300031507 Bacteria 142674
122 Ga0307509_10016021 3300031507 Bacteria 8698
123 Ga0307509_10064129 3300031507 Bacteria 3866
124 Ga0307509_10299014 3300031507 Unclassified 1359
125 Ga0307408_100591507 3300031548 Bacteria 985
126 Ga0307508_10044681 3300031616 Bacteria 3961
127 Ga0307508_10321673 3300031616 Bacteria 1139
128 Ga0265314_10099045 3300031711 Bacteria 1879
129 Ga0307406_10081273 3300031901 Bacteria 2154
130 Ga0307412_10586202 3300031911 Bacteria 942
131 Ga0307415_100071150 3300032126 Bacteria 2445
132 Ga0307415_100143370 3300032126 Bacteria 1828
133 Ga0373949_0000251 3300035090 Bacteria 20226
134 Ga0373941_0182345 3300035115 Bacteria 789
135 Ga0373961_0000072 3300035241 Bacteria 54778
136 Ga0373937_0437837 3300036401 Bacteria 1241
137 Ga0395899_0005050 3300037312 Bacteria 10264
138 Ga0395900_0105979 3300037418 Unclassified 2887
139 Ga0395898_0178372 3300037466 Unclassified 2030
140 Ga0395905_0300253 3300037471 Bacteria 1493
141 Ga0395905_0568593 3300037471 Bacteria 1035
142 Ga0395905_0590766 3300037471 Bacteria 1012
143 Ga0395905_0665663 3300037471 Unclassified 943
144 Ga0395901_0024602 3300038443 Bacteria 6184
145 Ga0436365_1591546 3300039437 Bacteria 986
146 Ga0436363_1628182 3300039450 Bacteria 1619
147 Ga0436362_0636347 3300039453 Unclassified 868
148 Ga0451807_1691755 3300041486 Unclassified 613
149 Ga0451577_0343602 3300042876 Bacteria 1354
150 Ga0466961_0156652 3300044693 Unclassified 1421
151 Ga0466967_0143881 3300045976 Bacteria 2223
152 Ga0466967_1323161 3300045976 Unclassified 718
153 Ga0495650_0024627 3300046471 Bacteria 2839
154 Ga0495622_0251126 3300046557 Bacteria 778
155 Ga0495649_0340330 3300046694 Bacteria 759
156 Ga0495686_0136324 3300047472 Bacteria 1451
157 Ga0496109_0699872 3300048912 Bacteria 951
158 Ga0496115_0653537 3300048918 Bacteria 831
159 Ga0501034_0105761 3300049571 Bacteria 2807
160 Ga0501034_0576166 3300049571 Bacteria 1033
161 Ga0501043_0185921 3300049579 Bacteria 1618
162 Ga0501046_0182005 3300049580 Bacteria 1571
163 Ga0501047_0012137 3300049581 Bacteria 8154
164 Ga0501047_0138627 3300049581 Bacteria 2311
165 Ga0501047_0542246 3300049581 Bacteria 988
166 Ga0501069_0020642 3300049585 Bacteria 3570
167 Ga0501070_0071293 3300049586 Bacteria 2877
168 Ga0501070_0082966 3300049586 Bacteria 2653
169 Ga0501070_0203787 3300049586 Unclassified 1624
170 Ga0501070_0227276 3300049586 Unclassified 1529
171 Ga0501070_0641945 3300049586 Bacteria 843
172 Ga0501071_0251332 3300049587 Bacteria 1334
173 Ga0501072_0020632 3300049588 Bacteria 5106
174 Ga0501073_0442723 3300049589 Bacteria 898
175 Ga0501074_0276516 3300049590 Bacteria 1194
176 Ga0501227_035194 3300049665 Bacteria 1217
177 Ga0501080_0124745 3300049742 Bacteria 2385
178 Ga0501083_0236122 3300049744 Unclassified 1190
179 Ga0501035_0819861 3300049822 Bacteria 742
180 Ga0501044_0140035 3300049823 Bacteria 2408
181 Ga0501044_0145818 3300049823 Bacteria 2353
182 nmdc:mga09592_19163_c1 3300050508 Bacteria 5614
183 nmdc:mga08y16_10982_c1 3300050511 Bacteria 9508
184 nmdc:mga0rr50_115151_c1 3300050513 Bacteria 2133
185 nmdc:mga0rr50_23667_c1 3300050513 Bacteria 4240
186 nmdc:mga08x19_565212_c1 3300050514 Unclassified 805
187 nmdc:mga08x19_662400_c1 3300050514 Bacteria 740
188 Ga0500635_0001750 3300053080 Bacteria 5293
189 Ga0500635_0205652 3300053080 Bacteria 766
190 Ga0500646_0070455 3300053090 Bacteria 1047
191 Ga0500647_0218292 3300053091 Unclassified 855
192 Ga0500566_0014242 3300053094 Bacteria 4676
193 Ga0500566_0029274 3300053094 Bacteria 3217
194 Ga0500566_0066895 3300053094 Bacteria 2024
195 Ga0500566_0197145 3300053094 Bacteria 1020
196 Ga0500640_005966 3300053095 Bacteria 4604
197 Ga0500554_000416 3300053102 Bacteria 9016
198 Ga0500595_000222 3300053119 Bacteria 38935
199 Ga0500597_036648 3300053120 Bacteria 2047
200 Ga0500608_127514 3300053122 Bacteria 1145
201 Ga0500614_000228 3300053123 Bacteria 14619
202 Ga0500614_003867 3300053123 Bacteria 3201
203 Ga0500642_0003529 3300053130 Bacteria 4744
204 Ga0500642_0183281 3300053130 Bacteria 978
205 Ga0500658_0193961 3300053134 Bacteria 928
206 Ga0500559_0002974 3300053136 Bacteria 8519
207 Ga0500568_0042495 3300053139 Unclassified 1821
208 Ga0500585_012947 3300053144 Bacteria 2527
209 Ga0500622_0132062 3300053156 Unclassified 1199
210 Ga0500630_026567 3300053159 Bacteria 2853
211 Ga0500639_179246 3300053163 Bacteria 939
212 Ga0500636_0029238 3300053177 Bacteria 3255
213 Ga0501084_0582284 3300054114 Unclassified 946
214 Ga0070707_100608570
215 Ga0070683_100045952
216 Ga0070683_100477868
217 Ga0070690_100489174
218 Ga0070670_100696638
219 Ga0068869_100038185
220 Ga0070680_100209316
221 Ga0070682_100168921
222 Ga0068868_100417002
223 Ga0070689_100012401
224 Ga0070689_100015697
225 Ga0070689_100117656
226 Ga0070687_100100573
227 Ga0070688_100188731
228 Ga0070710_10470529
229 Ga0070701_10075617
230 Ga0070711_100833629
231 Ga0070700_100230954
232 Ga0070694_100216986
233 Ga0070681_10463081
234 Ga0070681_11002670
235 Ga0070706_100013551
236 Ga0070698_100002435
237 Ga0070698_100471335
238 Ga0070699_100287643
239 Ga0070679_100001251
240 Ga0070679_100488168
241 Ga0070679_101374499
242 Ga0070695_100410233
243 Ga0070665_100003503
244 Ga0070665_100996493
245 Ga0070704_100120701
246 Ga0068855_100993227
247 Ga0068857_101260714
248 Ga0068856_100121323
249 Ga0070702_100246889
250 Ga0070702_100890968
251 Ga0068859_100031274
252 Ga0068859_100849358
253 Ga0068859_101175521
254 Ga0068864_100074683
255 Ga0068864_100379116
256 Ga0068861_100026222
257 Ga0068863_100118658
258 Ga0068863_100184771
259 Ga0068858_100677586
260 Ga0070717_10023776
261 Ga0070717_10046488
262 Ga0068871_101152764
263 Ga0075428_100541026
264 Ga0075430_100902602
265 Ga0075433_10784040
266 Ga0068865_100090181
267 Ga0075436_100203692
268 Ga0097620_100031274
269 Ga0097620_100849472
270 Ga0097620_101175588
271 Ga0075435_100090154
272 Ga0075435_100198935
273 Ga0105240_11008358
274 Ga0111539_10047645
275 Ga0111539_10870058
276 Ga0105245_10000008
277 Ga0105245_10363232
278 Ga0105245_11539007
279 Ga0105247_10623892
280 Ga0105243_10296438
281 Ga0105241_10278878
282 Ga0105248_10571271
283 Ga0105239_10500263
284 Ga0105246_11293336
285 Ga0157374_10115124
286 Ga0157378_10052147
287 Ga0157372_10963118
288 Ga0157376_10325669
289 Ga0157376_10608448
290 Ga0213874_10091895
291 Ga0207642_10124368
292 Ga0207710_10379257
293 Ga0207705_10435146
294 Ga0207684_10162922
295 Ga0207707_10424425
296 Ga0207707_10585447
297 Ga0207695_10671122
298 Ga0207660_10398131
299 Ga0207662_10027223
300 Ga0207652_10006560
301 Ga0207652_10759063
302 Ga0207652_10872867
303 Ga0207650_10573784
304 Ga0207687_10000071
305 Ga0207687_10172247
306 Ga0207709_10250503
307 Ga0207670_10086579
308 Ga0207670_10390008
309 Ga0207704_10053964
310 Ga0207711_10156351
311 Ga0207689_10028130
312 Ga0207689_10126739
313 Ga0207689_10557171
314 Ga0207667_10559084
315 Ga0207712_10400849
316 Ga0207703_10608463
317 Ga0207708_10104407
318 Ga0207702_10179979
319 Ga0207641_10048529
320 Ga0207676_10080451
321 Ga0207676_10631174
322 Ga0207675_100045765
323 Ga0207675_100087138
324 Ga0207683_10024553
325 Ga0207428_10211408
326 Ga0268266_10005513
327 Ga0268266_10484974
328 Ga0268265_10434120
329 Ga0268264_10150851
330 Ga0307517_10052102
331 Ga0265338_10134057
332 Ga0265338_10529220
333 Ga0265332_10004191
334 Ga0307509_10000065
335 Ga0307509_10016021
336 Ga0307509_10064129
337 Ga0307509_10299014
338 Ga0307408_100591507
339 Ga0307508_10044681
340 Ga0307508_10321673
341 Ga0265314_10099045
342 Ga0307406_10081273
343 Ga0307412_10586202
344 Ga0307415_100071150
345 Ga0307415_100143370
346 Ga0373949_0000251
347 Ga0373941_0182345
348 Ga0373961_0000072
349 Ga0373937_0437837
350 Ga0395899_0005050
351 Ga0395900_0105979
352 Ga0395898_0178372
353 Ga0395905_0300253
354 Ga0395905_0568593
355 Ga0395905_0590766
356 Ga0395905_0665663
357 Ga0395901_0024602
358 Ga0436365_1591546
359 Ga0436363_1628182
360 Ga0436362_0636347
361 Ga0451807_1691755
362 Ga0451577_0343602
363 Ga0466961_0156652
364 Ga0466967_0143881
365 Ga0466967_1323161
366 Ga0495650_0024627
367 Ga0495622_0251126
368 Ga0495649_0340330
369 Ga0495686_0136324
370 Ga0496109_0699872
371 Ga0496115_0653537
372 Ga0501034_0105761
373 Ga0501034_0576166
374 Ga0501043_0185921
375 Ga0501046_0182005
376 Ga0501047_0012137
377 Ga0501047_0138627
378 Ga0501047_0542246
379 Ga0501069_0020642
380 Ga0501070_0071293
381 Ga0501070_0082966
382 Ga0501070_0203787
383 Ga0501070_0227276
384 Ga0501070_0641945
385 Ga0501071_0251332
386 Ga0501072_0020632
387 Ga0501073_0442723
388 Ga0501074_0276516
389 Ga0501227_035194
390 Ga0501080_0124745
391 Ga0501083_0236122
392 Ga0501035_0819861
393 Ga0501044_0140035
394 Ga0501044_0145818
395 nmdc:mga09592_19163_c1
396 nmdc:mga08y16_10982_c1
397 nmdc:mga0rr50_115151_c1
398 nmdc:mga0rr50_23667_c1
399 nmdc:mga08x19_565212_c1
400 nmdc:mga08x19_662400_c1
401 Ga0500635_0001750
402 Ga0500635_0205652
403 Ga0500646_0070455
404 Ga0500647_0218292
405 Ga0500566_0014242
406 Ga0500566_0029274
407 Ga0500566_0066895
408 Ga0500566_0197145
409 Ga0500640_005966
410 Ga0500554_000416
411 Ga0500595_000222
412 Ga0500597_036648
413 Ga0500608_127514
414 Ga0500614_000228
415 Ga0500614_003867
416 Ga0500642_0003529
417 Ga0500642_0183281
418 Ga0500658_0193961
419 Ga0500559_0002974
420 Ga0500568_0042495
421 Ga0500585_012947
422 Ga0500622_0132062
423 Ga0500630_026567
424 Ga0500639_179246
425 Ga0500636_0029238
426 Ga0501084_0582284

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rob-assembly2.cif.gz_D the crystal structure of a conserved protein from planctomyces limnophilus dsm 3776 0.8318 37 166
3d9r-assembly2.cif.gz_D crystal structure of ketosteroid isomerase-like protein (yp_049581.1) from erwinia carotovora atroseptica scri1043 at 2.40 a resolution 0.7723 34 166
3rob-assembly2.cif.gz_D the crystal structure of a conserved protein from planctomyces limnophilus dsm 3776 0.7601 37 166
5ien-assembly2.cif.gz_B structure of cdl2.2, a computationally designed vitamin-d3 binder 0.7568 36 166
4ovm-assembly3.cif.gz_F crystal structure of sgcj protein from streptomyces carzinostaticus 0.7505 35 166
ID Description Score Start End Superfamily
af_P9WL25_11_145_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8043 40 167 3.10.450.50
2r4iB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8031 36 167 3.10.450.50
3d9rD00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7827 34 166 3.10.450.50
af_Q95XM3_640_752_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7675 41 167 3.10.450.50
2r4iB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7667 36 167 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A7W0QD29-F1-model_v4 Lipoprotein 0.9704 17 168
AF-A0A3M2DTW0-F1-model_v4 Uncharacterized protein 0.9432 17 168
AF-A0A538RKS5-F1-model_v4 Lipoprotein 0.9376 16 168
AF-A0A7W0QD29-F1-model_v4 Lipoprotein 0.934 17 168
AF-A0A1M3MXW1-F1-model_v4 SnoaL-like domain-containing protein 0.9262 21 168

Map